metagRoot

F435818

General Info

Members	Datasets	Scaffolds	Average Seq Length
404	251	392	476

Family's Representative Sequence

Representative Sequence	3300053118\|Ga0500594_0003657\|Ga0500594_0003657_253_1827
Length	524
Sequence	LLHDASIVEVILPGESWMDIVRLALTTGLLFVPALGFAQQASPLVSQGATAQGDVAVTIYNNNLALVQDVRQISLPQGRSRQEFPDVSAQIRPETVTLSGDGFGIIEQNFDYDLLSPSALMEKAVGQQITLLRTNPATGAETRERATVLAANGGVVLKIGERIEVLRDDGLPMRVIFDGIPPNLRARPTLSVTLEAERAGARPLTLSYLTPGIGWKSDYVALFDEAAGKIDVQGWITLSNNSGTTFSNARALLVAGEVAQVQQGYGDYRPRQPPVPRGNRPGSESGNSEQLGDFHVYPITGRTTIANAQTKQVSFLDASGVPARKGYEYRNAWLGNQGEAQSAASILKFSNARASGIGATLPAGTVRVYMRDTHGQAQFIGESSIPHTPGGSSLALRTGDAFDVKVQPVLEKRDNITLDEWQRYARWRVVTTEGGEQKVSEGYAEQPKTYYRTQMRYIVTNARSVPVTVDVVQAGLNQWXXXRDIRVPEESITGLQDNADTRRWEVPVPANGKTELTVTFLTPW

Samples

	Sample ID	Description	Type	Environment
1	2512564014	Sphingobium sp. AP49	Isolate	Rhizosphere
2	2643221560	Sphingopyxis sp. Root1497	Isolate	Unclassified
3	2643221563	Sphingopyxis sp. Root154	Isolate	Unclassified
4	2643221608	Sphingopyxis sp. Root214	Isolate	Unclassified
5	2751185897	Sphingomonas panacis DCY99	Isolate	Unclassified
6	2808606401	Sphingobium sp. AEW010	Isolate	Rhizosphere
7	2808606404	Sphingobium sp. AEW013	Isolate	Rhizosphere
8	2808606405	Sphingobium sp. AEW001	Isolate	Rhizosphere
9	2852653556	Sphingopyxis sp. JAI108	Isolate	Rhizosphere
10	2852680915	Sphingopyxis sp. JAI128	Isolate	Rhizosphere
11	2880518877	Sphingobium sp. JAI105	Isolate	Rhizosphere
12	2919709256	Sphingobium xenophagum 4256	Isolate	Unclassified
13	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
14	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
15	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
16	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
17	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
18	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
19	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
20	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
21	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
22	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
23	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
24	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
25	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
26	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
27	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
28	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
29	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
30	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
31	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
32	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
33	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
34	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
35	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
36	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
37	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
38	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
39	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
40	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
41	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
42	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
43	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
44	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
45	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
46	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
47	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
48	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
49	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
50	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
51	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
52	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
53	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
54	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
55	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
56	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
57	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
58	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
59	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
60	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
61	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
62	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
63	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
64	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
65	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
66	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
67	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
68	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
69	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
70	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
71	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
72	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
73	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
74	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
75	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
76	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
77	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
78	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
79	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
80	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
81	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
82	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
83	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
84	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
85	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
86	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
87	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
88	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
89	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
90	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
91	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
92	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
93	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
94	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
95	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
96	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
97	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
98	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
99	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
100	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
101	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
102	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
103	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
135	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
139	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
140	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
141	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
142	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
143	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
144	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
145	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
146	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
147	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
148	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
149	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
150	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
151	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
152	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
153	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
154	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
155	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
156	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
157	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
158	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
159	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
160	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
161	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
162	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
163	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
164	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
165	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
166	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
167	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
168	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
169	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
170	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
171	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
172	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
173	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
174	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
175	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
176	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
177	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
178	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
179	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
180	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
181	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
182	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
183	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
184	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
185	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
186	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
187	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
188	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
189	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
190	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
191	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
192	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
193	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
194	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
195	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
196	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
197	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
198	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
199	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
200	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
201	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
202	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
203	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
204	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
205	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
206	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
207	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
208	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
209	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
210	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
211	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
212	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
213	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
214	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
215	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
216	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
217	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
218	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
219	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
220	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
221	3300049664	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought	Metagenome	Rhizosphere
222	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
223	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
224	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
225	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
226	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
227	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
228	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
229	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
230	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
231	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
232	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
233	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
234	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
235	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
236	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
237	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
238	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
239	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
240	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
241	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
242	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
243	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
244	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
245	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
246	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
247	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
248	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
249	3300053723	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere	Metagenome	Endosphere
250	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
251	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97.03
Metatranscriptomes	0
Isolates	2.97

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	21.78
Nodule	0.25
Rhizoplane	2.48
Rhizosphere	66.09
Stem	0
Stem Tuber	0
Unclassified	9.41

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24741J21665_1000063	3300001915	Bacteria	25937
2	JGI24741J21665_1002247	3300001915	Bacteria	5096
3	JGI24740J21852_10006371	3300001979	Bacteria	4894
4	JGI24739J22299_10012436	3300001989	Bacteria	3126
5	JGI24737J22298_10000198	3300001990	Bacteria	19568
6	JGI24738J21930_10000753	3300002075	Bacteria	9296
7	JGI25150J39212_1000044	3300002774	Bacteria	83125
8	JGI25151J46595_10007071	3300003187	Bacteria	5543
9	JGI25165J46597_1000021	3300003214	Bacteria	359288
10	JGI25153J46596_10000043	3300003215	Bacteria	156407
11	Ga0055537_1011197	3300003773	Bacteria	1838
12	Ga0055524_1000616	3300003775	Bacteria	25523
13	Ga0055536_1002860	3300003781	Bacteria	9506
14	Ga0055536_1005464	3300003781	Bacteria	6204
15	Ga0055536_1015803	3300003781	Bacteria	2561
16	Ga0055530_10000156	3300003791	Bacteria	61575
17	Ga0055540_1003097	3300003792	Bacteria	8263
18	Ga0055531_10002786	3300003794	Bacteria	11469
19	Ga0055531_10002954	3300003794	Bacteria	11057
20	Ga0055531_10031650	3300003794	Bacteria	1747
21	Ga0065165_1011229	3300005262	Bacteria	3765
22	Ga0065704_10075682	3300005289	Bacteria	5446
23	Ga0065704_10100779	3300005289	Bacteria	2261
24	Ga0065704_10112372	3300005289	Bacteria	1935
25	Ga0065707_10082133	3300005295	Bacteria	21190
26	Ga0070658_10000003	3300005327	Bacteria	465963
27	Ga0070670_100032568	3300005331	Bacteria	4489
28	Ga0070670_100057754	3300005331	Bacteria	3330
29	Ga0070666_10010632	3300005335	Bacteria	5761
30	Ga0070682_100058293	3300005337	Bacteria	2435
31	Ga0068868_100000090	3300005338	Bacteria	55967
32	Ga0070660_100001109	3300005339	Bacteria	18145
33	Ga0070660_100001199	3300005339	Bacteria	17568
34	Ga0070660_100007475	3300005339	Bacteria	7618
35	Ga0070660_100010348	3300005339	Bacteria	6589
36	Ga0070660_100021879	3300005339	Bacteria	4722
37	Ga0070661_100001581	3300005344	Bacteria	15794
38	Ga0070661_100009676	3300005344	Bacteria	6683
39	Ga0070692_10005312	3300005345	Bacteria	5476
40	Ga0070668_100000021	3300005347	Bacteria	96397
41	Ga0070668_100001640	3300005347	Bacteria	16223
42	Ga0070668_100002639	3300005347	Bacteria	13171
43	Ga0070668_100008751	3300005347	Bacteria	7519
44	Ga0070669_100000149	3300005353	Bacteria	62788
45	Ga0070669_100006179	3300005353	Bacteria	8644
46	Ga0070675_100066525	3300005354	Unclassified	2981
47	Ga0070671_100000612	3300005355	Bacteria	25487
48	Ga0070671_100007008	3300005355	Bacteria	9030
49	Ga0070674_100014179	3300005356	Bacteria	4949
50	Ga0070674_100018341	3300005356	Bacteria	4423
51	Ga0070674_100069078	3300005356	Unclassified	2491
52	Ga0070659_100000017	3300005366	Bacteria	163966
53	Ga0070659_100020593	3300005366	Bacteria	5013
54	Ga0070659_100028605	3300005366	Bacteria	4306
55	Ga0070667_100000548	3300005367	Bacteria	37357
56	Ga0070667_100002797	3300005367	Bacteria	15061
57	Ga0070667_100035685	3300005367	Bacteria	4167
58	Ga0070663_100015604	3300005455	Bacteria	4910
59	Ga0070662_100015984	3300005457	Bacteria	5034
60	Ga0068853_100056097	3300005539	Bacteria	3396
61	Ga0070672_100006005	3300005543	Bacteria	8107
62	Ga0070665_100000207	3300005548	Bacteria	102416
63	Ga0070665_100000568	3300005548	Bacteria	51571
64	Ga0070665_100002230	3300005548	Bacteria	21591
65	Ga0070665_100002260	3300005548	Bacteria	21401
66	Ga0068855_100137637	3300005563	Bacteria	2785
67	Ga0068857_100092864	3300005577	Bacteria	2702
68	Ga0068857_100102457	3300005577	Bacteria	2569
69	Ga0068856_100003500	3300005614	Bacteria	15852
70	Ga0068852_100012869	3300005616	Bacteria	6378
71	Ga0068859_100030769	3300005617	Bacteria	5387
72	Ga0068861_100000115	3300005719	Bacteria	40462
73	Ga0068851_10029416	3300005834	Bacteria	2720
74	Ga0068851_10076443	3300005834	Bacteria	1741
75	Ga0068863_100000043	3300005841	Bacteria	153935
76	Ga0068863_100000225	3300005841	Bacteria	59865
77	Ga0068863_100029179	3300005841	Bacteria	5266
78	Ga0068858_100000444	3300005842	Bacteria	43311
79	Ga0068860_100007599	3300005843	Bacteria	10848
80	Ga0068860_100008571	3300005843	Bacteria	10193
81	Ga0068860_100023600	3300005843	Bacteria	5945
82	Ga0068860_100032246	3300005843	Bacteria	5035
83	Ga0068862_100000036	3300005844	Bacteria	173453
84	Ga0068862_100006233	3300005844	Bacteria	9931
85	Ga0068862_100006851	3300005844	Bacteria	9449
86	Ga0068862_100041082	3300005844	Bacteria	3934
87	Ga0075368_10000267	3300006042	Bacteria	14951
88	Ga0075363_100000443	3300006048	Bacteria	12980
89	Ga0075363_100006261	3300006048	Bacteria	5388
90	Ga0075364_10006884	3300006051	Bacteria	6711
91	Ga0075364_10014389	3300006051	Bacteria	4888
92	Ga0075362_10000023	3300006177	Bacteria	60275
93	Ga0075362_10000752	3300006177	Bacteria	9648
94	Ga0075367_10000262	3300006178	Bacteria	18034
95	Ga0075369_10000697	3300006186	Bacteria	10787
96	Ga0075369_10004198	3300006186	Bacteria	5308
97	Ga0075369_10009505	3300006186	Bacteria	3780
98	Ga0075366_10000034	3300006195	Bacteria	47623
99	Ga0075370_10000009	3300006353	Bacteria	97850
100	Ga0075370_10004571	3300006353	Bacteria	6743
101	Ga0097620_100030769	3300006931	Bacteria	5387
102	Ga0079104_1019871	3300006946	Bacteria	1865
103	Ga0105251_10030200	3300009011	Bacteria	2724
104	Ga0105250_10020266	3300009092	Bacteria	2689
105	Ga0105240_10171680	3300009093	Bacteria	2568
106	Ga0105245_10045290	3300009098	Bacteria	3928
107	Ga0105247_10011248	3300009101	Bacteria	5398
108	Ga0105243_10096893	3300009148	Bacteria	2441
109	Ga0105241_10007488	3300009174	Bacteria	8036
110	Ga0105248_10012619	3300009177	Bacteria	9323
111	Ga0105248_10021259	3300009177	Bacteria	7190
112	Ga0105238_10196386	3300009551	Bacteria	1994
113	Ga0105249_10000024	3300009553	Bacteria	232947
114	Ga0105249_10000427	3300009553	Bacteria	40134
115	Ga0105249_10023565	3300009553	Bacteria	5525
116	Ga0105249_10052645	3300009553	Bacteria	3718
117	Ga0105249_10099732	3300009553	Bacteria	2730
118	Ga0157371_10047209	3300013102	Bacteria	3062
119	Ga0163162_10031040	3300013306	Bacteria	5298
120	Ga0163162_10033555	3300013306	Bacteria	5101
121	Ga0163162_10065730	3300013306	Bacteria	3674
122	Ga0163163_10037349	3300014325	Bacteria	4725
123	Ga0157380_10014436	3300014326	Bacteria	5778
124	Ga0157380_10114724	3300014326	Bacteria	2271
125	Ga0163161_10029323	3300017792	Bacteria	3912
126	Ga0213873_10000057	3300021358	Bacteria	24447
127	Ga0213876_10000021	3300021384	Bacteria	260105
128	Ga0213876_10000473	3300021384	Bacteria	32032
129	Ga0209437_105010	3300025233	Bacteria	2286
130	Ga0207425_1000047	3300025245	Bacteria	189158
131	Ga0209129_1000497	3300025258	Bacteria	28640
132	Ga0209233_1000065	3300025261	Bacteria	387195
133	Ga0209565_1000548	3300025263	Bacteria	26162
134	Ga0209673_1001896	3300025273	Bacteria	16783
135	Ga0209675_1000287	3300025291	Bacteria	47834
136	Ga0209676_1000343	3300025292	Bacteria	88398
137	Ga0209676_1002799	3300025292	Bacteria	11562
138	Ga0209676_1002813	3300025292	Bacteria	11517
139	Ga0209676_1010550	3300025292	Bacteria	3830
140	Ga0209025_1000150	3300025294	Bacteria	172834
141	Ga0209758_1000009	3300025297	Bacteria	1123483
142	Ga0209758_1027704	3300025297	Bacteria	2415
143	Ga0209050_1000005	3300025298	Bacteria	1557793
144	Ga0209050_1000423	3300025298	Bacteria	78194
145	Ga0209050_1003854	3300025298	Bacteria	10676
146	Ga0209050_1014916	3300025298	Bacteria	3305
147	Ga0209256_1001341	3300025299	Bacteria	26162
148	Ga0209051_1000396	3300025303	Bacteria	60690
149	Ga0209257_1000267	3300025304	Bacteria	119949
150	Ga0209257_1000337	3300025304	Bacteria	97941
151	Ga0209257_1001283	3300025304	Bacteria	30714
152	Ga0209257_1004113	3300025304	Bacteria	11623
153	Ga0209257_1007963	3300025304	Bacteria	6203
154	Ga0209257_1009476	3300025304	Bacteria	5196
155	Ga0207656_10004027	3300025321	Bacteria	5098
156	Ga0207713_1004973	3300025735	Bacteria	8489
157	Ga0207710_10002229	3300025900	Bacteria	9103
158	Ga0207688_10100098	3300025901	Bacteria	1673
159	Ga0207680_10016588	3300025903	Bacteria	3871
160	Ga0207647_10019116	3300025904	Bacteria	4613
161	Ga0207705_10000005	3300025909	Bacteria	673478
162	Ga0207695_10109034	3300025913	Bacteria	2751
163	Ga0207695_10169083	3300025913	Bacteria	2113
164	Ga0207657_10000530	3300025919	Bacteria	40507
165	Ga0207657_10003138	3300025919	Bacteria	17677
166	Ga0207657_10014376	3300025919	Bacteria	7729
167	Ga0207657_10014536	3300025919	Bacteria	7676
168	Ga0207657_10022449	3300025919	Bacteria	5902
169	Ga0207657_10029163	3300025919	Bacteria	5027
170	Ga0207649_10000134	3300025920	Bacteria	63335
171	Ga0207649_10127259	3300025920	Bacteria	1726
172	Ga0207681_10000296	3300025923	Bacteria	36730
173	Ga0207659_10019344	3300025926	Bacteria	4481
174	Ga0207644_10000077	3300025931	Bacteria	72394
175	Ga0207644_10002535	3300025931	Bacteria	11749
176	Ga0207690_10000035	3300025932	Bacteria	149201
177	Ga0207690_10017725	3300025932	Bacteria	4354
178	Ga0207706_10039860	3300025933	Bacteria	4164
179	Ga0207669_10002781	3300025937	Bacteria	7503
180	Ga0207669_10010990	3300025937	Bacteria	4384
181	Ga0207691_10001517	3300025940	Bacteria	23102
182	Ga0207711_10027735	3300025941	Bacteria	4759
183	Ga0207651_10065091	3300025960	Bacteria	2555
184	Ga0207712_10000034	3300025961	Bacteria	202320
185	Ga0207712_10000362	3300025961	Bacteria	40217
186	Ga0207712_10004708	3300025961	Bacteria	8619
187	Ga0207712_10039343	3300025961	Bacteria	3239
188	Ga0207712_10057986	3300025961	Bacteria	2734
189	Ga0207668_10000003	3300025972	Bacteria	206959
190	Ga0207668_10000068	3300025972	Bacteria	81202
191	Ga0207668_10000311	3300025972	Bacteria	31842
192	Ga0207668_10001525	3300025972	Bacteria	13545
193	Ga0207658_10000402	3300025986	Bacteria	41365
194	Ga0207658_10000472	3300025986	Bacteria	37417
195	Ga0207658_10005614	3300025986	Bacteria	8580
196	Ga0207677_10000317	3300026023	Bacteria	35378
197	Ga0207703_10000974	3300026035	Bacteria	27552
198	Ga0207703_10005814	3300026035	Bacteria	9880
199	Ga0207639_10000100	3300026041	Bacteria	70921
200	Ga0207639_10107622	3300026041	Bacteria	2265
201	Ga0207678_10000007	3300026067	Bacteria	179943
202	Ga0207678_10036211	3300026067	Bacteria	4296
203	Ga0207641_10000031	3300026088	Bacteria	224320
204	Ga0207641_10000367	3300026088	Bacteria	53540
205	Ga0207641_10005160	3300026088	Bacteria	11170
206	Ga0207648_10165310	3300026089	Unclassified	1955
207	Ga0207674_10003398	3300026116	Bacteria	19518
208	Ga0207674_10186075	3300026116	Bacteria	2027
209	Ga0207675_100000440	3300026118	Bacteria	40440
210	Ga0207698_10022342	3300026142	Bacteria	4393
211	Ga0209813_10000089	3300027866	Bacteria	33826
212	Ga0268266_10000171	3300028379	Bacteria	118317
213	Ga0268266_10000949	3300028379	Bacteria	36940
214	Ga0268266_10001802	3300028379	Bacteria	24277
215	Ga0268266_10015186	3300028379	Bacteria	6613
216	Ga0268265_10000052	3300028380	Bacteria	174254
217	Ga0268265_10004167	3300028380	Bacteria	10127
218	Ga0268265_10014042	3300028380	Bacteria	5455
219	Ga0268265_10014815	3300028380	Bacteria	5322
220	Ga0268265_10055162	3300028380	Bacteria	3018
221	Ga0268265_10092816	3300028380	Bacteria	2417
222	Ga0268264_10001809	3300028381	Bacteria	19543
223	Ga0268264_10005662	3300028381	Bacteria	10589
224	Ga0268264_10014293	3300028381	Bacteria	6527
225	Ga0268264_10023317	3300028381	Bacteria	5049
226	Ga0268264_10156726	3300028381	Bacteria	2047
227	Ga0307517_10016086	3300028786	Bacteria	9869
228	Ga0265338_10080863	3300028800	Bacteria	2728
229	Ga0265331_10008273	3300031250	Bacteria	5928
230	Ga0265327_10058689	3300031251	Bacteria	1974
231	Ga0307405_10092590	3300031731	Bacteria	2005
232	Ga0307413_10006583	3300031824	Bacteria	5321
233	Ga0307413_10045335	3300031824	Bacteria	2606
234	Ga0307410_10007673	3300031852	Bacteria	5920
235	Ga0307406_10058976	3300031901	Bacteria	2468
236	Ga0307412_10000639	3300031911	Bacteria	20384
237	Ga0307412_10005535	3300031911	Bacteria	7093
238	Ga0307412_10005795	3300031911	Bacteria	6948
239	Ga0307412_10031622	3300031911	Bacteria	3344
240	Ga0307409_100000902	3300031995	Bacteria	13761
241	Ga0307414_10001625	3300032004	Bacteria	11694
242	Ga0307414_10003506	3300032004	Bacteria	8384
243	Ga0307414_10025967	3300032004	Bacteria	3762
244	Ga0307414_10100627	3300032004	Bacteria	2174
245	Ga0307411_10004501	3300032005	Bacteria	6686
246	Ga0307411_10190250	3300032005	Bacteria	1566
247	Ga0307415_100057026	3300032126	Bacteria	2682
248	Ga0307510_10003239	3300033180	Bacteria	18925
249	Ga0307510_10049195	3300033180	Bacteria	4487
250	Ga0307510_10114829	3300033180	Bacteria	2419
251	Ga0395900_0091067	3300037418	Bacteria	3134
252	Ga0395900_0155532	3300037418	Bacteria	2335
253	Ga0395898_0034005	3300037466	Bacteria	5084
254	Ga0395898_0044911	3300037466	Bacteria	4345
255	Ga0395905_0004481	3300037471	Bacteria	14487
256	Ga0395905_0017232	3300037471	Bacteria	6860
257	Ga0395901_0007654	3300038443	Bacteria	10899
258	Ga0395901_0076411	3300038443	Bacteria	3494
259	Ga0395901_0096064	3300038443	Bacteria	3106
260	Ga0237819_01701	3300038705	Bacteria	5335
261	Ga0436365_0007432	3300039437	Bacteria	19428
262	Ga0436362_0599901	3300039453	Bacteria	16755
263	Ga0439436_0017777	3300041404	Bacteria	2127
264	Ga0439461_0004949	3300041410	Bacteria	2251
265	Ga0451841_0336377	3300041498	Bacteria	2415
266	Ga0439445_0009457	3300042004	Bacteria	2296
267	Ga0439457_002253	3300042014	Bacteria	5579
268	Ga0439462_0001967	3300042015	Bacteria	4698
269	Ga0495617_010643	3300046452	Bacteria	3151
270	Ga0495627_000171	3300046453	Bacteria	74013
271	Ga0495627_000427	3300046453	Bacteria	36547
272	Ga0495638_0000261	3300046460	Bacteria	70934
273	Ga0495638_0005175	3300046460	Bacteria	9755
274	Ga0495650_0000116	3300046471	Bacteria	189814
275	Ga0495650_0003869	3300046471	Bacteria	10610
276	Ga0495585_0002440	3300046492	Bacteria	13323
277	Ga0495583_0001297	3300046506	Bacteria	26035
278	Ga0495606_0048879	3300046507	Bacteria	2778
279	Ga0495610_0003333	3300046512	Bacteria	12606
280	Ga0495637_0004676	3300046520	Bacteria	7067
281	Ga0495643_0001399	3300046522	Bacteria	22471
282	Ga0495648_0018360	3300046524	Bacteria	4953
283	Ga0495648_0079966	3300046524	Bacteria	1864
284	Ga0495598_0000615	3300046537	Bacteria	6746
285	Ga0495621_0021128	3300046539	Bacteria	2143
286	Ga0495633_0000607	3300046558	Bacteria	34283
287	Ga0495668_0000015	3300046616	Bacteria	441932
288	Ga0495668_0000022	3300046616	Bacteria	363999
289	Ga0495611_0022766	3300046648	Bacteria	2713
290	Ga0495625_0001842	3300046660	Bacteria	24227
291	Ga0495625_0005163	3300046660	Bacteria	12049
292	Ga0495625_0005431	3300046660	Bacteria	11627
293	Ga0495625_0012602	3300046660	Bacteria	6842
294	Ga0495625_0062887	3300046660	Bacteria	2622
295	Ga0495613_0000905	3300046689	Bacteria	22815
296	Ga0495670_0000037	3300046691	Bacteria	77395
297	Ga0495649_0001055	3300046694	Bacteria	21601
298	Ga0495673_0028560	3300047469	Bacteria	2641
299	Ga0495681_0000038	3300047470	Bacteria	121100
300	Ga0495686_0056124	3300047472	Bacteria	2461
301	Ga0496100_0048665	3300048903	Bacteria	2737
302	Ga0496101_0014895	3300048904	Bacteria	5232
303	Ga0496102_0000366	3300048905	Bacteria	54318
304	Ga0496103_0000505	3300048906	Bacteria	32245
305	Ga0496104_0000252	3300048907	Bacteria	47534
306	Ga0496105_0000237	3300048908	Bacteria	37330
307	Ga0496107_0184317	3300048910	Bacteria	1550
308	Ga0496112_0011047	3300048915	Bacteria	8227
309	Ga0496113_0017861	3300048916	Bacteria	4931
310	Ga0496115_0017104	3300048918	Bacteria	5533
311	Ga0496116_0031861	3300048919	Bacteria	3766
312	Ga0496117_0017091	3300048920	Bacteria	6074
313	Ga0496117_0022884	3300048920	Bacteria	5003
314	Ga0496118_0112678	3300048921	Bacteria	1799
315	Ga0496119_0000121	3300048922	Bacteria	109164
316	Ga0496119_0042292	3300048922	Bacteria	2891
317	Ga0496120_0003207	3300048923	Bacteria	15197
318	Ga0496121_0001469	3300048924	Bacteria	39683
319	Ga0496121_0008330	3300048924	Bacteria	12246
320	Ga0496121_0008799	3300048924	Bacteria	11765
321	Ga0496121_0054132	3300048924	Bacteria	3356
322	Ga0496122_0010617	3300048925	Bacteria	9459
323	Ga0496122_0050893	3300048925	Bacteria	3154
324	Ga0496123_0024552	3300048926	Bacteria	4578
325	Ga0496123_0031822	3300048926	Bacteria	3830
326	Ga0496124_0000597	3300048927	Bacteria	60724
327	Ga0496124_0005387	3300048927	Bacteria	14445
328	Ga0496124_0012977	3300048927	Bacteria	8168
329	Ga0496124_0013314	3300048927	Bacteria	8038
330	Ga0496124_0070069	3300048927	Bacteria	2910
331	Ga0496124_0196399	3300048927	Bacteria	1539
332	Ga0496125_0134316	3300048928	Bacteria	1734
333	Ga0496126_0000045	3300048929	Bacteria	331225
334	Ga0496126_0241243	3300048929	Bacteria	1510
335	Ga0501031_0038672	3300049568	Bacteria	3113
336	Ga0501032_0004694	3300049569	Bacteria	10257
337	Ga0501033_0006186	3300049570	Bacteria	9384
338	Ga0501034_0027828	3300049571	Bacteria	5749
339	Ga0501034_0034823	3300049571	Bacteria	5106
340	Ga0501034_0046607	3300049571	Bacteria	4379
341	Ga0501036_0035202	3300049572	Bacteria	4236
342	Ga0501036_0204517	3300049572	Bacteria	1660
343	Ga0501037_0022274	3300049573	Bacteria	4687
344	Ga0501038_0100842	3300049574	Bacteria	2404
345	Ga0501039_0025674	3300049575	Bacteria	4528
346	Ga0501043_0013664	3300049579	Bacteria	6354
347	Ga0501043_0074988	3300049579	Bacteria	2657
348	Ga0501046_0074257	3300049580	Bacteria	2638
349	Ga0501047_0017814	3300049581	Bacteria	6804
350	Ga0501047_0152926	3300049581	Bacteria	2182
351	Ga0501223_000122	3300049663	Bacteria	22213
352	Ga0501224_000016	3300049664	Bacteria	86205
353	Ga0501235_019186	3300049669	Bacteria	1517
354	Ga0501249_000247	3300049679	Bacteria	16029
355	Ga0501225_0000905	3300049705	Bacteria	9220
356	Ga0501241_008235	3300049758	Bacteria	1905
357	Ga0501035_0024396	3300049822	Bacteria	5546
358	Ga0501044_0009593	3300049823	Bacteria	10532
359	Ga0501044_0033840	3300049823	Bacteria	5366
360	Ga0501226_000020	3300049853	Bacteria	141193
361	nmdc:mga03683_188_c1	3300050489	Bacteria	20373
362	nmdc:mga03683_295_c1	3300050489	Bacteria	14848
363	nmdc:mga03n38_15795_c1	3300050490	Bacteria	2923
364	nmdc:mga00v17_14537_c1	3300050491	Bacteria	4397
365	nmdc:mga00v17_4418_c1	3300050491	Bacteria	7314
366	nmdc:mga0k408_32398_c1	3300050493	Bacteria	2986
367	nmdc:mga0k408_3_c1	3300050493	Bacteria	243777
368	nmdc:mga04h51_94_c1	3300050495	Bacteria	27279
369	nmdc:mga07m45_1921_c1	3300050496	Bacteria	9606
370	nmdc:mga07m45_22_c1	3300050496	Bacteria	117399
371	nmdc:mga07m45_37346_c1	3300050496	Bacteria	2709
372	nmdc:mga07m45_6_c1	3300050496	Bacteria	260521
373	nmdc:mga0sz30_1048_c1	3300050516	Bacteria	9952
374	nmdc:mga0sz30_2498_c1	3300050516	Bacteria	6556
375	nmdc:mga0sz30_4592_c1	3300050516	Bacteria	5002
376	Ga0500643_001652	3300053087	Bacteria	12426
377	Ga0500562_003966	3300053108	Bacteria	3731
378	Ga0500592_001817	3300053116	Bacteria	3446
379	Ga0500594_0003657	3300053118	Bacteria	3389
380	Ga0500595_002611	3300053119	Bacteria	8786
381	Ga0500595_002813	3300053119	Bacteria	8368
382	Ga0500607_000896	3300053121	Bacteria	28591
383	Ga0500608_000095	3300053122	Bacteria	35977
384	Ga0500658_0001794	3300053134	Bacteria	8476
385	Ga0500568_0006677	3300053139	Bacteria	5766
386	Ga0500573_0019720	3300053140	Bacteria	3859
387	Ga0500622_0001653	3300053156	Bacteria	17431
388	Ga0500627_0000177	3300053158	Bacteria	18687
389	Ga0500636_0000360	3300053177	Bacteria	24978
390	Ga0500567_000355	3300053723	Bacteria	14996
391	Ga0500645_001961	3300053730	Bacteria	9726
392	Ga0500596_000057	3300053735	Bacteria	15259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046524	Ga0495648_0079966	Ga0495648_0079966_567_1844	378
2	3300048929	Ga0496126_0241243	Ga0496126_0241243_15_1178	380
3	3300032126	Ga0307415_100057026	Ga0307415_1000570262	424
4	3300048927	Ga0496124_0196399	Ga0496124_0196399_35_1354	426
5	3300048920	Ga0496117_0017091	Ga0496117_0017091_2236_3636	427
6	3300009093	Ga0105240_10171680	Ga0105240_101716802	428
7	3300025913	Ga0207695_10109034	Ga0207695_101090342	428
8	3300048924	Ga0496121_0008799	Ga0496121_0008799_4238_5638	428
9	3300048926	Ga0496123_0024552	Ga0496123_0024552_213_1613	428
10	3300005338	Ga0068868_100000090	Ga0068868_10000009056	433
11	3300005339	Ga0070660_100001199	Ga0070660_10000119913	433
12	3300005366	Ga0070659_100000017	Ga0070659_10000001710	433
13	3300009098	Ga0105245_10045290	Ga0105245_100452902	433
14	3300025919	Ga0207657_10003138	Ga0207657_1000313814	433
15	3300025932	Ga0207690_10000035	Ga0207690_1000003510	433
16	3300026023	Ga0207677_10000317	Ga0207677_1000031710	433
17	3300048918	Ga0496115_0017104	Ga0496115_0017104_194_1624	433
18	3300047472	Ga0495686_0056124	Ga0495686_0056124_765_2162	434
19	3300005366	Ga0070659_100028605	Ga0070659_1000286052	435
20	3300048927	Ga0496124_0070069	Ga0496124_0070069_1033_2466	435
21	3300037418	Ga0395900_0091067	Ga0395900_0091067_1026_2438	436
22	3300053134	Ga0500658_0001794	Ga0500658_0001794_1457_2854	436
23	3300032005	Ga0307411_10190250	Ga0307411_101902501	437
24	3300005842	Ga0068858_100000444	Ga0068858_1000004445	440
25	3300009177	Ga0105248_10021259	Ga0105248_100212594	440
26	3300025941	Ga0207711_10027735	Ga0207711_100277352	440
27	3300026035	Ga0207703_10005814	Ga0207703_100058146	440
28	3300038443	Ga0395901_0096064	Ga0395901_0096064_438_1823	440
29	3300049571	Ga0501034_0027828	Ga0501034_0027828_4330_5679	440
30	3300046689	Ga0495613_0000905	Ga0495613_0000905_4043_5419	442
31	3300041404	Ga0439436_0017777	Ga0439436_0017777_25_1389	443
32	3300041410	Ga0439461_0004949	Ga0439461_0004949_222_1586	443
33	3300042004	Ga0439445_0009457	Ga0439445_0009457_354_1718	443
34	3300042014	Ga0439457_002253	Ga0439457_002253_2345_3709	443
35	3300042015	Ga0439462_0001967	Ga0439462_0001967_268_1632	443
36	3300003781	Ga0055536_1002860	Ga0055536_10028606	444
37	3300003781	Ga0055536_1005464	Ga0055536_10054645	444
38	3300003791	Ga0055530_10000156	Ga0055530_100001566	444
39	3300003794	Ga0055531_10002786	Ga0055531_100027866	444
40	3300005339	Ga0070660_100007475	Ga0070660_1000074752	444
41	3300025291	Ga0209675_1000287	Ga0209675_100028740	444
42	3300025292	Ga0209676_1002799	Ga0209676_10027995	444
43	3300025298	Ga0209050_1000423	Ga0209050_10004236	444
44	3300025304	Ga0209257_1000267	Ga0209257_10002675	444
45	3300025919	Ga0207657_10014536	Ga0207657_100145363	444
46	3300046660	Ga0495625_0012602	Ga0495625_0012602_2122_3609	444
47	3300053087	Ga0500643_001652	Ga0500643_001652_7713_9200	444
48	3300053116	Ga0500592_001817	Ga0500592_001817_231_1628	444
49	3300053158	Ga0500627_0000177	Ga0500627_0000177_11922_13319	444
50	3300028800	Ga0265338_10080863	Ga0265338_100808632	445
51	3300003773	Ga0055537_1011197	Ga0055537_10111971	446
52	3300003775	Ga0055524_1000616	Ga0055524_100061618	446
53	3300005262	Ga0065165_1011229	Ga0065165_10112292	446
54	3300005344	Ga0070661_100001581	Ga0070661_1000015819	446
55	3300025263	Ga0209565_1000548	Ga0209565_10005485	446
56	3300025273	Ga0209673_1001896	Ga0209673_10018965	446
57	3300025297	Ga0209758_1027704	Ga0209758_10277041	446
58	3300025298	Ga0209050_1003854	Ga0209050_10038547	446
59	3300025299	Ga0209256_1001341	Ga0209256_10013415	446
60	3300025304	Ga0209257_1007963	Ga0209257_10079632	446
61	3300025920	Ga0207649_10000134	Ga0207649_1000013452	446
62	3300033180	Ga0307510_10049195	Ga0307510_100491952	446
63	3300046616	Ga0495668_0000015	Ga0495668_0000015_433184_434560	446
64	iso_pu_bacteria	2643221563	2643834510	446
65	iso_pu_bacteria	2643221608	2644055436	446
66	iso_pu_bacteria	2852680915	2852683429	446
67	3300003794	Ga0055531_10031650	Ga0055531_100316502	447
68	3300005295	Ga0065707_10082133	Ga0065707_1008213312	447
69	3300005327	Ga0070658_10000003	Ga0070658_100000039	447
70	3300005339	Ga0070660_100001109	Ga0070660_1000011099	447
71	3300005366	Ga0070659_100020593	Ga0070659_1000205935	447
72	3300005719	Ga0068861_100000115	Ga0068861_10000011536	447
73	3300005844	Ga0068862_100000036	Ga0068862_10000003632	447
74	3300014325	Ga0163163_10037349	Ga0163163_100373493	447
75	3300017792	Ga0163161_10029323	Ga0163161_100293232	447
76	3300021384	Ga0213876_10000473	Ga0213876_1000047310	447
77	3300025292	Ga0209676_1010550	Ga0209676_10105503	447
78	3300025304	Ga0209257_1009476	Ga0209257_10094763	447
79	3300025909	Ga0207705_10000005	Ga0207705_1000000512	447
80	3300025919	Ga0207657_10000530	Ga0207657_100005308	447
81	3300025919	Ga0207657_10014376	Ga0207657_100143765	447
82	3300025926	Ga0207659_10019344	Ga0207659_100193444	447
83	3300026067	Ga0207678_10036211	Ga0207678_100362114	447
84	3300026118	Ga0207675_100000440	Ga0207675_1000004402	447
85	3300028380	Ga0268265_10000052	Ga0268265_1000005230	447
86	3300031911	Ga0307412_10000639	Ga0307412_100006396	447
87	3300038705	Ga0237819_01701	Ga0237819_01701_1616_2977	447
88	3300048927	Ga0496124_0000597	Ga0496124_0000597_4068_5450	447
89	3300053108	Ga0500562_003966	Ga0500562_003966_1371_2753	447
90	3300053730	Ga0500645_001961	Ga0500645_001961_6161_7549	447
91	iso_pu_bacteria	2512564014	2512641626	447
92	iso_pu_bacteria	2643221560	2643820143	447
93	iso_pu_bacteria	2808606401	2809065354	447
94	iso_pu_bacteria	2808606404	2809081254	447
95	iso_pu_bacteria	2808606405	2809085619	447
96	iso_pu_bacteria	2880518877	2880520802	447
97	3300026035	Ga0207703_10000974	Ga0207703_1000097427	448
98	3300032004	Ga0307414_10025967	Ga0307414_100259672	448
99	3300046471	Ga0495650_0003869	Ga0495650_0003869_4788_6161	448
100	3300046691	Ga0495670_0000037	Ga0495670_0000037_71325_72716	448
101	3300048910	Ga0496107_0184317	Ga0496107_0184317_163_1530	448
102	3300049568	Ga0501031_0038672	Ga0501031_0038672_1649_3031	448
103	3300049569	Ga0501032_0004694	Ga0501032_0004694_6005_7387	448
104	3300049570	Ga0501033_0006186	Ga0501033_0006186_5595_6977	448
105	3300049571	Ga0501034_0046607	Ga0501034_0046607_999_2381	448
106	3300049572	Ga0501036_0035202	Ga0501036_0035202_1992_3374	448
107	3300049573	Ga0501037_0022274	Ga0501037_0022274_1548_2930	448
108	3300049574	Ga0501038_0100842	Ga0501038_0100842_240_1622	448
109	3300049575	Ga0501039_0025674	Ga0501039_0025674_164_1546	448
110	3300049579	Ga0501043_0013664	Ga0501043_0013664_1282_2664	448
111	3300049580	Ga0501046_0074257	Ga0501046_0074257_846_2228	448
112	3300049581	Ga0501047_0017814	Ga0501047_0017814_4104_5486	448
113	3300049822	Ga0501035_0024396	Ga0501035_0024396_61_1443	448
114	3300049823	Ga0501044_0009593	Ga0501044_0009593_6530_7912	448
115	3300001990	JGI24737J22298_10000198	JGI24737J22298_1000019814	449
116	3300005577	Ga0068857_100092864	Ga0068857_1000928642	449
117	3300014326	Ga0157380_10014436	Ga0157380_100144365	449
118	3300025292	Ga0209676_1000343	Ga0209676_10003435	449
119	3300025298	Ga0209050_1014916	Ga0209050_10149162	449
120	3300026116	Ga0207674_10003398	Ga0207674_1000339815	449
121	3300031911	Ga0307412_10005795	Ga0307412_100057954	449
122	3300032004	Ga0307414_10001625	Ga0307414_100016254	449
123	3300046452	Ga0495617_010643	Ga0495617_010643_1339_2745	449
124	3300046453	Ga0495627_000171	Ga0495627_000171_4668_6182	449
125	3300046453	Ga0495627_000427	Ga0495627_000427_30635_32041	449
126	3300046512	Ga0495610_0003333	Ga0495610_0003333_5122_6528	449
127	3300046520	Ga0495637_0004676	Ga0495637_0004676_4128_5537	449
128	3300047469	Ga0495673_0028560	Ga0495673_0028560_503_2017	449
129	3300047470	Ga0495681_0000038	Ga0495681_0000038_4760_6166	449
130	3300048919	Ga0496116_0031861	Ga0496116_0031861_878_2278	449
131	3300048922	Ga0496119_0042292	Ga0496119_0042292_1359_2759	449
132	3300048927	Ga0496124_0013314	Ga0496124_0013314_1550_2950	449
133	3300053139	Ga0500568_0006677	Ga0500568_0006677_262_1647	449
134	3300005344	Ga0070661_100009676	Ga0070661_1000096766	450
135	3300005356	Ga0070674_100018341	Ga0070674_1000183412	450
136	3300005577	Ga0068857_100102457	Ga0068857_1001024572	450
137	3300005616	Ga0068852_100012869	Ga0068852_1000128695	450
138	3300005834	Ga0068851_10029416	Ga0068851_100294163	450
139	3300025919	Ga0207657_10029163	Ga0207657_100291632	450
140	3300025920	Ga0207649_10127259	Ga0207649_101272591	450
141	3300025937	Ga0207669_10010990	Ga0207669_100109904	450
142	3300046460	Ga0495638_0000261	Ga0495638_0000261_5898_7295	450
143	3300005539	Ga0068853_100056097	Ga0068853_1000560972	451
144	3300009551	Ga0105238_10196386	Ga0105238_101963862	451
145	3300026041	Ga0207639_10107622	Ga0207639_101076222	451
146	3300046660	Ga0495625_0001842	Ga0495625_0001842_7654_9048	451
147	3300005331	Ga0070670_100057754	Ga0070670_1000577542	452
148	3300005347	Ga0070668_100000021	Ga0070668_1000000217	452
149	3300005355	Ga0070671_100007008	Ga0070671_1000070084	452
150	3300005617	Ga0068859_100030769	Ga0068859_1000307694	452
151	3300005841	Ga0068863_100000043	Ga0068863_1000000437	452
152	3300005844	Ga0068862_100041082	Ga0068862_1000410822	452
153	3300006931	Ga0097620_100030769	Ga0097620_1000307694	452
154	3300025931	Ga0207644_10000077	Ga0207644_100000777	452
155	3300025972	Ga0207668_10000068	Ga0207668_100000687	452
156	3300026088	Ga0207641_10000031	Ga0207641_1000003110	452
157	3300028381	Ga0268264_10156726	Ga0268264_101567262	452
158	3300048928	Ga0496125_0134316	Ga0496125_0134316_363_1721	452
159	3300005335	Ga0070666_10010632	Ga0070666_100106324	453
160	3300005347	Ga0070668_100001640	Ga0070668_10000164010	453
161	3300005841	Ga0068863_100000225	Ga0068863_1000002256	453
162	3300025903	Ga0207680_10016588	Ga0207680_100165884	453
163	3300025972	Ga0207668_10000311	Ga0207668_100003116	453
164	3300026088	Ga0207641_10000367	Ga0207641_100003676	453
165	3300028381	Ga0268264_10014293	Ga0268264_100142935	453
166	3300046539	Ga0495621_0021128	Ga0495621_0021128_378_1763	453
167	iso_pu_bacteria	2852653556	2852656316	453
168	3300005353	Ga0070669_100006179	Ga0070669_1000061796	454
169	3300005367	Ga0070667_100000548	Ga0070667_10000054821	454
170	3300005843	Ga0068860_100007599	Ga0068860_1000075995	454
171	3300025986	Ga0207658_10000472	Ga0207658_100004726	454
172	iso_pu_bacteria	2919709256	2919711950	454
173	3300005337	Ga0070682_100058293	Ga0070682_1000582931	455
174	3300009092	Ga0105250_10020266	Ga0105250_100202662	455
175	3300009177	Ga0105248_10012619	Ga0105248_100126196	455
176	3300009553	Ga0105249_10052645	Ga0105249_100526452	455
177	3300013306	Ga0163162_10031040	Ga0163162_100310402	455
178	3300031911	Ga0307412_10031622	Ga0307412_100316223	455
179	3300041498	Ga0451841_0336377	Ga0451841_0336377_34_1440	455
180	3300048903	Ga0496100_0048665	Ga0496100_0048665_396_1859	455
181	3300048904	Ga0496101_0014895	Ga0496101_0014895_2091_3554	455
182	3300048905	Ga0496102_0000366	Ga0496102_0000366_11836_13299	455
183	3300048906	Ga0496103_0000505	Ga0496103_0000505_30472_31935	455
184	3300048907	Ga0496104_0000252	Ga0496104_0000252_26954_28417	455
185	3300048908	Ga0496105_0000237	Ga0496105_0000237_8909_10372	455
186	3300048915	Ga0496112_0011047	Ga0496112_0011047_5670_7133	455
187	3300048916	Ga0496113_0017861	Ga0496113_0017861_1664_3127	455
188	3300048920	Ga0496117_0022884	Ga0496117_0022884_3230_4693	455
189	3300048921	Ga0496118_0112678	Ga0496118_0112678_311_1774	455
190	3300048922	Ga0496119_0000121	Ga0496119_0000121_30954_32417	455
191	3300048923	Ga0496120_0003207	Ga0496120_0003207_6289_7752	455
192	3300048924	Ga0496121_0008330	Ga0496121_0008330_10437_11900	455
193	3300048925	Ga0496122_0010617	Ga0496122_0010617_1193_2656	455
194	3300048927	Ga0496124_0012977	Ga0496124_0012977_5486_6949	455
195	3300048929	Ga0496126_0000045	Ga0496126_0000045_111910_113373	455
196	3300049663	Ga0501223_000122	Ga0501223_000122_69_1484	455
197	3300049664	Ga0501224_000016	Ga0501224_000016_13420_14835	455
198	3300049669	Ga0501235_019186	Ga0501235_019186_61_1476	455
199	3300049705	Ga0501225_0000905	Ga0501225_0000905_3734_5149	455
200	3300049853	Ga0501226_000020	Ga0501226_000020_68494_69909	455
201	3300005354	Ga0070675_100066525	Ga0070675_1000665252	456
202	3300005356	Ga0070674_100069078	Ga0070674_1000690782	456
203	3300005543	Ga0070672_100006005	Ga0070672_1000060054	456
204	3300025940	Ga0207691_10001517	Ga0207691_1000151716	456
205	3300026089	Ga0207648_10165310	Ga0207648_101653102	456
206	3300046460	Ga0495638_0005175	Ga0495638_0005175_1168_2556	456
207	3300046694	Ga0495649_0001055	Ga0495649_0001055_9357_10760	456
208	3300005289	Ga0065704_10100779	Ga0065704_101007792	457
209	3300005347	Ga0070668_100008751	Ga0070668_1000087515	457
210	3300005353	Ga0070669_100000149	Ga0070669_10000014916	457
211	3300005355	Ga0070671_100000612	Ga0070671_10000061225	457
212	3300005367	Ga0070667_100002797	Ga0070667_1000027979	457
213	3300005548	Ga0070665_100002260	Ga0070665_10000226025	457
214	3300005843	Ga0068860_100023600	Ga0068860_1000236006	457
215	3300025735	Ga0207713_1004973	Ga0207713_10049735	457
216	3300025923	Ga0207681_10000296	Ga0207681_100002964	457
217	3300025931	Ga0207644_10002535	Ga0207644_1000253514	457
218	3300025961	Ga0207712_10039343	Ga0207712_100393432	457
219	3300025972	Ga0207668_10001525	Ga0207668_1000152510	457
220	3300025986	Ga0207658_10000402	Ga0207658_1000040240	457
221	3300028379	Ga0268266_10015186	Ga0268266_100151866	457
222	3300028380	Ga0268265_10055162	Ga0268265_100551622	457
223	3300028381	Ga0268264_10001809	Ga0268264_100018096	457
224	3300049571	Ga0501034_0034823	Ga0501034_0034823_235_1653	457
225	3300049572	Ga0501036_0204517	Ga0501036_0204517_197_1615	457
226	3300049579	Ga0501043_0074988	Ga0501043_0074988_1025_2443	457
227	3300049581	Ga0501047_0152926	Ga0501047_0152926_550_1968	457
228	3300049823	Ga0501044_0033840	Ga0501044_0033840_3460_4878	457
229	3300053119	Ga0500595_002813	Ga0500595_002813_5741_7141	457
230	iso_pu_bacteria	2751185897	2753767063	457
231	3300003794	Ga0055531_10002954	Ga0055531_100029547	458
232	3300005841	Ga0068863_100029179	Ga0068863_1000291792	458
233	3300009553	Ga0105249_10000427	Ga0105249_1000042728	458
234	3300025304	Ga0209257_1004113	Ga0209257_10041135	458
235	3300025961	Ga0207712_10000362	Ga0207712_100003627	458
236	3300026088	Ga0207641_10005160	Ga0207641_100051605	458
237	3300003781	Ga0055536_1015803	Ga0055536_10158032	459
238	3300025292	Ga0209676_1002813	Ga0209676_10028135	459
239	3300028380	Ga0268265_10014042	Ga0268265_100140425	459
240	3300031911	Ga0307412_10005535	Ga0307412_100055355	459
241	3300046660	Ga0495625_0005163	Ga0495625_0005163_6641_8065	459
242	3300048924	Ga0496121_0001469	Ga0496121_0001469_5467_6927	459
243	3300005844	Ga0068862_100006851	Ga0068862_1000068516	460
244	3300028380	Ga0268265_10014815	Ga0268265_100148155	460
245	3300005843	Ga0068860_100008571	Ga0068860_1000085713	461
246	3300005844	Ga0068862_100006233	Ga0068862_1000062333	461
247	3300009101	Ga0105247_10011248	Ga0105247_100112485	461
248	3300014326	Ga0157380_10114724	Ga0157380_101147242	461
249	3300025900	Ga0207710_10002229	Ga0207710_100022293	461
250	3300028380	Ga0268265_10004167	Ga0268265_100041677	461
251	3300028381	Ga0268264_10005662	Ga0268264_100056627	461
252	3300005331	Ga0070670_100032568	Ga0070670_1000325681	465
253	3300005548	Ga0070665_100000207	Ga0070665_100000207115	466
254	3300005548	Ga0070665_100000568	Ga0070665_10000056847	466
255	3300028379	Ga0268266_10000171	Ga0268266_10000171130	466
256	3300028379	Ga0268266_10000949	Ga0268266_100009495	466
257	3300031251	Ga0265327_10058689	Ga0265327_100586892	466
258	3300028379	Ga0268266_10001802	Ga0268266_1000180216	473
259	3300046537	Ga0495598_0000615	Ga0495598_0000615_3087_4601	473
260	3300050489	nmdc:mga03683_295_c1	nmdc:mga03683_295_c1_6284_7705	473
261	3300050491	nmdc:mga00v17_4418_c1	nmdc:mga00v17_4418_c1_1213_2634	473
262	3300050516	nmdc:mga0sz30_2498_c1	nmdc:mga0sz30_2498_c1_4836_6257	473
263	3300005339	Ga0070660_100010348	Ga0070660_1000103485	474
264	3300005345	Ga0070692_10005312	Ga0070692_100053122	474
265	3300005457	Ga0070662_100015984	Ga0070662_1000159843	474
266	3300005843	Ga0068860_100032246	Ga0068860_1000322463	474
267	3300009148	Ga0105243_10096893	Ga0105243_100968932	474
268	3300009553	Ga0105249_10023565	Ga0105249_100235655	474
269	3300013102	Ga0157371_10047209	Ga0157371_100472092	474
270	3300013306	Ga0163162_10065730	Ga0163162_100657303	474
271	3300025932	Ga0207690_10017725	Ga0207690_100177252	474
272	3300025933	Ga0207706_10039860	Ga0207706_100398603	474
273	3300025961	Ga0207712_10004708	Ga0207712_100047086	474
274	3300026116	Ga0207674_10186075	Ga0207674_101860752	474
275	3300028381	Ga0268264_10023317	Ga0268264_100233173	474
276	3300037471	Ga0395905_0004481	Ga0395905_0004481_3313_4779	474
277	3300037466	Ga0395898_0034005	Ga0395898_0034005_341_1837	475
278	3300038443	Ga0395901_0007654	Ga0395901_0007654_4309_5805	475
279	3300005367	Ga0070667_100035685	Ga0070667_1000356855	476
280	3300021358	Ga0213873_10000057	Ga0213873_1000005710	476
281	3300021384	Ga0213876_10000021	Ga0213876_1000002114	476
282	3300025986	Ga0207658_10005614	Ga0207658_100056149	476
283	3300037418	Ga0395900_0155532	Ga0395900_0155532_600_2075	476
284	3300037466	Ga0395898_0044911	Ga0395898_0044911_2599_4074	476
285	3300037471	Ga0395905_0017232	Ga0395905_0017232_4207_5682	476
286	3300038443	Ga0395901_0076411	Ga0395901_0076411_1497_2972	476
287	3300039437	Ga0436365_0007432	Ga0436365_0007432_13903_15378	476
288	3300039453	Ga0436362_0599901	Ga0436362_0599901_1378_2853	476
289	3300025901	Ga0207688_10100098	Ga0207688_101000981	477
290	3300031250	Ga0265331_10008273	Ga0265331_100082732	477
291	3300049758	Ga0501241_008235	Ga0501241_008235_348_1844	478
292	3300005347	Ga0070668_100002639	Ga0070668_1000026398	479
293	3300005548	Ga0070665_100002230	Ga0070665_10000223013	479
294	3300025972	Ga0207668_10000003	Ga0207668_1000000362	479
295	3300028380	Ga0268265_10092816	Ga0268265_100928162	479
296	3300006042	Ga0075368_10000267	Ga0075368_100002675	480
297	3300006048	Ga0075363_100000443	Ga0075363_1000004437	480
298	3300006051	Ga0075364_10014389	Ga0075364_100143892	480
299	3300006178	Ga0075367_10000262	Ga0075367_100002628	480
300	3300006186	Ga0075369_10000697	Ga0075369_100006978	480
301	3300027866	Ga0209813_10000089	Ga0209813_1000008919	480
302	3300050490	nmdc:mga03n38_15795_c1	nmdc:mga03n38_15795_c1_432_1916	480
303	3300050491	nmdc:mga00v17_14537_c1	nmdc:mga00v17_14537_c1_2755_4239	480
304	3300050495	nmdc:mga04h51_94_c1	nmdc:mga04h51_94_c1_11606_13090	480
305	3300050496	nmdc:mga07m45_22_c1	nmdc:mga07m45_22_c1_102714_104198	480
306	3300050516	nmdc:mga0sz30_1048_c1	nmdc:mga0sz30_1048_c1_8170_9654	480
307	3300053121	Ga0500607_000896	Ga0500607_000896_6869_8353	480
308	3300005356	Ga0070674_100014179	Ga0070674_1000141793	481
309	3300025937	Ga0207669_10002781	Ga0207669_100027813	481
310	3300025960	Ga0207651_10065091	Ga0207651_100650912	481
311	3300053735	Ga0500596_000057	Ga0500596_000057_3928_5472	481
312	3300031824	Ga0307413_10006583	Ga0307413_100065834	482
313	3300031852	Ga0307410_10007673	Ga0307410_100076732	482
314	3300031995	Ga0307409_100000902	Ga0307409_10000090210	482
315	3300032004	Ga0307414_10003506	Ga0307414_100035064	482
316	3300032005	Ga0307411_10004501	Ga0307411_100045012	482
317	3300006048	Ga0075363_100006261	Ga0075363_1000062612	486
318	3300006177	Ga0075362_10000023	Ga0075362_1000002327	486
319	3300006186	Ga0075369_10004198	Ga0075369_100041981	486
320	3300046648	Ga0495611_0022766	Ga0495611_0022766_1103_2614	486
321	3300013306	Ga0163162_10033555	Ga0163162_100335552	487
322	3300003214	JGI25165J46597_1000021	JGI25165J46597_100002140	489
323	3300025233	Ga0209437_105010	Ga0209437_1050102	489
324	3300025261	Ga0209233_1000065	Ga0209233_100006539	489
325	3300046524	Ga0495648_0018360	Ga0495648_0018360_753_2291	489
326	3300046660	Ga0495625_0005431	Ga0495625_0005431_6689_8227	489
327	3300001915	JGI24741J21665_1002247	JGI24741J21665_10022474	490
328	3300028786	Ga0307517_10016086	Ga0307517_100160867	490
329	3300033180	Ga0307510_10114829	Ga0307510_101148292	490
330	3300046471	Ga0495650_0000116	Ga0495650_0000116_63265_64809	490
331	3300046492	Ga0495585_0002440	Ga0495585_0002440_6185_7729	490
332	3300046506	Ga0495583_0001297	Ga0495583_0001297_6840_8384	490
333	3300046507	Ga0495606_0048879	Ga0495606_0048879_381_1925	490
334	3300046522	Ga0495643_0001399	Ga0495643_0001399_14861_16405	490
335	3300046558	Ga0495633_0000607	Ga0495633_0000607_5729_7273	490
336	3300046616	Ga0495668_0000022	Ga0495668_0000022_39526_41070	490
337	3300049679	Ga0501249_000247	Ga0501249_000247_11852_13375	490
338	3300053119	Ga0500595_002611	Ga0500595_002611_5809_7353	490
339	3300053177	Ga0500636_0000360	Ga0500636_0000360_13110_14654	490
340	3300033180	Ga0307510_10003239	Ga0307510_100032391	491
341	3300050489	nmdc:mga03683_188_c1	nmdc:mga03683_188_c1_4519_5997	491
342	3300050516	nmdc:mga0sz30_4592_c1	nmdc:mga0sz30_4592_c1_3493_4971	491
343	3300006051	Ga0075364_10006884	Ga0075364_100068842	492
344	3300006177	Ga0075362_10000752	Ga0075362_100007525	492
345	3300006186	Ga0075369_10009505	Ga0075369_100095054	492
346	3300053122	Ga0500608_000095	Ga0500608_000095_25572_27062	492
347	3300053140	Ga0500573_0019720	Ga0500573_0019720_465_1955	492
348	3300053723	Ga0500567_000355	Ga0500567_000355_11355_12845	492
349	3300006353	Ga0075370_10004571	Ga0075370_100045716	493
350	3300050496	nmdc:mga07m45_1921_c1	nmdc:mga07m45_1921_c1_1707_3200	493
351	3300002774	JGI25150J39212_1000044	JGI25150J39212_100004424	494
352	3300003187	JGI25151J46595_10007071	JGI25151J46595_100070713	494
353	3300003215	JGI25153J46596_10000043	JGI25153J46596_1000004347	494
354	3300003792	Ga0055540_1003097	Ga0055540_10030975	494
355	3300025245	Ga0207425_1000047	Ga0207425_1000047103	494
356	3300025258	Ga0209129_1000497	Ga0209129_10004979	494
357	3300025294	Ga0209025_1000150	Ga0209025_100015047	494
358	3300025297	Ga0209758_1000009	Ga0209758_1000009831	494
359	3300025298	Ga0209050_1000005	Ga0209050_1000005336	494
360	3300025303	Ga0209051_1000396	Ga0209051_100039611	494
361	3300025304	Ga0209257_1000337	Ga0209257_100033789	494
362	3300025304	Ga0209257_1001283	Ga0209257_100128326	494
363	3300005289	Ga0065704_10075682	Ga0065704_100756822	495
364	3300006195	Ga0075366_10000034	Ga0075366_1000003439	495
365	3300006353	Ga0075370_10000009	Ga0075370_1000000971	495
366	3300006946	Ga0079104_1019871	Ga0079104_10198712	495
367	3300009553	Ga0105249_10000024	Ga0105249_1000002435	495
368	3300025961	Ga0207712_10000034	Ga0207712_1000003436	495
369	3300050493	nmdc:mga0k408_32398_c1	nmdc:mga0k408_32398_c1_950_2440	495
370	3300050493	nmdc:mga0k408_3_c1	nmdc:mga0k408_3_c1_63174_64664	495
371	3300050496	nmdc:mga07m45_6_c1	nmdc:mga07m45_6_c1_183798_185288	495
372	3300005289	Ga0065704_10112372	Ga0065704_101123721	496
373	3300009011	Ga0105251_10030200	Ga0105251_100302002	496
374	3300009553	Ga0105249_10099732	Ga0105249_100997322	496
375	3300025961	Ga0207712_10057986	Ga0207712_100579862	496
376	3300046660	Ga0495625_0062887	Ga0495625_0062887_535_2055	496
377	3300048924	Ga0496121_0054132	Ga0496121_0054132_1607_3115	496
378	3300048925	Ga0496122_0050893	Ga0496122_0050893_984_2492	496
379	3300048926	Ga0496123_0031822	Ga0496123_0031822_1379_2887	496
380	3300048927	Ga0496124_0005387	Ga0496124_0005387_379_1887	496
381	3300053118	Ga0500594_0003657	Ga0500594_0003657_253_1827	496
382	3300053156	Ga0500622_0001653	Ga0500622_0001653_945_2465	496
383	3300001915	JGI24741J21665_1000063	JGI24741J21665_100006311	497
384	3300001979	JGI24740J21852_10006371	JGI24740J21852_100063712	497
385	3300001989	JGI24739J22299_10012436	JGI24739J22299_100124361	497
386	3300002075	JGI24738J21930_10000753	JGI24738J21930_100007534	497
387	3300005339	Ga0070660_100021879	Ga0070660_1000218791	497
388	3300005455	Ga0070663_100015604	Ga0070663_1000156043	497
389	3300005563	Ga0068855_100137637	Ga0068855_1001376372	497
390	3300005614	Ga0068856_100003500	Ga0068856_10000350014	497
391	3300005834	Ga0068851_10076443	Ga0068851_100764431	497
392	3300009174	Ga0105241_10007488	Ga0105241_100074887	497
393	3300025321	Ga0207656_10004027	Ga0207656_100040275	497
394	3300025904	Ga0207647_10019116	Ga0207647_100191163	497
395	3300025913	Ga0207695_10169083	Ga0207695_101690832	497
396	3300025919	Ga0207657_10022449	Ga0207657_100224492	497
397	3300026041	Ga0207639_10000100	Ga0207639_100001005	497
398	3300026067	Ga0207678_10000007	Ga0207678_1000000725	497
399	3300026142	Ga0207698_10022342	Ga0207698_100223422	497
400	3300031731	Ga0307405_10092590	Ga0307405_100925902	497
401	3300031824	Ga0307413_10045335	Ga0307413_100453352	497
402	3300031901	Ga0307406_10058976	Ga0307406_100589762	497
403	3300032004	Ga0307414_10100627	Ga0307414_101006271	497
404	3300050496	nmdc:mga07m45_37346_c1	nmdc:mga07m45_37346_c1_1183_2688	497

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4g2a-assembly1.cif.gz_A	crystal structure of a putative nutrient binding protein (lpg2210) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 2.33 a resolution	0.5999	419	489
2e9g-assembly1.cif.gz_A	solution structure of the alpha adaptinc2 domain from human adapter-related protein complex 1 gamma 2 subunit	0.5777	375	489
3a23-assembly2.cif.gz_B	crystal structure of beta-l-arabinopyranosidase complexed with d-galactose	0.575	421	486
3zy7-assembly1.cif.gz_B	crystal structure of computationally redesigned gamma-adaptin appendage domain forming a symmetric homodimer	0.572	374	489
5cn1-assembly4.cif.gz_D	crystal structure of yeast gga1_gae domain-p21	0.5037	375	489

ID	Description	Score	Start	End	Superfamily
af_M9PDR0_822_937_2.60.40.10	Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins	0.7583	423	488	2.60.40.10
4lnvC07	Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins	0.7348	423	488	2.60.40.10
af_A0A1D6JKY6_765_893_2.60.40.1230	Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain	0.6517	373	492	2.60.40.1230
af_A0A0P0X6J5_29_168_2.60.40.1820	Mainly Beta;Sandwich;Immunoglobulin-like;	0.6481	378	491	2.60.40.1820
2wnwB01	Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II	0.6262	399	490	2.60.40.1180

ID	Description	Score	Start	End
AF-A0A202DSY0-F1-model_v4	DUF4139 domain-containing protein	0.8819	295	492
AF-A0A202DSY0-F1-model_v4	DUF4139 domain-containing protein	0.8672	295	492
AF-A0A2G2QV75-F1-model_v4	DUF4139 domain-containing protein	0.8535	4	489
AF-A0A848QRH3-F1-model_v4	DUF4139 domain-containing protein	0.8522	5	492
AF-A0A6L3ZR79-F1-model_v4	deleted	0.8512	256	492

Feature Viewer

pLDDT	pTM	Quality
83.02	0.69	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F435818

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map