F435849

General Info

Members Datasets Scaffolds Average Seq Length
405 230 810 209

Family's Representative Sequence

Representative Sequence 3300003761|Ga0055535_1002349|Ga0055535_10023494
Length 204
Sequence MLKLEVYLINIMAQTSSITTLFIDIGGVLLTNGWDRAARKLAASTFSLDPVEFEERHHLTFDTYEEGKLTMDEYLNRIVFFMFSRTEPYNEMIEMICQLKEKYGLKIAIVNNEGRELNQYRITTFGINKFVDFFISSCFVHFRKPDADIFRIALDIAFVKPKEVLYIEDRAMFVSVAEGLGINGLLHVDYASTKEKLASYGLIL

Samples

Sample ID Description Type Environment
1 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
80 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
118 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
119 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
120 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
123 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
124 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
127 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
141 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
145 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
146 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
147 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
148 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
149 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
150 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
152 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
157 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
158 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
203 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
204 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
205 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
206 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
207 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
208 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
209 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
210 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
213 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
214 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
218 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
219 2818991444 Filimonas endophytica 3197 Isolate Unclassified
220 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
221 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
222 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
223 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
224 2914759650 Rhizosphaericola mali Isolate Rhizosphere
225 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
226 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
227 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
228 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
229 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
230 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.54
Metatranscriptomes 0.25
Isolates 3.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.88
Nodule 0
Rhizoplane 0.25
Rhizosphere 84.44
Stem 0
Stem Tuber 0
Unclassified 10.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055535_1002349 3300003761 Bacteria 6834
2 SwRhRL2b_contig_2331142 2162886007 Bacteria 920
3 JGI24740J21852_10009658 3300001979 Bacteria 3763
4 JGI24739J22299_10010942 3300001989 Unclassified 3355
5 JGI25154J39366_1000014 3300002738 Bacteria 265287
6 JGI25159J45721_1016808 3300002987 Bacteria 1544
7 JGI25153J46596_10012293 3300003215 Bacteria 3707
8 JGI25153J46596_10028917 3300003215 Unclassified 1912
9 rootH1_10041388 3300003316 Bacteria 5229
10 rootH2_10044532 3300003320 Bacteria 2753
11 rootH2_10063065 3300003320 Unclassified 1599
12 rootH2_10244250 3300003320 Unclassified 1394
13 rootH1_10022911 3300003323 Bacteria 25134
14 rootH1_10055761 3300003323 Bacteria 1956
15 rootH1_10086867 3300003323 Bacteria 5072
16 JGI25160J50197_1000469 3300003354 Bacteria 24764
17 JGI25160J50197_1006316 3300003354 Bacteria 4813
18 JGI25160J50197_1019274 3300003354 Bacteria 2097
19 Ga0055528_1001321 3300003790 Bacteria 15499
20 Ga0055530_10001156 3300003791 Bacteria 20457
21 Ga0055531_10000255 3300003794 Bacteria 56959
22 Ga0065165_1000036 3300005262 Bacteria 212900
23 Ga0065165_1021086 3300005262 Bacteria 2272
24 Ga0065704_10073064 3300005289 Bacteria 7620
25 Ga0070690_100201936 3300005330 Bacteria 1384
26 Ga0070666_10015874 3300005335 Bacteria 4811
27 Ga0070680_100001790 3300005336 Bacteria 15774
28 Ga0070682_100001196 3300005337 Bacteria 14792
29 Ga0068868_100210447 3300005338 Bacteria 1625
30 Ga0070691_10102783 3300005341 Bacteria 1421
31 Ga0070661_100546407 3300005344 Bacteria 932
32 Ga0070669_100036318 3300005353 Bacteria 3570
33 Ga0070671_100083116 3300005355 Bacteria 2677
34 Ga0070667_100418329 3300005367 Bacteria 1221
35 Ga0070678_100012467 3300005456 Bacteria 5286
36 Ga0070662_100149881 3300005457 Bacteria 1815
37 Ga0070681_10003107 3300005458 Bacteria 15431
38 Ga0070698_100592096 3300005471 Bacteria 1049
39 Ga0070699_100691980 3300005518 Bacteria 931
40 Ga0070679_100006573 3300005530 Bacteria 10831
41 Ga0070684_100213272 3300005535 Bacteria 1760
42 Ga0068853_100069869 3300005539 Bacteria 3056
43 Ga0068853_100158724 3300005539 Bacteria 2039
44 Ga0068853_100596544 3300005539 Bacteria 1049
45 Ga0068855_100006424 3300005563 Bacteria 14312
46 Ga0068855_100009610 3300005563 Bacteria 11670
47 Ga0068855_100545995 3300005563 Bacteria 1255
48 Ga0068857_100039909 3300005577 Bacteria 4160
49 Ga0068857_100237386 3300005577 Bacteria 1668
50 Ga0068856_100000682 3300005614 Bacteria 36865
51 Ga0068856_100121651 3300005614 Bacteria 2612
52 Ga0070702_100168041 3300005615 Bacteria 1424
53 Ga0068852_100263789 3300005616 Bacteria 1655
54 Ga0068852_100487936 3300005616 Bacteria 1225
55 Ga0068859_100011386 3300005617 Bacteria 8945
56 Ga0068864_100318323 3300005618 Bacteria 1461
57 Ga0068866_10253229 3300005718 Bacteria 1078
58 Ga0068861_100328742 3300005719 Unclassified 1334
59 Ga0068870_10125252 3300005840 Bacteria 1485
60 Ga0068863_100180800 3300005841 Bacteria 2024
61 Ga0068863_100518570 3300005841 Bacteria 1175
62 Ga0068858_100316179 3300005842 Unclassified 1492
63 Ga0068860_100001417 3300005843 Bacteria 25958
64 Ga0068860_100114235 3300005843 Bacteria 2582
65 Ga0068862_100138054 3300005844 Unclassified 2162
66 Ga0068862_100635519 3300005844 Bacteria 1028
67 Ga0068862_100715612 3300005844 Bacteria 971
68 Ga0070715_10099626 3300006163 Unclassified 1353
69 Ga0097621_100081065 3300006237 Bacteria 2700
70 Ga0097621_100488352 3300006237 Bacteria 1114
71 Ga0068871_100083261 3300006358 Bacteria 2653
72 Ga0075433_10065601 3300006852 Bacteria 3184
73 Ga0075433_10764069 3300006852 Unclassified 845
74 Ga0075434_100123707 3300006871 Unclassified 2603
75 Ga0068865_101009579 3300006881 Unclassified 729
76 Ga0097620_100011386 3300006931 Bacteria 8945
77 Ga0105240_10000741 3300009093 Bacteria 59621
78 Ga0105240_10015004 3300009093 Bacteria 10551
79 Ga0105240_10279157 3300009093 Bacteria 1920
80 Ga0105247_10003669 3300009101 Bacteria 9972
81 Ga0105247_10428403 3300009101 Bacteria 949
82 Ga0105243_10385573 3300009148 Bacteria 1297
83 Ga0105243_11322897 3300009148 Unclassified 738
84 Ga0105241_10000232 3300009174 Bacteria 42050
85 Ga0105241_10512690 3300009174 Bacteria 1071
86 Ga0105237_10019971 3300009545 Bacteria 6917
87 Ga0105238_10485661 3300009551 Bacteria 1235
88 Ga0105249_10020007 3300009553 Bacteria 5977
89 Ga0105249_10065299 3300009553 Bacteria 3348
90 Ga0105249_10123377 3300009553 Bacteria 2464
91 Ga0105249_11221663 3300009553 Bacteria 823
92 Ga0105239_10002966 3300010375 Bacteria 21156
93 Ga0105246_10270011 3300011119 Bacteria 1359
94 Ga0157371_10002786 3300013102 Bacteria 16402
95 Ga0157371_10038479 3300013102 Unclassified 3422
96 Ga0157370_10000989 3300013104 Bacteria 35947
97 Ga0157370_10011361 3300013104 Bacteria 9324
98 Ga0157370_10134602 3300013104 Bacteria 2304
99 Ga0157370_10178432 3300013104 Bacteria 1974
100 Ga0157370_10336821 3300013104 Bacteria 1391
101 Ga0157369_10177054 3300013105 Unclassified 2245
102 Ga0157374_10079420 3300013296 Bacteria 3109
103 Ga0157374_10578376 3300013296 Bacteria 1132
104 Ga0163162_10001381 3300013306 Bacteria 22593
105 Ga0163162_10242169 3300013306 Bacteria 1935
106 Ga0157372_10764673 3300013307 Unclassified 1123
107 Ga0157372_11645821 3300013307 Bacteria 739
108 Ga0157375_10025841 3300013308 Bacteria 5463
109 Ga0163163_10072214 3300014325 Bacteria 3440
110 Ga0157379_10287957 3300014968 Bacteria 1496
111 Ga0157379_10338274 3300014968 Bacteria 1376
112 Ga0157376_10019851 3300014969 Bacteria 5188
113 Ga0182005_1000115 3300015265 Bacteria 57790
114 Ga0163161_10049111 3300017792 Bacteria 3048
115 Ga0209436_104776 3300025208 Bacteria 3270
116 Ga0209258_100160 3300025242 Bacteria 154101
117 Ga0207425_1022637 3300025245 Bacteria 1321
118 Ga0209646_1000002 3300025246 Bacteria 1425781
119 Ga0209026_1001201 3300025250 Bacteria 11996
120 Ga0209148_1000153 3300025254 Bacteria 147028
121 Ga0209129_1034708 3300025258 Bacteria 824
122 Ga0209673_1000483 3300025273 Bacteria 66457
123 Ga0209130_1002792 3300025284 Bacteria 8180
124 Ga0209758_1004413 3300025297 Bacteria 11731
125 Ga0209758_1009863 3300025297 Bacteria 5833
126 Ga0209050_1000160 3300025298 Bacteria 157000
127 Ga0207426_1000322 3300025302 Bacteria 91914
128 Ga0207426_1001341 3300025302 Bacteria 20920
129 Ga0207426_1003689 3300025302 Bacteria 8034
130 Ga0209257_1000071 3300025304 Bacteria 335832
131 Ga0207710_10009133 3300025900 Bacteria 4173
132 Ga0207710_10221046 3300025900 Bacteria 940
133 Ga0207680_10173606 3300025903 Bacteria 1453
134 Ga0207643_10169494 3300025908 Bacteria 1317
135 Ga0207654_10000387 3300025911 Bacteria 25661
136 Ga0207654_10499980 3300025911 Bacteria 858
137 Ga0207707_10000247 3300025912 Bacteria 59237
138 Ga0207695_10146757 3300025913 Bacteria 2302
139 Ga0207695_10298022 3300025913 Bacteria 1504
140 Ga0207695_10492567 3300025913 Unclassified 1108
141 Ga0207671_10108993 3300025914 Bacteria 2105
142 Ga0207660_10001032 3300025917 Bacteria 18430
143 Ga0207649_10487991 3300025920 Unclassified 935
144 Ga0207652_10001102 3300025921 Bacteria 24374
145 Ga0207650_10563260 3300025925 Bacteria 956
146 Ga0207706_10009705 3300025933 Bacteria 8834
147 Ga0207661_10505316 3300025944 Unclassified 1105
148 Ga0207667_10009142 3300025949 Bacteria 11702
149 Ga0207667_10062499 3300025949 Bacteria 3893
150 Ga0207712_10105099 3300025961 Bacteria 2107
151 Ga0207640_10189588 3300025981 Bacteria 1549
152 Ga0207639_10015070 3300026041 Bacteria 5444
153 Ga0207639_10104654 3300026041 Bacteria 2295
154 Ga0207639_10444030 3300026041 Bacteria 1177
155 Ga0207639_10516390 3300026041 Unclassified 1093
156 Ga0207702_10000681 3300026078 Bacteria 36846
157 Ga0207702_10015867 3300026078 Bacteria 6237
158 Ga0207641_10146307 3300026088 Bacteria 2137
159 Ga0207648_10194235 3300026089 Bacteria 1799
160 Ga0207676_10072892 3300026095 Bacteria 2762
161 Ga0207674_10031888 3300026116 Bacteria 5531
162 Ga0207674_10080986 3300026116 Bacteria 3249
163 Ga0207674_10125497 3300026116 Bacteria 2533
164 Ga0207675_100154744 3300026118 Bacteria 2184
165 Ga0207683_10014974 3300026121 Bacteria 6601
166 Ga0207698_10433321 3300026142 Bacteria 1265
167 Ga0207698_10656983 3300026142 Bacteria 1039
168 Ga0268265_11041970 3300028380 Bacteria 810
169 Ga0268264_10059707 3300028381 Bacteria 3196
170 Ga0268264_11371678 3300028381 Bacteria 717
171 Ga0265337_1000308 3300028556 Bacteria 25957
172 Ga0265326_10000901 3300028558 Bacteria 10783
173 Ga0265319_1000131 3300028563 Bacteria 55815
174 Ga0265319_1000836 3300028563 Bacteria 19628
175 Ga0265334_10001305 3300028573 Bacteria 12041
176 Ga0265334_10020277 3300028573 Bacteria 2724
177 Ga0265318_10002816 3300028577 Bacteria 9087
178 Ga0265318_10038796 3300028577 Bacteria 1819
179 Ga0265323_10006997 3300028653 Bacteria 4714
180 Ga0265323_10009397 3300028653 Bacteria 3998
181 Ga0265323_10020149 3300028653 Bacteria 2571
182 Ga0265322_10003090 3300028654 Bacteria 5068
183 Ga0265322_10005589 3300028654 Bacteria 3717
184 Ga0265322_10120914 3300028654 Bacteria 746
185 Ga0265336_10000253 3300028666 Bacteria 37997
186 Ga0265338_10000618 3300028800 Bacteria 62009
187 Ga0265338_10010288 3300028800 Bacteria 11000
188 Ga0265324_10002355 3300029957 Bacteria 9754
189 Ga0265324_10005993 3300029957 Bacteria 5148
190 Ga0265324_10044386 3300029957 Bacteria 1532
191 Ga0265330_10012346 3300031235 Bacteria 3996
192 Ga0265332_10000457 3300031238 Bacteria 28508
193 Ga0265332_10172299 3300031238 Bacteria 903
194 Ga0265328_10000837 3300031239 Bacteria 14264
195 Ga0265328_10015960 3300031239 Bacteria 2932
196 Ga0265320_10000453 3300031240 Bacteria 32182
197 Ga0265320_10002020 3300031240 Bacteria 14322
198 Ga0265320_10026884 3300031240 Bacteria 3006
199 Ga0265325_10012849 3300031241 Bacteria 4777
200 Ga0265329_10002390 3300031242 Bacteria 8519
201 Ga0265329_10063007 3300031242 Bacteria 1173
202 Ga0265340_10000898 3300031247 Bacteria 16865
203 Ga0265340_10002522 3300031247 Bacteria 10398
204 Ga0265340_10006137 3300031247 Bacteria 6626
205 Ga0265339_10002163 3300031249 Bacteria 14277
206 Ga0265339_10013554 3300031249 Bacteria 4937
207 Ga0265331_10002271 3300031250 Bacteria 13131
208 Ga0265331_10049664 3300031250 Bacteria 2014
209 Ga0265327_10052707 3300031251 Bacteria 2117
210 Ga0265316_10000055 3300031344 Bacteria 122834
211 Ga0265316_10000905 3300031344 Bacteria 32395
212 Ga0265316_10003134 3300031344 Bacteria 16835
213 Ga0265316_10004265 3300031344 Bacteria 14281
214 Ga0307509_10163267 3300031507 Bacteria 2121
215 Ga0265313_10003299 3300031595 Bacteria 13215
216 Ga0316575_10001700 3300031665 Bacteria 7208
217 Ga0316575_10003567 3300031665 Bacteria 5382
218 Ga0316575_10014761 3300031665 Unclassified 2938
219 Ga0316575_10178313 3300031665 Bacteria 882
220 Ga0316579_10000943 3300031691 Bacteria 10140
221 Ga0316579_10001771 3300031691 Bacteria 7943
222 Ga0316579_10002292 3300031691 Bacteria 7220
223 Ga0316579_10009321 3300031691 Bacteria 4124
224 Ga0316579_10026550 3300031691 Unclassified 2624
225 Ga0316579_10035586 3300031691 Bacteria 2296
226 Ga0316579_10124577 3300031691 Bacteria 1239
227 Ga0316579_10174110 3300031691 Bacteria 1040
228 Ga0265314_10006535 3300031711 Bacteria 10288
229 Ga0265314_10116382 3300031711 Bacteria 1690
230 Ga0265342_10001618 3300031712 Bacteria 20784
231 Ga0265342_10011735 3300031712 Bacteria 5977
232 Ga0316576_10067359 3300031727 Bacteria 2636
233 Ga0316576_10083816 3300031727 Bacteria 2369
234 Ga0316576_10084424 3300031727 Bacteria 2360
235 Ga0316576_10091778 3300031727 Bacteria 2263
236 Ga0316576_10252627 3300031727 Bacteria 1323
237 Ga0316576_10278160 3300031727 Unclassified 1254
238 Ga0316578_10000448 3300031728 Bacteria 13673
239 Ga0316578_10013570 3300031728 Bacteria 4325
240 Ga0316578_10020923 3300031728 Bacteria 3624
241 Ga0316578_10023141 3300031728 Bacteria 3475
242 Ga0316578_10060761 3300031728 Bacteria 2225
243 Ga0316578_10132334 3300031728 Bacteria 1501
244 Ga0316578_10512290 3300031728 Unclassified 706
245 Ga0316577_10000254 3300031733 Bacteria 18853
246 Ga0316577_10000303 3300031733 Bacteria 17922
247 Ga0316577_10000701 3300031733 Bacteria 14192
248 Ga0316577_10001616 3300031733 Bacteria 10751
249 Ga0316577_10003284 3300031733 Bacteria 8152
250 Ga0316577_10003516 3300031733 Bacteria 7924
251 Ga0316577_10004020 3300031733 Bacteria 7530
252 Ga0316577_10008670 3300031733 Bacteria 5454
253 Ga0316577_10022462 3300031733 Bacteria 3503
254 Ga0316577_10036158 3300031733 Unclassified 2761
255 Ga0316577_10132365 3300031733 Bacteria 1403
256 Ga0316583_10000810 3300032133 Bacteria 9886
257 Ga0316583_10009713 3300032133 Bacteria 3467
258 Ga0316583_10049118 3300032133 Bacteria 1485
259 Ga0316585_10008989 3300032137 Bacteria 2903
260 Ga0316585_10043245 3300032137 Bacteria 1438
261 Ga0316580_10004176 3300032139 Bacteria 4167
262 Ga0316580_10147078 3300032139 Bacteria 723
263 Ga0316592_1000534 3300033524 Bacteria 5372
264 Ga0373961_0188748 3300035241 Bacteria 721
265 Ga0316574_0001960 3300035398 Bacteria 10098
266 Ga0316574_0008450 3300035398 Bacteria 5718
267 Ga0316574_0028308 3300035398 Bacteria 3379
268 Ga0316574_0057937 3300035398 Bacteria 2426
269 Ga0316574_0160286 3300035398 Bacteria 1449
270 Ga0316574_0193317 3300035398 Bacteria 1308
271 Ga0316574_0292853 3300035398 Unclassified 1036
272 Ga0316574_0384259 3300035398 Unclassified 885
273 Ga0373927_0054043 3300035695 Bacteria 2598
274 Ga0373947_0267732 3300035725 Bacteria 1134
275 Ga0373937_0051477 3300036401 Bacteria 3775
276 Ga0316582_0000037 3300036647 Bacteria 31129
277 Ga0316582_0000375 3300036647 Bacteria 16078
278 Ga0316582_0000402 3300036647 Bacteria 15778
279 Ga0316582_0002928 3300036647 Bacteria 8209
280 Ga0316582_0003841 3300036647 Bacteria 7468
281 Ga0316582_0006194 3300036647 Bacteria 6251
282 Ga0316582_0008238 3300036647 Bacteria 5590
283 Ga0316582_0008904 3300036647 Bacteria 5418
284 Ga0316582_0123998 3300036647 Unclassified 1731
285 Ga0316582_0134524 3300036647 Unclassified 1663
286 Ga0316582_0156932 3300036647 Bacteria 1540
287 Ga0316582_0161414 3300036647 Bacteria 1518
288 Ga0316582_0171953 3300036647 Bacteria 1471
289 Ga0316582_0182019 3300036647 Bacteria 1430
290 Ga0316582_0317375 3300036647 Unclassified 1071
291 Ga0316582_0378970 3300036647 Bacteria 974
292 Ga0316584_0000340 3300036712 Bacteria 23993
293 Ga0316584_0000543 3300036712 Bacteria 20235
294 Ga0316584_0002815 3300036712 Bacteria 11151
295 Ga0316584_0036987 3300036712 Bacteria 3623
296 Ga0316584_0052899 3300036712 Bacteria 3037
297 Ga0316584_0062635 3300036712 Bacteria 2785
298 Ga0316584_0079732 3300036712 Unclassified 2453
299 Ga0316581_0000092 3300037588 Bacteria 11766
300 Ga0451577_0174981 3300042876 Unclassified 1934
301 Ga0451577_0191306 3300042876 Bacteria 1846
302 Ga0451577_0404810 3300042876 Bacteria 1239
303 Ga0466969_0000745 3300044656 Bacteria 17612
304 Ga0466972_0000159 3300044658 Bacteria 54274
305 Ga0453683_0000288 3300044673 Bacteria 65205
306 Ga0453683_0002053 3300044673 Bacteria 16122
307 Ga0453683_0018325 3300044673 Bacteria 4495
308 Ga0453683_0076915 3300044673 Bacteria 2090
309 Ga0466966_0000186 3300044684 Bacteria 41305
310 Ga0453684_0000781 3300044712 Bacteria 109749
311 Ga0453684_0000930 3300044712 Bacteria 96857
312 Ga0453684_0018956 3300044712 Bacteria 10516
313 Ga0453684_0027477 3300044712 Bacteria 8162
314 Ga0453684_0081054 3300044712 Unclassified 4049
315 Ga0453684_0132991 3300044712 Unclassified 2983
316 Ga0453684_0155929 3300044712 Bacteria 2708
317 Ga0453684_0243819 3300044712 Unclassified 2067
318 Ga0453684_0244197 3300044712 Bacteria 2066
319 Ga0453684_0703323 3300044712 Unclassified 1098
320 Ga0453684_0786015 3300044712 Unclassified 1028
321 Ga0453684_0816458 3300044712 Bacteria 1005
322 Ga0453684_0883655 3300044712 Bacteria 958
323 Ga0453684_1047127 3300044712 Bacteria 865
324 Ga0453684_1290722 3300044712 Bacteria 762
325 Ga0466968_0071066 3300044735 Bacteria 1516
326 Ga0466968_0123320 3300044735 Bacteria 1174
327 Ga0466970_0000562 3300044765 Bacteria 18148
328 Ga0466970_0359592 3300044765 Unclassified 827
329 Ga0466959_0000025 3300045049 Bacteria 120128
330 Ga0451576_0000736 3300045051 Bacteria 65519
331 Ga0451576_0694191 3300045051 Bacteria 1069
332 Ga0495627_009731 3300046453 Unclassified 3525
333 Ga0495627_018599 3300046453 Bacteria 2340
334 Ga0495580_0686197 3300046472 Unclassified 671
335 Ga0495643_0015515 3300046522 Bacteria 4500
336 Ga0495587_0158276 3300046536 Bacteria 1290
337 Ga0495633_0000103 3300046558 Bacteria 114769
338 Ga0495672_0032596 3300047320 Bacteria 3239
339 Ga0496114_0223225 3300048917 Unclassified 1654
340 Ga0496121_0000011 3300048924 Bacteria 792193
341 Ga0501032_0119145 3300049569 Bacteria 1745
342 Ga0501034_0056816 3300049571 Bacteria 3936
343 Ga0501037_0143007 3300049573 Bacteria 1711
344 Ga0501038_0042113 3300049574 Bacteria 3978
345 Ga0501039_0059514 3300049575 Bacteria 2959
346 Ga0501043_0018628 3300049579 Bacteria 5448
347 Ga0501046_0005073 3300049580 Bacteria 11809
348 Ga0501047_0006477 3300049581 Bacteria 11017
349 Ga0501047_0040231 3300049581 Bacteria 4521
350 Ga0501048_0023308 3300049582 Bacteria 4526
351 Ga0501067_0006941 3300049583 Bacteria 6284
352 Ga0501067_0224833 3300049583 Unclassified 1045
353 Ga0501068_0026274 3300049584 Bacteria 3429
354 Ga0501068_0233217 3300049584 Bacteria 1171
355 Ga0501069_0128963 3300049585 Bacteria 1447
356 Ga0501070_0008015 3300049586 Bacteria 8945
357 Ga0501071_0328988 3300049587 Bacteria 1161
358 Ga0501073_0164908 3300049589 Bacteria 1534
359 Ga0501074_0016146 3300049590 Bacteria 5426
360 Ga0501074_0203086 3300049590 Bacteria 1412
361 Ga0501076_0200910 3300049592 Bacteria 1628
362 Ga0501080_0077291 3300049742 Bacteria 3095
363 Ga0501080_0106575 3300049742 Bacteria 2597
364 Ga0501081_0956146 3300049743 Bacteria 647
365 Ga0501083_0019944 3300049744 Unclassified 4666
366 Ga0501083_0039929 3300049744 Bacteria 3186
367 Ga0501241_000513 3300049758 Bacteria 8366
368 Ga0501035_0003473 3300049822 Bacteria 15083
369 Ga0501044_0111783 3300049823 Bacteria 2739
370 nmdc:mga0n895_145520_c1 3300050512 Bacteria 2399
371 nmdc:mga0n895_92803_c1 3300050512 Unclassified 3022
372 nmdc:mga0a205_509671_c1 3300050515 Bacteria 1060
373 Ga0500644_0000567 3300053088 Bacteria 14501
374 Ga0500583_0000017 3300053092 Bacteria 141647
375 Ga0500569_001611 3300053109 Bacteria 4283
376 Ga0500607_017620 3300053121 Bacteria 4072
377 Ga0500658_0002777 3300053134 Bacteria 6727
378 Ga0500559_0017951 3300053136 Bacteria 2991
379 Ga0500568_0018591 3300053139 Bacteria 3037
380 Ga0500577_0000506 3300053142 Bacteria 10029
381 Ga0500590_063169 3300053148 Bacteria 1857
382 Ga0500616_0003814 3300053153 Bacteria 11181
383 Ga0500616_0109268 3300053153 Bacteria 1338
384 Ga0500622_0001437 3300053156 Bacteria 19111
385 Ga0500634_0068778 3300053161 Bacteria 1859
386 Ga0500639_012641 3300053163 Bacteria 4433
387 Ga0501084_0016212 3300054114 Bacteria 6187
388 Ga0501084_0133026 3300054114 Bacteria 2094
389 Ga0501084_0326158 3300054114 Bacteria 1297
390 Ga0501082_0051299 3300060353 Bacteria 3556
391 Ga0501082_0064979 3300060353 Bacteria 3142
392 Ga0530510_0944284 3300061734 Unclassified 659
393 2819576521 2818991442 Bacteria 8318214
394 2819589101 2818991444 Bacteria 6968812
395 2819679931 2818991460 Bacteria 7595395
396 2821143257 2821136567 Bacteria 8080116
397 2884794486 2884791551 Bacteria 8511252
398 2904470152 2904467357 Bacteria 8057758
399 2914762052 2914759650 Bacteria 4701441
400 2929179963 2929177148 Bacteria 7883697
401 2929242144 2929239360 Bacteria 7745570
402 2929923700 2929921140 Bacteria 8649150
403 2945982384 2945977869 Bacteria 7777518
404 2946018228 2946013367 Bacteria 7766675
405 8003153727 8003151029 Bacteria 8187759
406 Ga0055535_1002349
407 SwRhRL2b_contig_2331142
408 JGI24740J21852_10009658
409 JGI24739J22299_10010942
410 JGI25154J39366_1000014
411 JGI25159J45721_1016808
412 JGI25153J46596_10012293
413 JGI25153J46596_10028917
414 rootH1_10041388
415 rootH2_10044532
416 rootH2_10063065
417 rootH2_10244250
418 rootH1_10022911
419 rootH1_10055761
420 rootH1_10086867
421 JGI25160J50197_1000469
422 JGI25160J50197_1006316
423 JGI25160J50197_1019274
424 Ga0055528_1001321
425 Ga0055530_10001156
426 Ga0055531_10000255
427 Ga0065165_1000036
428 Ga0065165_1021086
429 Ga0065704_10073064
430 Ga0070690_100201936
431 Ga0070666_10015874
432 Ga0070680_100001790
433 Ga0070682_100001196
434 Ga0068868_100210447
435 Ga0070691_10102783
436 Ga0070661_100546407
437 Ga0070669_100036318
438 Ga0070671_100083116
439 Ga0070667_100418329
440 Ga0070678_100012467
441 Ga0070662_100149881
442 Ga0070681_10003107
443 Ga0070698_100592096
444 Ga0070699_100691980
445 Ga0070679_100006573
446 Ga0070684_100213272
447 Ga0068853_100069869
448 Ga0068853_100158724
449 Ga0068853_100596544
450 Ga0068855_100006424
451 Ga0068855_100009610
452 Ga0068855_100545995
453 Ga0068857_100039909
454 Ga0068857_100237386
455 Ga0068856_100000682
456 Ga0068856_100121651
457 Ga0070702_100168041
458 Ga0068852_100263789
459 Ga0068852_100487936
460 Ga0068859_100011386
461 Ga0068864_100318323
462 Ga0068866_10253229
463 Ga0068861_100328742
464 Ga0068870_10125252
465 Ga0068863_100180800
466 Ga0068863_100518570
467 Ga0068858_100316179
468 Ga0068860_100001417
469 Ga0068860_100114235
470 Ga0068862_100138054
471 Ga0068862_100635519
472 Ga0068862_100715612
473 Ga0070715_10099626
474 Ga0097621_100081065
475 Ga0097621_100488352
476 Ga0068871_100083261
477 Ga0075433_10065601
478 Ga0075433_10764069
479 Ga0075434_100123707
480 Ga0068865_101009579
481 Ga0097620_100011386
482 Ga0105240_10000741
483 Ga0105240_10015004
484 Ga0105240_10279157
485 Ga0105247_10003669
486 Ga0105247_10428403
487 Ga0105243_10385573
488 Ga0105243_11322897
489 Ga0105241_10000232
490 Ga0105241_10512690
491 Ga0105237_10019971
492 Ga0105238_10485661
493 Ga0105249_10020007
494 Ga0105249_10065299
495 Ga0105249_10123377
496 Ga0105249_11221663
497 Ga0105239_10002966
498 Ga0105246_10270011
499 Ga0157371_10002786
500 Ga0157371_10038479
501 Ga0157370_10000989
502 Ga0157370_10011361
503 Ga0157370_10134602
504 Ga0157370_10178432
505 Ga0157370_10336821
506 Ga0157369_10177054
507 Ga0157374_10079420
508 Ga0157374_10578376
509 Ga0163162_10001381
510 Ga0163162_10242169
511 Ga0157372_10764673
512 Ga0157372_11645821
513 Ga0157375_10025841
514 Ga0163163_10072214
515 Ga0157379_10287957
516 Ga0157379_10338274
517 Ga0157376_10019851
518 Ga0182005_1000115
519 Ga0163161_10049111
520 Ga0209436_104776
521 Ga0209258_100160
522 Ga0207425_1022637
523 Ga0209646_1000002
524 Ga0209026_1001201
525 Ga0209148_1000153
526 Ga0209129_1034708
527 Ga0209673_1000483
528 Ga0209130_1002792
529 Ga0209758_1004413
530 Ga0209758_1009863
531 Ga0209050_1000160
532 Ga0207426_1000322
533 Ga0207426_1001341
534 Ga0207426_1003689
535 Ga0209257_1000071
536 Ga0207710_10009133
537 Ga0207710_10221046
538 Ga0207680_10173606
539 Ga0207643_10169494
540 Ga0207654_10000387
541 Ga0207654_10499980
542 Ga0207707_10000247
543 Ga0207695_10146757
544 Ga0207695_10298022
545 Ga0207695_10492567
546 Ga0207671_10108993
547 Ga0207660_10001032
548 Ga0207649_10487991
549 Ga0207652_10001102
550 Ga0207650_10563260
551 Ga0207706_10009705
552 Ga0207661_10505316
553 Ga0207667_10009142
554 Ga0207667_10062499
555 Ga0207712_10105099
556 Ga0207640_10189588
557 Ga0207639_10015070
558 Ga0207639_10104654
559 Ga0207639_10444030
560 Ga0207639_10516390
561 Ga0207702_10000681
562 Ga0207702_10015867
563 Ga0207641_10146307
564 Ga0207648_10194235
565 Ga0207676_10072892
566 Ga0207674_10031888
567 Ga0207674_10080986
568 Ga0207674_10125497
569 Ga0207675_100154744
570 Ga0207683_10014974
571 Ga0207698_10433321
572 Ga0207698_10656983
573 Ga0268265_11041970
574 Ga0268264_10059707
575 Ga0268264_11371678
576 Ga0265337_1000308
577 Ga0265326_10000901
578 Ga0265319_1000131
579 Ga0265319_1000836
580 Ga0265334_10001305
581 Ga0265334_10020277
582 Ga0265318_10002816
583 Ga0265318_10038796
584 Ga0265323_10006997
585 Ga0265323_10009397
586 Ga0265323_10020149
587 Ga0265322_10003090
588 Ga0265322_10005589
589 Ga0265322_10120914
590 Ga0265336_10000253
591 Ga0265338_10000618
592 Ga0265338_10010288
593 Ga0265324_10002355
594 Ga0265324_10005993
595 Ga0265324_10044386
596 Ga0265330_10012346
597 Ga0265332_10000457
598 Ga0265332_10172299
599 Ga0265328_10000837
600 Ga0265328_10015960
601 Ga0265320_10000453
602 Ga0265320_10002020
603 Ga0265320_10026884
604 Ga0265325_10012849
605 Ga0265329_10002390
606 Ga0265329_10063007
607 Ga0265340_10000898
608 Ga0265340_10002522
609 Ga0265340_10006137
610 Ga0265339_10002163
611 Ga0265339_10013554
612 Ga0265331_10002271
613 Ga0265331_10049664
614 Ga0265327_10052707
615 Ga0265316_10000055
616 Ga0265316_10000905
617 Ga0265316_10003134
618 Ga0265316_10004265
619 Ga0307509_10163267
620 Ga0265313_10003299
621 Ga0316575_10001700
622 Ga0316575_10003567
623 Ga0316575_10014761
624 Ga0316575_10178313
625 Ga0316579_10000943
626 Ga0316579_10001771
627 Ga0316579_10002292
628 Ga0316579_10009321
629 Ga0316579_10026550
630 Ga0316579_10035586
631 Ga0316579_10124577
632 Ga0316579_10174110
633 Ga0265314_10006535
634 Ga0265314_10116382
635 Ga0265342_10001618
636 Ga0265342_10011735
637 Ga0316576_10067359
638 Ga0316576_10083816
639 Ga0316576_10084424
640 Ga0316576_10091778
641 Ga0316576_10252627
642 Ga0316576_10278160
643 Ga0316578_10000448
644 Ga0316578_10013570
645 Ga0316578_10020923
646 Ga0316578_10023141
647 Ga0316578_10060761
648 Ga0316578_10132334
649 Ga0316578_10512290
650 Ga0316577_10000254
651 Ga0316577_10000303
652 Ga0316577_10000701
653 Ga0316577_10001616
654 Ga0316577_10003284
655 Ga0316577_10003516
656 Ga0316577_10004020
657 Ga0316577_10008670
658 Ga0316577_10022462
659 Ga0316577_10036158
660 Ga0316577_10132365
661 Ga0316583_10000810
662 Ga0316583_10009713
663 Ga0316583_10049118
664 Ga0316585_10008989
665 Ga0316585_10043245
666 Ga0316580_10004176
667 Ga0316580_10147078
668 Ga0316592_1000534
669 Ga0373961_0188748
670 Ga0316574_0001960
671 Ga0316574_0008450
672 Ga0316574_0028308
673 Ga0316574_0057937
674 Ga0316574_0160286
675 Ga0316574_0193317
676 Ga0316574_0292853
677 Ga0316574_0384259
678 Ga0373927_0054043
679 Ga0373947_0267732
680 Ga0373937_0051477
681 Ga0316582_0000037
682 Ga0316582_0000375
683 Ga0316582_0000402
684 Ga0316582_0002928
685 Ga0316582_0003841
686 Ga0316582_0006194
687 Ga0316582_0008238
688 Ga0316582_0008904
689 Ga0316582_0123998
690 Ga0316582_0134524
691 Ga0316582_0156932
692 Ga0316582_0161414
693 Ga0316582_0171953
694 Ga0316582_0182019
695 Ga0316582_0317375
696 Ga0316582_0378970
697 Ga0316584_0000340
698 Ga0316584_0000543
699 Ga0316584_0002815
700 Ga0316584_0036987
701 Ga0316584_0052899
702 Ga0316584_0062635
703 Ga0316584_0079732
704 Ga0316581_0000092
705 Ga0451577_0174981
706 Ga0451577_0191306
707 Ga0451577_0404810
708 Ga0466969_0000745
709 Ga0466972_0000159
710 Ga0453683_0000288
711 Ga0453683_0002053
712 Ga0453683_0018325
713 Ga0453683_0076915
714 Ga0466966_0000186
715 Ga0453684_0000781
716 Ga0453684_0000930
717 Ga0453684_0018956
718 Ga0453684_0027477
719 Ga0453684_0081054
720 Ga0453684_0132991
721 Ga0453684_0155929
722 Ga0453684_0243819
723 Ga0453684_0244197
724 Ga0453684_0703323
725 Ga0453684_0786015
726 Ga0453684_0816458
727 Ga0453684_0883655
728 Ga0453684_1047127
729 Ga0453684_1290722
730 Ga0466968_0071066
731 Ga0466968_0123320
732 Ga0466970_0000562
733 Ga0466970_0359592
734 Ga0466959_0000025
735 Ga0451576_0000736
736 Ga0451576_0694191
737 Ga0495627_009731
738 Ga0495627_018599
739 Ga0495580_0686197
740 Ga0495643_0015515
741 Ga0495587_0158276
742 Ga0495633_0000103
743 Ga0495672_0032596
744 Ga0496114_0223225
745 Ga0496121_0000011
746 Ga0501032_0119145
747 Ga0501034_0056816
748 Ga0501037_0143007
749 Ga0501038_0042113
750 Ga0501039_0059514
751 Ga0501043_0018628
752 Ga0501046_0005073
753 Ga0501047_0006477
754 Ga0501047_0040231
755 Ga0501048_0023308
756 Ga0501067_0006941
757 Ga0501067_0224833
758 Ga0501068_0026274
759 Ga0501068_0233217
760 Ga0501069_0128963
761 Ga0501070_0008015
762 Ga0501071_0328988
763 Ga0501073_0164908
764 Ga0501074_0016146
765 Ga0501074_0203086
766 Ga0501076_0200910
767 Ga0501080_0077291
768 Ga0501080_0106575
769 Ga0501081_0956146
770 Ga0501083_0019944
771 Ga0501083_0039929
772 Ga0501241_000513
773 Ga0501035_0003473
774 Ga0501044_0111783
775 nmdc:mga0n895_145520_c1
776 nmdc:mga0n895_92803_c1
777 nmdc:mga0a205_509671_c1
778 Ga0500644_0000567
779 Ga0500583_0000017
780 Ga0500569_001611
781 Ga0500607_017620
782 Ga0500658_0002777
783 Ga0500559_0017951
784 Ga0500568_0018591
785 Ga0500577_0000506
786 Ga0500590_063169
787 Ga0500616_0003814
788 Ga0500616_0109268
789 Ga0500622_0001437
790 Ga0500634_0068778
791 Ga0500639_012641
792 Ga0501084_0016212
793 Ga0501084_0133026
794 Ga0501084_0326158
795 Ga0501082_0051299
796 Ga0501082_0064979
797 Ga0530510_0944284
798 2819576521
799 2819589101
800 2819679931
801 2821143257
802 2884794486
803 2904470152
804 2914762052
805 2929179963
806 2929242144
807 2929923700
808 2945982384
809 2946018228
810 8003153727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

51

186

0.86

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

18

181

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cnh-assembly2.cif.gz_B crystal structure of predicted hydrolase of haloacid dehalogenase-like superfamily (np_295428.1) from deinococcus radiodurans at 1.66 a resolution 0.9756 6 204
3cnh-assembly2.cif.gz_B crystal structure of predicted hydrolase of haloacid dehalogenase-like superfamily (np_295428.1) from deinococcus radiodurans at 1.66 a resolution 0.9613 6 204
4f71-assembly1.cif.gz_A crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, wild-type protein, complex with magnesium and inorganic phosphate 0.8336 7 195
4f72-assembly1.cif.gz_A crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, asp12ala mutant, complex with magnesium and inorganic phosphate 0.8319 7 195
4dfd-assembly2.cif.gz_B crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, magnesium complex 0.8214 5 195
ID Description Score Start End Superfamily
3cnhA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9863 22 83 1.10.150.240
3cnhA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9127 22 83 1.10.150.240
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9047 90 186 3.40.50.1000
3cnhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9029 6 204 3.40.50.1000
3cnhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.889 6 204 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A519TE61-F1-model_v4 HAD family phosphatase 0.9974 4 168
AF-A0A419E840-F1-model_v4 HAD family phosphatase 0.996 1 207
AF-A0A1E4FR59-F1-model_v4 Hydrolase 0.9932 7 206
AF-B3DUP2-F1-model_v4 HAD superfamily hydrolase 0.9917 1 206 GO:0016787
AF-Q1Q779-F1-model_v4 Fusion protein similar to hydrolase/phosphatase (N-terminal) and ribose-5-phosphate isomerase (C-terminal) (EC 5.3.1.6) (Ribose 5-phosphate isomerase B) 0.9916 6 207 GO:0004751
GO:0005975
GO:0016787

Map