F435830

General Info

Members Datasets Scaffolds Average Seq Length
404 258 327 404

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2773857925|2774868919
Length 477
Sequence VALFYFRVRIAERWIPWLLAALALAGALGPTITNEGLVMKTTPAGSETLHHHTRRMGGRDPHEAHRVATPLELLFDLTFVVSFGLAASQFAHELAEGHYAAALIGFGFASFAICWAWVNFSWFSSAYDTDDWIFRLVTMVQMIGVLVLAIGLPRMFASIEHGEHLDNSVMVLGYVIMRVAMVFQWLRAARQDPARHRACLTYAVAISIAQLGWVVLIFFDFSLGVTFILVCTLVLIELAGPVTAERKDGGTPWHAHHIAERHGLFAIIALGEGIVGTLATLSAVVEEQGWTTDAALVCIAGIGLTFGMWWVYYILPSAQILEAHRNRSFVWGYGQMVIVGSIVATGAGLHVAAYFIEHKAHIGALATVLCVAIPVSVYLGSIYALYTYLVGRFDPFHAWLLIGTATVATLAVIAAFAGIDMAACLVILMLAPAVTVFGYEILGHRHQAEALVKEDAATLIEHQRVHVDSSLPHTHRQ

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
4 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
5 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
6 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
7 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
8 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
9 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
10 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
11 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
12 2643221557 Ensifer sp. Root558 Isolate Unclassified
13 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
14 2643221610 Ensifer sp. Root74 Isolate Unclassified
15 2643221615 Nocardioides sp. Root224 Isolate Unclassified
16 2643221618 Ensifer sp. Root231 Isolate Unclassified
17 2643221626 Ensifer sp. Root31 Isolate Unclassified
18 2643221655 Ensifer sp. Root1252 Isolate Unclassified
19 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
20 2643221659 Ensifer sp. Root127 Isolate Unclassified
21 2643221668 Ensifer sp. Root423 Isolate Unclassified
22 2643221675 Ensifer sp. Root1298 Isolate Unclassified
23 2643221680 Ensifer sp. Root1312 Isolate Unclassified
24 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
25 2643221698 Ensifer sp. Root142 Isolate Unclassified
26 2643221712 Ensifer sp. Root258 Isolate Unclassified
27 2643221726 Ensifer sp. Root954 Isolate Unclassified
28 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
29 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
30 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
31 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
32 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
33 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
34 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
35 2773857925 Microvirga vignae BR3299 Isolate Unclassified
36 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
37 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
38 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
39 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
40 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
41 2844163670 Ensifer sp. 1H6 Isolate Unclassified
42 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
43 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
44 2855730933 Achromobacter sp. HZ28 Isolate Nodule
45 2855767633 Achromobacter sp. HZ34 Isolate Nodule
46 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
47 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
48 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
49 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
50 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
51 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
52 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
53 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
54 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
55 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
56 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
57 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
58 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
59 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
60 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
61 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
62 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
63 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
64 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
65 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
66 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
67 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
68 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
69 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
70 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
71 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
72 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
73 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
74 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
75 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
76 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
77 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
78 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
79 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
80 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
81 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
82 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
83 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
84 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
85 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
86 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
87 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
88 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
89 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
90 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
91 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
92 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
93 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
94 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
95 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
96 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
97 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
98 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
99 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
100 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
101 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
102 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
103 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
104 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
105 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
108 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
116 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
122 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
140 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
141 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
142 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
143 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
144 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
145 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
146 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
173 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
174 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
193 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
194 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
195 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
196 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
197 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
198 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
247 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
248 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
249 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
250 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
251 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
252 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
255 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.94
Metatranscriptomes 0
Isolates 19.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.35
Nodule 5.94
Rhizoplane 0.5
Rhizosphere 66.83
Stem 0
Stem Tuber 0
Unclassified 11.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1000555 3300002741 Bacteria 22318
2 JGI25152J39213_1000109 3300002773 Bacteria 57724
3 JGI25159J45721_1000014 3300002987 Bacteria 147809
4 JGI25151J46595_10000265 3300003187 Bacteria 59850
5 JGI25151J46595_10027148 3300003187 Bacteria 2300
6 JGI25165J46597_1000079 3300003214 Bacteria 179163
7 rootH1_10078654 3300003316 Bacteria 4457
8 JGI25160J50197_1000020 3300003354 Bacteria 232739
9 JGI25161J50226_1001410 3300003374 Bacteria 7292
10 Ga0055526_1005168 3300003771 Bacteria 7591
11 Ga0055524_1012812 3300003775 Bacteria 3199
12 Ga0055536_1011464 3300003781 Bacteria 3396
13 Ga0055543_1000768 3300004625 Bacteria 15975
14 Ga0065165_1000013 3300005262 Bacteria 301887
15 Ga0070658_10059953 3300005327 Bacteria 3098
16 Ga0070661_100000160 3300005344 Bacteria 55287
17 Ga0070669_100288757 3300005353 Bacteria 1316
18 Ga0070671_100028503 3300005355 Bacteria 4598
19 Ga0070674_100010566 3300005356 Bacteria 5586
20 Ga0070711_100064083 3300005439 Bacteria 2567
21 Ga0070700_100094806 3300005441 Bacteria 1955
22 Ga0070694_100026016 3300005444 Bacteria 3790
23 Ga0070663_100006263 3300005455 Bacteria 7137
24 Ga0070707_100048564 3300005468 Bacteria 4065
25 Ga0070698_100002736 3300005471 Bacteria 19380
26 Ga0070698_100018030 3300005471 Bacteria 7432
27 Ga0070698_100057431 3300005471 Bacteria 3938
28 Ga0070698_100077026 3300005471 Bacteria 3335
29 Ga0070699_100031660 3300005518 Bacteria 4567
30 Ga0070697_100069285 3300005536 Bacteria 2889
31 Ga0070697_100095588 3300005536 Bacteria 2464
32 Ga0070697_100177655 3300005536 Bacteria 1804
33 Ga0070697_100303398 3300005536 Bacteria 1373
34 Ga0070695_100050769 3300005545 Bacteria 2659
35 Ga0070695_100110119 3300005545 Bacteria 1867
36 Ga0070695_100122129 3300005545 Bacteria 1783
37 Ga0070696_100032741 3300005546 Bacteria 3567
38 Ga0070696_100133070 3300005546 Bacteria 1811
39 Ga0070696_100158173 3300005546 Bacteria 1668
40 Ga0068855_100163637 3300005563 Bacteria 2523
41 Ga0070702_100034685 3300005615 Bacteria 2782
42 Ga0068862_100027289 3300005844 Bacteria 4806
43 Ga0068862_100081978 3300005844 Bacteria 2799
44 Ga0081455_10109110 3300005937 Bacteria 2203
45 Ga0075365_10077899 3300006038 Bacteria 2240
46 Ga0075363_100024754 3300006048 Bacteria 3054
47 Ga0075363_100036061 3300006048 Bacteria 2592
48 Ga0075364_10109113 3300006051 Bacteria 1846
49 Ga0075364_10172951 3300006051 Bacteria 1460
50 Ga0075362_10033188 3300006177 Bacteria 2244
51 Ga0075369_10007294 3300006186 Bacteria 4206
52 Ga0075370_10091246 3300006353 Bacteria 1757
53 Ga0075428_100027390 3300006844 Bacteria 6305
54 Ga0075428_100119622 3300006844 Bacteria 2867
55 Ga0075428_100129698 3300006844 Bacteria 2743
56 Ga0075428_100295322 3300006844 Bacteria 1742
57 Ga0075431_100024725 3300006847 Bacteria 6158
58 Ga0075431_100295130 3300006847 Bacteria 1639
59 Ga0075433_10025954 3300006852 Bacteria 4956
60 Ga0075433_10049418 3300006852 Bacteria 3659
61 Ga0075434_100018861 3300006871 Bacteria 6668
62 Ga0075434_100021346 3300006871 Bacteria 6293
63 Ga0075434_100026066 3300006871 Bacteria 5724
64 Ga0075434_100114987 3300006871 Bacteria 2703
65 Ga0075429_100069895 3300006880 Bacteria 3057
66 Ga0075436_100029961 3300006914 Bacteria 3743
67 Ga0075436_100033872 3300006914 Bacteria 3520
68 Ga0075436_100085548 3300006914 Bacteria 2189
69 Ga0075436_100105574 3300006914 Bacteria 1964
70 Ga0075435_100040305 3300007076 Bacteria 3729
71 Ga0075435_100070668 3300007076 Bacteria 2849
72 Ga0075435_100093268 3300007076 Bacteria 2487
73 Ga0075435_100149562 3300007076 Bacteria 1962
74 Ga0099795_10033514 3300007788 Bacteria 1784
75 Ga0105244_10006177 3300009036 Bacteria 7813
76 Ga0105240_10055861 3300009093 Bacteria 4942
77 Ga0111539_10010027 3300009094 Bacteria 11939
78 Ga0111539_10017652 3300009094 Bacteria 8833
79 Ga0111539_10089667 3300009094 Bacteria 3614
80 Ga0114129_10022110 3300009147 Bacteria 9025
81 Ga0114129_10149360 3300009147 Bacteria 3198
82 Ga0114129_10223646 3300009147 Bacteria 2538
83 Ga0114129_10236456 3300009147 Bacteria 2458
84 Ga0114129_10311679 3300009147 Bacteria 2094
85 Ga0105243_10009399 3300009148 Bacteria 7450
86 Ga0105242_10249376 3300009176 Bacteria 1599
87 Ga0105237_10038673 3300009545 Bacteria 4817
88 Ga0105238_10040306 3300009551 Bacteria 4733
89 Ga0105239_10030437 3300010375 Bacteria 5936
90 Ga0105239_10177334 3300010375 Bacteria 2384
91 Ga0105246_10019309 3300011119 Bacteria 4353
92 Ga0105246_10082297 3300011119 Bacteria 2297
93 Ga0105246_10095545 3300011119 Bacteria 2152
94 Ga0105246_10155886 3300011119 Bacteria 1734
95 Ga0157371_10176178 3300013102 Bacteria 1529
96 Ga0157370_10009575 3300013104 Bacteria 10318
97 Ga0157369_10086635 3300013105 Bacteria 3345
98 Ga0171463_1003 3300013249 Bacteria 695693
99 Ga0157378_10104510 3300013297 Bacteria 2589
100 Ga0157372_10121860 3300013307 Bacteria 2996
101 Ga0157380_10024473 3300014326 Bacteria 4571
102 Ga0157380_10059550 3300014326 Bacteria 3048
103 Ga0183363_1085 3300015690 Bacteria 28396
104 Ga0214542_1012200 3300021321 Bacteria 11255
105 Ga0214543_1000038 3300021327 Bacteria 182106
106 Ga0207425_1007216 3300025245 Bacteria 2956
107 Ga0209026_1000118 3300025250 Bacteria 130611
108 Ga0209759_1000076 3300025256 Bacteria 175911
109 Ga0209129_1000180 3300025258 Bacteria 90882
110 Ga0209233_1000247 3300025261 Bacteria 87890
111 Ga0209673_1026592 3300025273 Bacteria 1896
112 Ga0209130_1000034 3300025284 Bacteria 302439
113 Ga0209130_1017690 3300025284 Bacteria 1692
114 Ga0209676_1019352 3300025292 Bacteria 2343
115 Ga0209025_1000026 3300025294 Bacteria 519850
116 Ga0209025_1000311 3300025294 Bacteria 108141
117 Ga0209025_1001362 3300025294 Bacteria 32778
118 Ga0209564_1000013 3300025295 Bacteria 775755
119 Ga0209758_1034104 3300025297 Bacteria 2031
120 Ga0209050_1009685 3300025298 Bacteria 4887
121 Ga0209256_1000396 3300025299 Bacteria 69216
122 Ga0209256_1003573 3300025299 Bacteria 10736
123 Ga0207426_1000006 3300025302 Bacteria 1025969
124 Ga0209051_1003723 3300025303 Bacteria 9823
125 Ga0209051_1004857 3300025303 Bacteria 8079
126 Ga0209051_1008029 3300025303 Bacteria 5656
127 Ga0209051_1010204 3300025303 Bacteria 4770
128 Ga0209051_1032204 3300025303 Bacteria 2004
129 Ga0207688_10016441 3300025901 Bacteria 4013
130 Ga0207699_10061925 3300025906 Bacteria 2253
131 Ga0207695_10000190 3300025913 Bacteria 176747
132 Ga0207695_10263570 3300025913 Bacteria 1620
133 Ga0207671_10035935 3300025914 Bacteria 3674
134 Ga0207663_10003106 3300025916 Bacteria 8059
135 Ga0207649_10000029 3300025920 Bacteria 156557
136 Ga0207646_10065117 3300025922 Bacteria 3253
137 Ga0207646_10107832 3300025922 Bacteria 2499
138 Ga0207694_10008166 3300025924 Bacteria 7909
139 Ga0207694_10055941 3300025924 Bacteria 3064
140 Ga0207700_10074734 3300025928 Bacteria 2623
141 Ga0207709_10186218 3300025935 Bacteria 1470
142 Ga0207665_10034950 3300025939 Bacteria 3335
143 Ga0207639_10156129 3300026041 Bacteria 1917
144 Ga0209971_1013523 3300027682 Bacteria 1933
145 Ga0207428_10002027 3300027907 Bacteria 20466
146 Ga0307515_10000154 3300028794 Bacteria 166582
147 Ga0307515_10000285 3300028794 Bacteria 124535
148 Ga0307515_10004744 3300028794 Bacteria 27847
149 Ga0307515_10058049 3300028794 Bacteria 5584
150 Ga0307515_10087371 3300028794 Bacteria 3958
151 Ga0316176_1193234 3300030732 Bacteria 2744
152 Ga0314311_1151601 3300030733 Bacteria 4083
153 Ga0316178_1118312 3300030735 Bacteria 4115
154 Ga0265327_10016080 3300031251 Bacteria 4779
155 Ga0307513_10005286 3300031456 Bacteria 17089
156 Ga0307408_100014633 3300031548 Bacteria 5213
157 Ga0307408_100019143 3300031548 Bacteria 4607
158 Ga0307408_100020305 3300031548 Bacteria 4481
159 Ga0307408_100026368 3300031548 Bacteria 3991
160 Ga0307408_100049545 3300031548 Bacteria 3017
161 Ga0307408_100053051 3300031548 Bacteria 2926
162 Ga0307408_100133610 3300031548 Bacteria 1938
163 Ga0307405_10001802 3300031731 Bacteria 9165
164 Ga0307405_10002619 3300031731 Bacteria 7997
165 Ga0307405_10024590 3300031731 Bacteria 3443
166 Ga0307405_10026595 3300031731 Bacteria 3341
167 Ga0307405_10083646 3300031731 Bacteria 2093
168 Ga0307413_10002843 3300031824 Bacteria 7144
169 Ga0307413_10009752 3300031824 Bacteria 4613
170 Ga0307413_10069557 3300031824 Bacteria 2209
171 Ga0307413_10089694 3300031824 Bacteria 1998
172 Ga0307413_10111376 3300031824 Bacteria 1833
173 Ga0307413_10138112 3300031824 Bacteria 1680
174 Ga0307410_10003768 3300031852 Bacteria 7687
175 Ga0307410_10011738 3300031852 Bacteria 5027
176 Ga0307410_10066040 3300031852 Bacteria 2490
177 Ga0307410_10091329 3300031852 Bacteria 2162
178 Ga0307406_10038434 3300031901 Bacteria 2963
179 Ga0307406_10149696 3300031901 Bacteria 1663
180 Ga0307407_10012633 3300031903 Bacteria 4066
181 Ga0307407_10027097 3300031903 Bacteria 3044
182 Ga0307412_10031683 3300031911 Bacteria 3341
183 Ga0307412_10069295 3300031911 Bacteria 2400
184 Ga0307412_10112477 3300031911 Bacteria 1946
185 Ga0307409_100028147 3300031995 Bacteria 3997
186 Ga0307409_100029899 3300031995 Bacteria 3906
187 Ga0307416_100016859 3300032002 Bacteria 5091
188 Ga0307416_100073539 3300032002 Bacteria 2850
189 Ga0307416_100138331 3300032002 Bacteria 2208
190 Ga0307416_100232203 3300032002 Bacteria 1779
191 Ga0307416_100318243 3300032002 Bacteria 1556
192 Ga0307416_100357748 3300032002 Bacteria 1480
193 Ga0307414_10074763 3300032004 Bacteria 2456
194 Ga0307414_10162615 3300032004 Bacteria 1775
195 Ga0307414_10188109 3300032004 Bacteria 1668
196 Ga0307411_10055312 3300032005 Bacteria 2610
197 Ga0307411_10111637 3300032005 Bacteria 1958
198 Ga0307510_10049407 3300033180 Bacteria 4474
199 Ga0395900_0156842 3300037418 Bacteria 2325
200 Ga0395900_0282730 3300037418 Bacteria 1650
201 Ga0395905_0006501 3300037471 Bacteria 11753
202 Ga0395905_0067978 3300037471 Bacteria 3338
203 Ga0395901_0149970 3300038443 Bacteria 2450
204 Ga0439436_0001436 3300041404 Bacteria 6905
205 Ga0439461_0012447 3300041410 Bacteria 1593
206 Ga0439466_0020270 3300041411 Bacteria 2370
207 Ga0439442_000177 3300042002 Bacteria 16193
208 Ga0439449_0000036 3300042007 Bacteria 39721
209 Ga0439457_002655 3300042014 Bacteria 5046
210 Ga0495638_0005593 3300046460 Bacteria 9289
211 Ga0495638_0014322 3300046460 Bacteria 5367
212 Ga0495645_0057610 3300046543 Bacteria 2820
213 Ga0495668_0028229 3300046616 Bacteria 3174
214 Ga0495625_0005589 3300046660 Bacteria 11404
215 Ga0495625_0182590 3300046660 Bacteria 1394
216 Ga0495686_0005550 3300047472 Bacteria 9921
217 Ga0495686_0145557 3300047472 Bacteria 1395
218 Ga0496112_0013726 3300048915 Bacteria 7489
219 Ga0496119_0046931 3300048922 Bacteria 2692
220 Ga0496120_0002072 3300048923 Bacteria 21552
221 Ga0496126_0019399 3300048929 Bacteria 6697
222 Ga0501031_0035988 3300049568 Bacteria 3229
223 Ga0501032_0000946 3300049569 Bacteria 23464
224 Ga0501032_0003609 3300049569 Bacteria 11782
225 Ga0501032_0075514 3300049569 Bacteria 2245
226 Ga0501033_0000429 3300049570 Bacteria 40229
227 Ga0501034_0000038 3300049571 Bacteria 237795
228 Ga0501034_0225953 3300049571 Bacteria 1822
229 Ga0501036_0024315 3300049572 Bacteria 5107
230 Ga0501037_0000293 3300049573 Bacteria 42480
231 Ga0501037_0009830 3300049573 Bacteria 7020
232 Ga0501038_0091852 3300049574 Bacteria 2542
233 Ga0501038_0117218 3300049574 Bacteria 2199
234 Ga0501039_0014696 3300049575 Bacteria 5988
235 Ga0501039_0058100 3300049575 Bacteria 2995
236 Ga0501040_0053104 3300049576 Bacteria 2775
237 Ga0501040_0192225 3300049576 Bacteria 1448
238 Ga0501043_0000042 3300049579 Bacteria 116080
239 Ga0501043_0057385 3300049579 Bacteria 3057
240 Ga0501047_0228799 3300049581 Bacteria 1714
241 Ga0501048_0016644 3300049582 Bacteria 5421
242 Ga0501048_0027862 3300049582 Bacteria 4102
243 Ga0501048_0112823 3300049582 Bacteria 1920
244 Ga0501067_0019361 3300049583 Bacteria 3767
245 Ga0501069_0000001 3300049585 Bacteria 289100
246 Ga0501070_0000358 3300049586 Bacteria 41528
247 Ga0501071_0010567 3300049587 Bacteria 6191
248 Ga0501071_0175704 3300049587 Bacteria 1604
249 Ga0501072_0048025 3300049588 Bacteria 3361
250 Ga0501073_0000015 3300049589 Bacteria 157300
251 Ga0501073_0018082 3300049589 Bacteria 5098
252 Ga0501074_0001569 3300049590 Bacteria 15457
253 Ga0501075_0052513 3300049591 Bacteria 3065
254 Ga0501076_0022312 3300049592 Bacteria 4865
255 Ga0501076_0101611 3300049592 Bacteria 2317
256 Ga0501079_0044838 3300049741 Bacteria 3413
257 Ga0501079_0257467 3300049741 Bacteria 1364
258 Ga0501080_0001963 3300049742 Bacteria 17746
259 Ga0501080_0063194 3300049742 Bacteria 3446
260 Ga0501080_0104031 3300049742 Bacteria 2633
261 Ga0501080_0195343 3300049742 Bacteria 1859
262 Ga0501080_0214145 3300049742 Bacteria 1765
263 Ga0501083_0000578 3300049744 Bacteria 23504
264 Ga0501035_0000903 3300049822 Bacteria 31389
265 Ga0501035_0030073 3300049822 Bacteria 4951
266 Ga0501035_0124686 3300049822 Bacteria 2249
267 Ga0501035_0218584 3300049822 Bacteria 1628
268 Ga0501044_0000018 3300049823 Bacteria 225885
269 Ga0501044_0020593 3300049823 Bacteria 7040
270 Ga0501044_0082408 3300049823 Bacteria 3255
271 Ga0501044_0142841 3300049823 Bacteria 2381
272 Ga0501044_0155845 3300049823 Bacteria 2263
273 Ga0501044_0222125 3300049823 Bacteria 1840
274 nmdc:mga03683_14634_c1 3300050489 Bacteria 2906
275 nmdc:mga03683_7962_c1 3300050489 Bacteria 3705
276 nmdc:mga03n38_7203_c1 3300050490 Bacteria 3921
277 nmdc:mga00v17_156406_c1 3300050491 Bacteria 1466
278 nmdc:mga00v17_56636_c1 3300050491 Bacteria 2397
279 nmdc:mga0yw44_32227_c1 3300050492 Bacteria 3052
280 nmdc:mga0yw44_44028_c1 3300050492 Bacteria 2668
281 nmdc:mga0k408_71908_c1 3300050493 Bacteria 2019
282 nmdc:mga07m45_15579_c1 3300050496 Bacteria 4060
283 nmdc:mga05p37_101196_c1 3300050507 Bacteria 3549
284 nmdc:mga05p37_139934_c1 3300050507 Bacteria 2966
285 nmdc:mga05p37_154235_c1 3300050507 Bacteria 2808
286 nmdc:mga05p37_183716_c1 3300050507 Bacteria 2543
287 nmdc:mga05p37_25188_c1 3300050507 Bacteria 7235
288 nmdc:mga05p37_448503_c1 3300050507 Bacteria 1494
289 nmdc:mga05p37_83434_c1 3300050507 Bacteria 3937
290 nmdc:mga05p37_932_c1 3300050507 Bacteria 32971
291 nmdc:mga09592_44817_c1 3300050508 Bacteria 3724
292 nmdc:mga09592_77723_c1 3300050508 Bacteria 2823
293 nmdc:mga08y16_15899_c1 3300050511 Bacteria 7909
294 nmdc:mga08y16_24270_c1 3300050511 Bacteria 6401
295 nmdc:mga08y16_439137_c1 3300050511 Bacteria 1332
296 nmdc:mga0n895_123253_c1 3300050512 Bacteria 2614
297 nmdc:mga0n895_35887_c1 3300050512 Bacteria 4784
298 nmdc:mga0n895_5555_c1 3300050512 Bacteria 10555
299 nmdc:mga0n895_5751_c1 3300050512 Bacteria 10404
300 nmdc:mga0n895_6418_c1 3300050512 Bacteria 9981
301 nmdc:mga0n895_67595_c1 3300050512 Bacteria 3539
302 nmdc:mga0rr50_105821_c1 3300050513 Bacteria 2219
303 nmdc:mga0rr50_124480_c1 3300050513 Bacteria 2056
304 nmdc:mga0rr50_14916_c1 3300050513 Bacteria 5114
305 nmdc:mga08x19_3441_c1 3300050514 Bacteria 9438
306 nmdc:mga08x19_43549_c1 3300050514 Bacteria 2864
307 nmdc:mga08x19_52202_c1 3300050514 Bacteria 2629
308 nmdc:mga08x19_83589_c1 3300050514 Bacteria 2099
309 nmdc:mga08x19_95699_c1 3300050514 Bacteria 1965
310 nmdc:mga0a205_18829_c1 3300050515 Bacteria 6499
311 nmdc:mga0a205_66667_c1 3300050515 Bacteria 3478
312 nmdc:mga0sz30_5768_c1 3300050516 Bacteria 4559
313 Ga0500643_000008 3300053087 Bacteria 457931
314 Ga0500556_0000470 3300053104 Bacteria 28389
315 Ga0500569_031269 3300053109 Bacteria 1496
316 Ga0500593_000830 3300053117 Bacteria 11557
317 Ga0500608_005776 3300053122 Bacteria 4958
318 Ga0500568_0006178 3300053139 Bacteria 6058
319 Ga0500568_0039539 3300053139 Bacteria 1904
320 Ga0500616_0005045 3300053153 Bacteria 9130
321 Ga0500616_0092997 3300053153 Bacteria 1489
322 Ga0500622_0007110 3300053156 Bacteria 6396
323 Ga0500627_0048656 3300053158 Bacteria 1842
324 Ga0501084_0056751 3300054114 Bacteria 3276
325 Ga0501082_0051216 3300060353 Bacteria 3559
326 Ga0501082_0231954 3300060353 Bacteria 1606
327 Ga0530510_0212974 3300061734 Bacteria 1435

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0053104 Ga0501040_0053104_1726_2742 338
2 3300037418 Ga0395900_0282730 Ga0395900_0282730_159_1403 350
3 3300031548 Ga0307408_100053051 Ga0307408_1000530511 351
4 3300031731 Ga0307405_10001802 Ga0307405_100018022 351
5 3300032002 Ga0307416_100232203 Ga0307416_1002322031 351
6 3300032002 Ga0307416_100318243 Ga0307416_1003182431 351
7 3300013102 Ga0157371_10176178 Ga0157371_101761781 354
8 3300013104 Ga0157370_10009575 Ga0157370_100095753 354
9 3300031548 Ga0307408_100019143 Ga0307408_1000191432 356
10 3300031852 Ga0307410_10066040 Ga0307410_100660403 356
11 3300011119 Ga0105246_10082297 Ga0105246_100822971 357
12 3300031901 Ga0307406_10149696 Ga0307406_101496962 360
13 3300049569 Ga0501032_0003609 Ga0501032_0003609_1346_2569 362
14 3300049572 Ga0501036_0024315 Ga0501036_0024315_3142_4365 362
15 3300049573 Ga0501037_0009830 Ga0501037_0009830_1539_2762 362
16 3300049575 Ga0501039_0014696 Ga0501039_0014696_750_1973 362
17 3300050514 nmdc:mga08x19_3441_c1 nmdc:mga08x19_3441_c1_5393_6580 364
18 3300005545 Ga0070695_100110119 Ga0070695_1001101191 365
19 3300031911 Ga0307412_10112477 Ga0307412_101124772 365
20 3300005471 Ga0070698_100077026 Ga0070698_1000770264 366
21 3300006871 Ga0075434_100114987 Ga0075434_1001149873 366
22 3300009147 Ga0114129_10311679 Ga0114129_103116793 366
23 3300050512 nmdc:mga0n895_123253_c1 nmdc:mga0n895_123253_c1_149_1405 366
24 3300050515 nmdc:mga0a205_66667_c1 nmdc:mga0a205_66667_c1_246_1502 366
25 3300005536 Ga0070697_100177655 Ga0070697_1001776552 367
26 3300011119 Ga0105246_10155886 Ga0105246_101558862 367
27 3300025303 Ga0209051_1008029 Ga0209051_10080293 367
28 3300031852 Ga0307410_10011738 Ga0307410_100117382 367
29 3300032004 Ga0307414_10162615 Ga0307414_101626152 367
30 3300041411 Ga0439466_0020270 Ga0439466_0020270_470_1690 367
31 3300006844 Ga0075428_100295322 Ga0075428_1002953222 368
32 3300009148 Ga0105243_10009399 Ga0105243_100093993 368
33 3300011119 Ga0105246_10095545 Ga0105246_100955452 368
34 3300048915 Ga0496112_0013726 Ga0496112_0013726_3634_4875 368
35 3300050514 nmdc:mga08x19_83589_c1 nmdc:mga08x19_83589_c1_130_1371 369
36 iso_pu_bacteria 2882456835 2882462054 369
37 3300005327 Ga0070658_10059953 Ga0070658_100599532 370
38 3300031548 Ga0307408_100020305 Ga0307408_1000203053 370
39 3300031731 Ga0307405_10026595 Ga0307405_100265953 370
40 3300031824 Ga0307413_10009752 Ga0307413_100097523 370
41 3300031852 Ga0307410_10003768 Ga0307410_100037686 370
42 3300031903 Ga0307407_10027097 Ga0307407_100270973 370
43 3300031995 Ga0307409_100028147 Ga0307409_1000281473 370
44 3300032002 Ga0307416_100016859 Ga0307416_1000168593 370
45 3300050507 nmdc:mga05p37_183716_c1 nmdc:mga05p37_183716_c1_771_1988 370
46 3300005536 Ga0070697_100069285 Ga0070697_1000692853 371
47 3300006914 Ga0075436_100105574 Ga0075436_1001055742 371
48 3300009094 Ga0111539_10017652 Ga0111539_100176527 371
49 3300050507 nmdc:mga05p37_448503_c1 nmdc:mga05p37_448503_c1_246_1463 371
50 3300050511 nmdc:mga08y16_15899_c1 nmdc:mga08y16_15899_c1_4513_5790 371
51 3300032005 Ga0307411_10055312 Ga0307411_100553122 372
52 3300049582 Ga0501048_0027862 Ga0501048_0027862_1624_2826 372
53 3300050513 nmdc:mga0rr50_14916_c1 nmdc:mga0rr50_14916_c1_3378_4604 372
54 3300031852 Ga0307410_10091329 Ga0307410_100913292 373
55 3300005344 Ga0070661_100000160 Ga0070661_1000001609 374
56 3300005353 Ga0070669_100288757 Ga0070669_1002887571 374
57 3300005844 Ga0068862_100027289 Ga0068862_1000272893 374
58 3300025920 Ga0207649_10000029 Ga0207649_1000002985 374
59 3300050507 nmdc:mga05p37_154235_c1 nmdc:mga05p37_154235_c1_1186_2412 374
60 3300006914 Ga0075436_100085548 Ga0075436_1000855482 375
61 3300031731 Ga0307405_10024590 Ga0307405_100245903 375
62 3300031911 Ga0307412_10069295 Ga0307412_100692952 375
63 3300042002 Ga0439442_000177 Ga0439442_000177_11931_13136 375
64 3300050514 nmdc:mga08x19_52202_c1 nmdc:mga08x19_52202_c1_478_1704 375
65 3300037471 Ga0395905_0067978 Ga0395905_0067978_1694_2893 376
66 3300005563 Ga0068855_100163637 Ga0068855_1001636372 377
67 3300006844 Ga0075428_100129698 Ga0075428_1001296983 377
68 3300031548 Ga0307408_100133610 Ga0307408_1001336102 377
69 3300031824 Ga0307413_10069557 Ga0307413_100695571 377
70 3300032004 Ga0307414_10074763 Ga0307414_100747634 377
71 3300049582 Ga0501048_0112823 Ga0501048_0112823_559_1866 377
72 3300050507 nmdc:mga05p37_83434_c1 nmdc:mga05p37_83434_c1_2226_3491 377
73 3300005468 Ga0070707_100048564 Ga0070707_1000485644 378
74 3300009093 Ga0105240_10055861 Ga0105240_100558617 378
75 3300031824 Ga0307413_10089694 Ga0307413_100896942 378
76 3300032004 Ga0307414_10188109 Ga0307414_101881091 378
77 3300005518 Ga0070699_100031660 Ga0070699_1000316604 379
78 3300006914 Ga0075436_100033872 Ga0075436_1000338724 379
79 3300025245 Ga0207425_1007216 Ga0207425_10072163 379
80 3300025258 Ga0209129_1000180 Ga0209129_100018021 379
81 3300025294 Ga0209025_1001362 Ga0209025_100136225 379
82 3300031824 Ga0307413_10002843 Ga0307413_100028433 379
83 3300032002 Ga0307416_100357748 Ga0307416_1003577482 379
84 iso_pu_bacteria 2571042365 2572253750 379
85 3300006847 Ga0075431_100295130 Ga0075431_1002951302 380
86 3300007076 Ga0075435_100040305 Ga0075435_1000403056 380
87 3300009147 Ga0114129_10223646 Ga0114129_102236462 380
88 3300009176 Ga0105242_10249376 Ga0105242_102493762 380
89 3300005444 Ga0070694_100026016 Ga0070694_1000260163 381
90 3300005471 Ga0070698_100002736 Ga0070698_1000027367 381
91 3300005471 Ga0070698_100057431 Ga0070698_1000574313 381
92 3300007076 Ga0075435_100149562 Ga0075435_1001495622 381
93 3300025922 Ga0207646_10107832 Ga0207646_101078323 381
94 3300025935 Ga0207709_10186218 Ga0207709_101862182 381
95 iso_pu_bacteria 2643221687 2644489348 381
96 3300032002 Ga0307416_100138331 Ga0307416_1001383312 382
97 3300037471 Ga0395905_0006501 Ga0395905_0006501_6510_7778 382
98 3300041404 Ga0439436_0001436 Ga0439436_0001436_137_1378 382
99 3300041410 Ga0439461_0012447 Ga0439461_0012447_51_1292 382
100 3300042007 Ga0439449_0000036 Ga0439449_0000036_37033_38274 382
101 3300042014 Ga0439457_002655 Ga0439457_002655_1897_3138 382
102 3300003316 rootH1_10078654 rootH1_100786542 383
103 3300005355 Ga0070671_100028503 Ga0070671_1000285032 383
104 3300005356 Ga0070674_100010566 Ga0070674_1000105664 383
105 3300005536 Ga0070697_100303398 Ga0070697_1003033981 383
106 3300009094 Ga0111539_10010027 Ga0111539_100100279 383
107 3300010375 Ga0105239_10030437 Ga0105239_100304373 383
108 3300027907 Ga0207428_10002027 Ga0207428_100020272 383
109 3300031731 Ga0307405_10083646 Ga0307405_100836462 383
110 3300050507 nmdc:mga05p37_25188_c1 nmdc:mga05p37_25188_c1_2917_4113 383
111 3300050508 nmdc:mga09592_44817_c1 nmdc:mga09592_44817_c1_658_1854 383
112 3300050508 nmdc:mga09592_77723_c1 nmdc:mga09592_77723_c1_456_1652 383
113 3300050511 nmdc:mga08y16_24270_c1 nmdc:mga08y16_24270_c1_2945_4141 383
114 3300050511 nmdc:mga08y16_439137_c1 nmdc:mga08y16_439137_c1_40_1236 383
115 3300050512 nmdc:mga0n895_35887_c1 nmdc:mga0n895_35887_c1_2763_3959 383
116 3300050512 nmdc:mga0n895_5751_c1 nmdc:mga0n895_5751_c1_5900_7096 383
117 3300050512 nmdc:mga0n895_67595_c1 nmdc:mga0n895_67595_c1_2245_3441 383
118 3300050515 nmdc:mga0a205_18829_c1 nmdc:mga0a205_18829_c1_1960_3156 383
119 3300031548 Ga0307408_100026368 Ga0307408_1000263682 384
120 3300031824 Ga0307413_10111376 Ga0307413_101113762 384
121 3300031901 Ga0307406_10038434 Ga0307406_100384343 384
122 3300032002 Ga0307416_100073539 Ga0307416_1000735392 384
123 3300047472 Ga0495686_0145557 Ga0495686_0145557_156_1358 384
124 3300048922 Ga0496119_0046931 Ga0496119_0046931_965_2233 384
125 3300048923 Ga0496120_0002072 Ga0496120_0002072_4649_5917 384
126 3300049822 Ga0501035_0218584 Ga0501035_0218584_66_1319 384
127 3300053087 Ga0500643_000008 Ga0500643_000008_120975_122186 384
128 3300053104 Ga0500556_0000470 Ga0500556_0000470_14963_16162 384
129 3300053117 Ga0500593_000830 Ga0500593_000830_2960_4159 384
130 3300053158 Ga0500627_0048656 Ga0500627_0048656_329_1531 384
131 iso_pu_bacteria 2974302888 2974305007 384
132 3300005546 Ga0070696_100133070 Ga0070696_1001330702 385
133 3300006847 Ga0075431_100024725 Ga0075431_1000247255 385
134 3300006871 Ga0075434_100026066 Ga0075434_1000260664 385
135 3300009147 Ga0114129_10149360 Ga0114129_101493601 385
136 3300025303 Ga0209051_1032204 Ga0209051_10322042 385
137 3300025928 Ga0207700_10074734 Ga0207700_100747342 385
138 3300049571 Ga0501034_0000038 Ga0501034_0000038_226041_227249 385
139 3300050507 nmdc:mga05p37_932_c1 nmdc:mga05p37_932_c1_5212_6414 385
140 3300050512 nmdc:mga0n895_5555_c1 nmdc:mga0n895_5555_c1_3701_4903 385
141 3300050512 nmdc:mga0n895_6418_c1 nmdc:mga0n895_6418_c1_6239_7441 385
142 3300050513 nmdc:mga0rr50_124480_c1 nmdc:mga0rr50_124480_c1_264_1466 385
143 3300050514 nmdc:mga08x19_95699_c1 nmdc:mga08x19_95699_c1_426_1628 385
144 3300050516 nmdc:mga0sz30_5768_c1 nmdc:mga0sz30_5768_c1_2136_3338 385
145 3300009036 Ga0105244_10006177 Ga0105244_100061772 386
146 3300011119 Ga0105246_10019309 Ga0105246_100193092 386
147 3300025303 Ga0209051_1004857 Ga0209051_10048576 386
148 3300031731 Ga0307405_10002619 Ga0307405_100026193 386
149 3300049574 Ga0501038_0117218 Ga0501038_0117218_603_1811 386
150 3300049575 Ga0501039_0058100 Ga0501039_0058100_989_2197 386
151 3300049742 Ga0501080_0214145 Ga0501080_0214145_223_1428 386
152 3300049823 Ga0501044_0082408 Ga0501044_0082408_315_1520 386
153 3300050492 nmdc:mga0yw44_32227_c1 nmdc:mga0yw44_32227_c1_1687_2892 386
154 iso_pu_bacteria 2693429783 2694627776 386
155 iso_pu_bacteria 2693429784 2694636049 386
156 iso_pu_bacteria 2693429784 2694636890 386
157 3300031903 Ga0307407_10012633 Ga0307407_100126332 387
158 3300031911 Ga0307412_10031683 Ga0307412_100316833 387
159 3300046660 Ga0495625_0005589 Ga0495625_0005589_1526_2737 387
160 3300046660 Ga0495625_0182590 Ga0495625_0182590_137_1345 387
161 3300005471 Ga0070698_100018030 Ga0070698_1000180305 388
162 3300005536 Ga0070697_100095588 Ga0070697_1000955882 388
163 3300005546 Ga0070696_100158173 Ga0070696_1001581732 388
164 3300005937 Ga0081455_10109110 Ga0081455_101091102 388
165 3300006852 Ga0075433_10049418 Ga0075433_100494183 388
166 3300006914 Ga0075436_100029961 Ga0075436_1000299614 388
167 3300007076 Ga0075435_100070668 Ga0075435_1000706683 388
168 3300009147 Ga0114129_10022110 Ga0114129_100221105 388
169 3300013297 Ga0157378_10104510 Ga0157378_101045102 388
170 3300025913 Ga0207695_10000190 Ga0207695_1000019043 388
171 3300025922 Ga0207646_10065117 Ga0207646_100651171 388
172 3300025939 Ga0207665_10034950 Ga0207665_100349501 388
173 3300049587 Ga0501071_0175704 Ga0501071_0175704_297_1517 388
174 3300050507 nmdc:mga05p37_101196_c1 nmdc:mga05p37_101196_c1_1131_2348 388
175 3300050513 nmdc:mga0rr50_105821_c1 nmdc:mga0rr50_105821_c1_991_2208 388
176 3300050514 nmdc:mga08x19_43549_c1 nmdc:mga08x19_43549_c1_272_1489 388
177 3300054114 Ga0501084_0056751 Ga0501084_0056751_1345_2565 388
178 3300060353 Ga0501082_0231954 Ga0501082_0231954_89_1309 388
179 3300061734 Ga0530510_0212974 Ga0530510_0212974_83_1303 388
180 3300021321 Ga0214542_1012200 Ga0214542_10122002 389
181 3300021327 Ga0214543_1000038 Ga0214543_100003821 389
182 3300030735 Ga0316178_1118312 Ga0316178_11183121 389
183 3300037418 Ga0395900_0156842 Ga0395900_0156842_674_1891 389
184 3300049568 Ga0501031_0035988 Ga0501031_0035988_445_1701 389
185 3300049569 Ga0501032_0000946 Ga0501032_0000946_5932_7188 389
186 3300049570 Ga0501033_0000429 Ga0501033_0000429_36748_38004 389
187 3300049573 Ga0501037_0000293 Ga0501037_0000293_6290_7546 389
188 3300049579 Ga0501043_0000042 Ga0501043_0000042_76367_77623 389
189 3300049583 Ga0501067_0019361 Ga0501067_0019361_922_2178 389
190 3300049585 Ga0501069_0000001 Ga0501069_0000001_131004_132260 389
191 3300049586 Ga0501070_0000358 Ga0501070_0000358_6278_7534 389
192 3300049587 Ga0501071_0010567 Ga0501071_0010567_4128_5384 389
193 3300049589 Ga0501073_0018082 Ga0501073_0018082_609_1865 389
194 3300049590 Ga0501074_0001569 Ga0501074_0001569_7278_8534 389
195 3300049592 Ga0501076_0101611 Ga0501076_0101611_867_2123 389
196 3300049742 Ga0501080_0001963 Ga0501080_0001963_6225_7481 389
197 3300049744 Ga0501083_0000578 Ga0501083_0000578_2628_3884 389
198 3300049822 Ga0501035_0000903 Ga0501035_0000903_23803_25059 389
199 3300049823 Ga0501044_0000018 Ga0501044_0000018_56767_58023 389
200 3300002773 JGI25152J39213_1000109 JGI25152J39213_10001097 390
201 3300030733 Ga0314311_1151601 Ga0314311_11516012 390
202 3300046616 Ga0495668_0028229 Ga0495668_0028229_1831_3069 390
203 3300049823 Ga0501044_0222125 Ga0501044_0222125_162_1382 390
204 3300050489 nmdc:mga03683_7962_c1 nmdc:mga03683_7962_c1_2031_3248 390
205 3300050490 nmdc:mga03n38_7203_c1 nmdc:mga03n38_7203_c1_1228_2445 390
206 3300050491 nmdc:mga00v17_56636_c1 nmdc:mga00v17_56636_c1_845_2062 390
207 3300050493 nmdc:mga0k408_71908_c1 nmdc:mga0k408_71908_c1_621_1838 390
208 3300050496 nmdc:mga07m45_15579_c1 nmdc:mga07m45_15579_c1_2204_3421 390
209 3300003187 JGI25151J46595_10000265 JGI25151J46595_1000026545 391
210 3300009094 Ga0111539_10089667 Ga0111539_100896672 391
211 3300025294 Ga0209025_1000026 Ga0209025_1000026326 391
212 3300030732 Ga0316176_1193234 Ga0316176_11932342 392
213 iso_pu_bacteria 2643221615 2644092627 392
214 iso_pu_bacteria 2643221657 2644322240 392
215 3300009545 Ga0105237_10038673 Ga0105237_100386732 393
216 3300009551 Ga0105238_10040306 Ga0105238_100403067 393
217 3300010375 Ga0105239_10177334 Ga0105239_101773342 393
218 3300013105 Ga0157369_10086635 Ga0157369_100866353 393
219 3300025913 Ga0207695_10263570 Ga0207695_102635702 393
220 3300025914 Ga0207671_10035935 Ga0207671_100359353 393
221 3300025924 Ga0207694_10008166 Ga0207694_100081668 393
222 iso_pu_bacteria 2844849076 2844850583 393
223 3300005545 Ga0070695_100122129 Ga0070695_1001221292 394
224 3300005546 Ga0070696_100032741 Ga0070696_1000327412 394
225 3300053109 Ga0500569_031269 Ga0500569_031269_175_1437 394
226 iso_pu_bacteria 2690315906 2691511828 394
227 iso_pu_bacteria 2758568016 2758638561 394
228 iso_pu_bacteria 2857740372 2857744861 394
229 iso_pu_bacteria 2904497146 2904499105 394
230 iso_pu_bacteria 2919034639 2919039081 394
231 iso_pu_bacteria 2919059106 2919060920 394
232 iso_pu_bacteria 2919538618 2919541329 394
233 iso_pu_bacteria 2932426870 2932430159 394
234 iso_pu_bacteria 2939647034 2939651229 394
235 iso_pu_bacteria 2939674588 2939678961 394
236 iso_pu_bacteria 2945956166 2945956228 394
237 iso_pu_bacteria 2946037020 2946041566 394
238 iso_pu_bacteria 2953998280 2954002767 394
239 3300006051 Ga0075364_10172951 Ga0075364_101729511 395
240 3300050491 nmdc:mga00v17_156406_c1 nmdc:mga00v17_156406_c1_12_1283 395
241 3300006186 Ga0075369_10007294 Ga0075369_100072941 396
242 3300006844 Ga0075428_100027390 Ga0075428_1000273903 396
243 3300006871 Ga0075434_100021346 Ga0075434_1000213464 396
244 3300006880 Ga0075429_100069895 Ga0075429_1000698953 396
245 3300007076 Ga0075435_100093268 Ga0075435_1000932681 396
246 3300025273 Ga0209673_1026592 Ga0209673_10265921 396
247 3300025303 Ga0209051_1003723 Ga0209051_10037236 396
248 3300031548 Ga0307408_100014633 Ga0307408_1000146334 396
249 3300031995 Ga0307409_100029899 Ga0307409_1000298992 396
250 iso_pu_bacteria 2654587920 2656278950 396
251 3300005439 Ga0070711_100064083 Ga0070711_1000640833 397
252 3300005545 Ga0070695_100050769 Ga0070695_1000507692 397
253 3300006852 Ga0075433_10025954 Ga0075433_100259542 397
254 3300006871 Ga0075434_100018861 Ga0075434_1000188613 397
255 3300025906 Ga0207699_10061925 Ga0207699_100619253 397
256 iso_pu_bacteria 2881412998 2881415065 397
257 3300005455 Ga0070663_100006263 Ga0070663_1000062634 398
258 3300006844 Ga0075428_100119622 Ga0075428_1001196223 398
259 3300009147 Ga0114129_10236456 Ga0114129_102364561 398
260 3300025916 Ga0207663_10003106 Ga0207663_100031062 398
261 3300038443 Ga0395901_0149970 Ga0395901_0149970_884_2128 398
262 3300050507 nmdc:mga05p37_139934_c1 nmdc:mga05p37_139934_c1_355_1620 398
263 iso_pu_bacteria 2513237159 2513999795 398
264 iso_pu_bacteria 2842521101 2842526367 398
265 3300005615 Ga0070702_100034685 Ga0070702_1000346853 399
266 3300007788 Ga0099795_10033514 Ga0099795_100335142 399
267 3300014326 Ga0157380_10059550 Ga0157380_100595502 399
268 3300049569 Ga0501032_0075514 Ga0501032_0075514_134_1390 399
269 3300049822 Ga0501035_0030073 Ga0501035_0030073_3298_4554 399
270 3300049823 Ga0501044_0142841 Ga0501044_0142841_992_2248 399
271 iso_pu_bacteria 2513237305 2514421996 399
272 iso_pu_bacteria 2721755686 2723573254 399
273 iso_pu_bacteria 2937822353 2937822698 399
274 3300031824 Ga0307413_10138112 Ga0307413_101381122 400
275 3300032005 Ga0307411_10111637 Ga0307411_101116372 400
276 3300049588 Ga0501072_0048025 Ga0501072_0048025_1253_2515 400
277 3300049591 Ga0501075_0052513 Ga0501075_0052513_594_1856 400
278 3300049592 Ga0501076_0022312 Ga0501076_0022312_850_2112 400
279 3300049741 Ga0501079_0044838 Ga0501079_0044838_459_1721 400
280 iso_pu_bacteria 2509276019 2509376514 400
281 iso_pu_bacteria 2558860100 2558864417 400
282 iso_pu_bacteria 2582581306 2585270424 400
283 iso_pu_bacteria 2582581865 2585387756 400
284 iso_pu_bacteria 2582581866 2585397935 400
285 iso_pu_bacteria 2850079185 2850081512 400
286 iso_pu_bacteria 2855730933 2855732350 400
287 iso_pu_bacteria 2855767633 2855769058 400
288 3300003775 Ga0055524_1012812 Ga0055524_10128124 401
289 3300025299 Ga0209256_1000396 Ga0209256_100039652 401
290 3300027682 Ga0209971_1013523 Ga0209971_10135231 401
291 3300033180 Ga0307510_10049407 Ga0307510_100494071 401
292 3300049742 Ga0501080_0063194 Ga0501080_0063194_1186_2457 401
293 3300053153 Ga0500616_0092997 Ga0500616_0092997_39_1295 401
294 iso_pu_bacteria 2643221564 2643836670 401
295 iso_pu_bacteria 2756170246 2756675107 401
296 iso_pu_bacteria 2844002411 2844003400 401
297 iso_pu_bacteria 2871451962 2871457006 401
298 iso_pu_bacteria 2871466892 2871471708 401
299 iso_pu_bacteria 2899803654 2899804454 401
300 iso_pu_bacteria 2906378014 2906382017 401
301 iso_pu_bacteria 2920822456 2920825264 401
302 3300031548 Ga0307408_100049545 Ga0307408_1000495451 402
303 iso_pu_bacteria 2508501122 2509108353 402
304 iso_pu_bacteria 2939582691 2939588765 402
305 3300006038 Ga0075365_10077899 Ga0075365_100778992 403
306 3300006048 Ga0075363_100024754 Ga0075363_1000247543 403
307 3300028794 Ga0307515_10058049 Ga0307515_100580493 403
308 3300046543 Ga0495645_0057610 Ga0495645_0057610_361_1632 403
309 3300049581 Ga0501047_0228799 Ga0501047_0228799_47_1303 403
310 3300049589 Ga0501073_0000015 Ga0501073_0000015_57723_58997 403
311 3300049742 Ga0501080_0104031 Ga0501080_0104031_1204_2478 403
312 3300049822 Ga0501035_0124686 Ga0501035_0124686_787_2043 403
313 3300049823 Ga0501044_0020593 Ga0501044_0020593_3160_4416 403
314 3300050489 nmdc:mga03683_14634_c1 nmdc:mga03683_14634_c1_35_1291 403
315 3300050492 nmdc:mga0yw44_44028_c1 nmdc:mga0yw44_44028_c1_890_2146 403
316 iso_pu_bacteria 2510065059 2510315065 403
317 iso_pu_bacteria 2558860100 2558861125 403
318 iso_pu_bacteria 2775506901 2776266141 403
319 iso_pu_bacteria 2791355091 2792624924 403
320 iso_pu_bacteria 2869162929 2869166075 403
321 iso_pu_bacteria 2874168670 2874172501 403
322 iso_pu_bacteria 2876377896 2876379259 403
323 iso_pu_bacteria 2882632389 2882635281 403
324 iso_pu_bacteria 2933418574 2933422153 403
325 iso_pu_bacteria 2938014810 2938015147 403
326 3300025284 Ga0209130_1017690 Ga0209130_10176902 404
327 3300028794 Ga0307515_10000154 Ga0307515_1000015414 404
328 3300028794 Ga0307515_10004744 Ga0307515_1000474423 404
329 3300031456 Ga0307513_10005286 Ga0307513_1000528613 404
330 iso_pu_bacteria 2599185352 2600195473 404
331 iso_pu_bacteria 2643221557 2643803040 404
332 iso_pu_bacteria 2643221610 2644063402 404
333 iso_pu_bacteria 2643221618 2644107235 404
334 iso_pu_bacteria 2643221626 2644150800 404
335 iso_pu_bacteria 2643221655 2644308630 404
336 iso_pu_bacteria 2643221659 2644335447 404
337 iso_pu_bacteria 2643221668 2644374685 404
338 iso_pu_bacteria 2643221675 2644414165 404
339 iso_pu_bacteria 2643221680 2644447693 404
340 iso_pu_bacteria 2643221698 2644539852 404
341 iso_pu_bacteria 2643221712 2644614571 404
342 iso_pu_bacteria 2643221726 2644690166 404
343 iso_pu_bacteria 2838074704 2838076814 404
344 iso_pu_bacteria 2844163670 2844164622 404
345 iso_pu_bacteria 2896384573 2896390392 404
346 iso_pu_bacteria 2920760137 2920761473 404
347 iso_pu_bacteria 2941499720 2941502090 404
348 3300013307 Ga0157372_10121860 Ga0157372_101218602 405
349 3300025924 Ga0207694_10055941 Ga0207694_100559412 405
350 3300026041 Ga0207639_10156129 Ga0207639_101561292 405
351 3300047472 Ga0495686_0005550 Ga0495686_0005550_2944_4224 405
352 3300048929 Ga0496126_0019399 Ga0496126_0019399_4167_5438 405
353 3300053153 Ga0500616_0005045 Ga0500616_0005045_6947_8224 405
354 3300060353 Ga0501082_0051216 Ga0501082_0051216_439_1701 405
355 3300028794 Ga0307515_10087371 Ga0307515_100873712 406
356 3300002741 JGI25157J39369_1000555 JGI25157J39369_100055518 407
357 3300002987 JGI25159J45721_1000014 JGI25159J45721_1000014103 407
358 3300003187 JGI25151J46595_10027148 JGI25151J46595_100271482 407
359 3300003214 JGI25165J46597_1000079 JGI25165J46597_100007962 407
360 3300003354 JGI25160J50197_1000020 JGI25160J50197_1000020103 407
361 3300003374 JGI25161J50226_1001410 JGI25161J50226_10014108 407
362 3300003771 Ga0055526_1005168 Ga0055526_10051687 407
363 3300003781 Ga0055536_1011464 Ga0055536_10114642 407
364 3300004625 Ga0055543_1000768 Ga0055543_100076810 407
365 3300005262 Ga0065165_1000013 Ga0065165_1000013115 407
366 3300005441 Ga0070700_100094806 Ga0070700_1000948061 407
367 3300005844 Ga0068862_100081978 Ga0068862_1000819783 407
368 3300006048 Ga0075363_100036061 Ga0075363_1000360612 407
369 3300006051 Ga0075364_10109113 Ga0075364_101091132 407
370 3300006177 Ga0075362_10033188 Ga0075362_100331882 407
371 3300006353 Ga0075370_10091246 Ga0075370_100912461 407
372 3300013249 Ga0171463_1003 Ga0171463_1003111 407
373 3300014326 Ga0157380_10024473 Ga0157380_100244731 407
374 3300015690 Ga0183363_1085 Ga0183363_108521 407
375 3300025250 Ga0209026_1000118 Ga0209026_1000118110 407
376 3300025256 Ga0209759_1000076 Ga0209759_1000076153 407
377 3300025261 Ga0209233_1000247 Ga0209233_100024728 407
378 3300025284 Ga0209130_1000034 Ga0209130_1000034112 407
379 3300025292 Ga0209676_1019352 Ga0209676_10193521 407
380 3300025294 Ga0209025_1000311 Ga0209025_100031129 407
381 3300025295 Ga0209564_1000013 Ga0209564_1000013112 407
382 3300025297 Ga0209758_1034104 Ga0209758_10341042 407
383 3300025298 Ga0209050_1009685 Ga0209050_10096853 407
384 3300025299 Ga0209256_1003573 Ga0209256_100357310 407
385 3300025302 Ga0207426_1000006 Ga0207426_1000006485 407
386 3300025303 Ga0209051_1010204 Ga0209051_10102044 407
387 3300025901 Ga0207688_10016441 Ga0207688_100164412 407
388 3300028794 Ga0307515_10000285 Ga0307515_1000028515 407
389 3300031251 Ga0265327_10016080 Ga0265327_100160803 407
390 3300046460 Ga0495638_0005593 Ga0495638_0005593_5990_7270 407
391 3300046460 Ga0495638_0014322 Ga0495638_0014322_581_1852 407
392 3300049571 Ga0501034_0225953 Ga0501034_0225953_88_1356 407
393 3300049574 Ga0501038_0091852 Ga0501038_0091852_378_1646 407
394 3300049576 Ga0501040_0192225 Ga0501040_0192225_50_1318 407
395 3300049579 Ga0501043_0057385 Ga0501043_0057385_530_1798 407
396 3300049582 Ga0501048_0016644 Ga0501048_0016644_1854_3122 407
397 3300049741 Ga0501079_0257467 Ga0501079_0257467_65_1333 407
398 3300049742 Ga0501080_0195343 Ga0501080_0195343_204_1472 407
399 3300049823 Ga0501044_0155845 Ga0501044_0155845_466_1734 407
400 3300053122 Ga0500608_005776 Ga0500608_005776_1815_3086 407
401 3300053139 Ga0500568_0006178 Ga0500568_0006178_188_1465 407
402 3300053139 Ga0500568_0039539 Ga0500568_0039539_16_1284 407
403 3300053156 Ga0500622_0007110 Ga0500622_0007110_4900_6171 407
404 iso_pu_bacteria 2773857925 2774868919 407

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06772

LtrA

Bacterial low temperature requirement A protein (LtrA)

67

432

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6w8n-assembly1.cif.gz_B structure of a trans-membrane protein 0.5587 30 389
7lf6-assembly1.cif.gz_B structure of lysosomal membrane protein 0.5233 30 388
6w8n-assembly1.cif.gz_B structure of a trans-membrane protein 0.5092 30 389
4gp8-assembly1.cif.gz_A structure of recombinant cytochrome ba3 oxidase mutant y133w+t231f from thermus thermophilus 0.3414 31 382
6eid-assembly2.cif.gz_B crystal structure of wild-type channelrhodopsin 2 0.3383 48 345
ID Description Score Start End Superfamily
af_Q9Y7U1_22_240_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5129 35 207 1.20.1070.10
af_I1NB82_29_177_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.4867 224 389 1.20.140.40
af_Q9FKW5_2_121_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.4861 228 348 1.20.930.20
af_K7KC87_1_156_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.4792 228 357 1.20.1410.10
af_Q9FKW5_2_121_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.469 228 348 1.20.930.20
ID Description Score Start End GO Terms
AF-A0A1G9NV35-F1-model_v4 Low temperature requirement protein LtrA 0.9848 14 357 GO:0016020
AF-A0A2W4JCK6-F1-model_v4 Low temperature requirement protein A 0.9745 2 336 GO:0016020
AF-A0A359IPU6-F1-model_v4 deleted 0.9714 18 183
AF-A0A2W4JCK6-F1-model_v4 Low temperature requirement protein A 0.9688 2 336 GO:0016020
AF-A0A3C1E1H9-F1-model_v4 Low temperature requirement protein A 0.9672 18 313 GO:0016020

Feature Viewer

pLDDT pTM Quality
81.61 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map