F435864

General Info

Members Datasets Scaffolds Average Seq Length
405 196 405 295

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100001433|Ga0070670_10000143319
Length 310
Sequence MEMTPLPPDARGAPLSGVPALSEVGRLISVVVKHARDAFVDERTIASEWQPLNFTAAPDLGAAIDEYERFLEILRSSGAAIHQLPRTPETTLDSVYARDASIVSPKGLILCRMGKRARQSEPHAQEQAFRAMTPPVPVAGHINAPGLLEGGDVVWLDDRTLVVGLGYRTNAEGINQLRAIVGESVDVVEVPLPHWRGESDVMHLMSLISPVDRDLAVVYSRLLPVPFRQLLLDRGYRLIDVPDEEFDSMGCNVLALSPGRCVMVAGNPKTRAALEQTGVDVTEYVGHEISAKGAGGPTCLTRPIARAALE

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
138 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
139 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
148 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.73
Rhizosphere 98.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_6635214 2162886011 Bacteria 1262
2 JGI25406J46586_10000701 3300003203 Bacteria 15649
3 JGI25406J46586_10004848 3300003203 Bacteria 6254
4 JGI25406J46586_10027343 3300003203 Bacteria 2189
5 Ga0065714_10078145 3300005288 Unclassified 2625
6 Ga0065704_10084663 3300005289 Bacteria 3310
7 Ga0065712_10000375 3300005290 Bacteria 12196
8 Ga0065712_10006902 3300005290 Unclassified 3672
9 Ga0065715_10000319 3300005293 Bacteria 16378
10 Ga0065715_10001450 3300005293 Bacteria 9174
11 Ga0065715_10171088 3300005293 Unclassified 1546
12 Ga0065707_10009483 3300005295 Unclassified 2456
13 Ga0065707_10114792 3300005295 Unclassified 2287
14 Ga0065707_10117658 3300005295 Bacteria 2206
15 Ga0070676_10011129 3300005328 Bacteria 4888
16 Ga0070676_10108258 3300005328 Bacteria 1727
17 Ga0070683_100063512 3300005329 Bacteria 3435
18 Ga0070670_100001433 3300005331 Bacteria 19191
19 Ga0070670_100060217 3300005331 Unclassified 3259
20 Ga0070670_100391328 3300005331 Bacteria 1226
21 Ga0070670_100554806 3300005331 Bacteria 1025
22 Ga0070677_10000843 3300005333 Bacteria 10069
23 Ga0070677_10051186 3300005333 Bacteria 1671
24 Ga0068869_100026379 3300005334 Bacteria 4045
25 Ga0068869_100099569 3300005334 Unclassified 2197
26 Ga0070666_10002720 3300005335 Bacteria 10680
27 Ga0068868_100477513 3300005338 Bacteria 1088
28 Ga0070689_100035095 3300005340 Bacteria 3830
29 Ga0070689_100058506 3300005340 Bacteria 2993
30 Ga0070661_100013533 3300005344 Bacteria 5729
31 Ga0070692_10000087 3300005345 Bacteria 19775
32 Ga0070668_100304805 3300005347 Bacteria 1337
33 Ga0070669_100289601 3300005353 Bacteria 1314
34 Ga0070675_100039970 3300005354 Unclassified 3828
35 Ga0070675_100079977 3300005354 Bacteria 2724
36 Ga0070675_100227246 3300005354 Bacteria 1627
37 Ga0070671_100008027 3300005355 Bacteria 8448
38 Ga0070674_100000192 3300005356 Bacteria 29259
39 Ga0070674_100104130 3300005356 Bacteria 2073
40 Ga0070674_100310588 3300005356 Bacteria 1260
41 Ga0070674_100369816 3300005356 Bacteria 1163
42 Ga0070673_100006411 3300005364 Bacteria 7650
43 Ga0070673_100027254 3300005364 Bacteria 4234
44 Ga0070673_100034412 3300005364 Bacteria 3834
45 Ga0070673_100194493 3300005364 Bacteria 1744
46 Ga0070688_100013169 3300005365 Bacteria 4656
47 Ga0070667_100013748 3300005367 Bacteria 6692
48 Ga0070667_100099993 3300005367 Unclassified 2504
49 Ga0070705_100004014 3300005440 Bacteria 7187
50 Ga0070705_100020385 3300005440 Bacteria 3508
51 Ga0070700_100043878 3300005441 Bacteria 2752
52 Ga0070700_100167787 3300005441 Bacteria 1518
53 Ga0070694_100001263 3300005444 Bacteria 14687
54 Ga0070694_100001421 3300005444 Bacteria 14035
55 Ga0070694_100002505 3300005444 Bacteria 10845
56 Ga0070708_100235796 3300005445 Bacteria 1717
57 Ga0070663_100423316 3300005455 Bacteria 1093
58 Ga0070678_100127992 3300005456 Bacteria 2013
59 Ga0070678_100246460 3300005456 Bacteria 1496
60 Ga0070662_100025846 3300005457 Bacteria 4059
61 Ga0070681_10078581 3300005458 Bacteria 3256
62 Ga0068867_100072093 3300005459 Unclassified 2585
63 Ga0070685_10001382 3300005466 Bacteria 12755
64 Ga0070685_10041081 3300005466 Unclassified 2634
65 Ga0070706_100078007 3300005467 Bacteria 3067
66 Ga0070706_100130016 3300005467 Unclassified 2350
67 Ga0070707_100060306 3300005468 Bacteria 3639
68 Ga0070707_100228695 3300005468 Bacteria 1811
69 Ga0070707_100259620 3300005468 Bacteria 1690
70 Ga0070698_100006494 3300005471 Bacteria 12684
71 Ga0070698_100024963 3300005471 Bacteria 6230
72 Ga0070699_100005528 3300005518 Bacteria 11075
73 Ga0070699_100011804 3300005518 Bacteria 7538
74 Ga0070684_100061250 3300005535 Bacteria 3293
75 Ga0070697_100210635 3300005536 Bacteria 1655
76 Ga0070672_100019473 3300005543 Bacteria 4926
77 Ga0070672_100039953 3300005543 Bacteria 3597
78 Ga0070672_100062025 3300005543 Bacteria 2949
79 Ga0070672_100149792 3300005543 Bacteria 1929
80 Ga0070686_100013152 3300005544 Unclassified 4728
81 Ga0070686_100017209 3300005544 Bacteria 4220
82 Ga0070686_100085887 3300005544 Unclassified 2094
83 Ga0070686_100328961 3300005544 Unclassified 1142
84 Ga0070686_100338579 3300005544 Bacteria 1127
85 Ga0070695_100000155 3300005545 Bacteria 32258
86 Ga0070695_100012116 3300005545 Bacteria 5168
87 Ga0070695_100139586 3300005545 Unclassified 1679
88 Ga0070696_100000499 3300005546 Bacteria 24777
89 Ga0070696_100018420 3300005546 Bacteria 4719
90 Ga0070696_100020527 3300005546 Bacteria 4476
91 Ga0070665_100127266 3300005548 Unclassified 2550
92 Ga0070665_100542356 3300005548 Bacteria 1175
93 Ga0070704_100001916 3300005549 Bacteria 11493
94 Ga0070704_100021875 3300005549 Bacteria 4154
95 Ga0070704_100022977 3300005549 Bacteria 4065
96 Ga0070704_100062787 3300005549 Bacteria 2664
97 Ga0070704_100122239 3300005549 Bacteria 2002
98 Ga0070664_100010026 3300005564 Bacteria 7678
99 Ga0070664_100033709 3300005564 Bacteria 4292
100 Ga0068857_100034333 3300005577 Bacteria 4486
101 Ga0068857_100161724 3300005577 Unclassified 2032
102 Ga0070702_100121131 3300005615 Bacteria 1638
103 Ga0070702_100133334 3300005615 Bacteria 1572
104 Ga0068852_100354186 3300005616 Bacteria 1434
105 Ga0068859_100013649 3300005617 Bacteria 8143
106 Ga0068859_100021732 3300005617 Bacteria 6437
107 Ga0068859_100137800 3300005617 Unclassified 2514
108 Ga0068864_100006351 3300005618 Bacteria 9693
109 Ga0068864_100018848 3300005618 Bacteria 5770
110 Ga0068864_100022739 3300005618 Bacteria 5257
111 Ga0068864_100031978 3300005618 Bacteria 4468
112 Ga0068861_100016529 3300005719 Bacteria 5222
113 Ga0068870_10014057 3300005840 Unclassified 3774
114 Ga0068870_10029164 3300005840 Unclassified 2777
115 Ga0068870_10154392 3300005840 Bacteria 1355
116 Ga0068870_10201163 3300005840 Unclassified 1208
117 Ga0068863_100012665 3300005841 Bacteria 8133
118 Ga0068863_100060573 3300005841 Bacteria 3579
119 Ga0068858_100048179 3300005842 Bacteria 3949
120 Ga0068860_100010476 3300005843 Bacteria 9164
121 Ga0068862_100007446 3300005844 Bacteria 9076
122 Ga0068862_100053872 3300005844 Unclassified 3444
123 Ga0068862_100067718 3300005844 Bacteria 3079
124 Ga0081539_10000093 3300005985 Bacteria 207314
125 Ga0081539_10001136 3300005985 Bacteria 48290
126 Ga0081539_10009894 3300005985 Bacteria 7865
127 Ga0070717_10610844 3300006028 Unclassified 989
128 Ga0097621_100054679 3300006237 Unclassified 3257
129 Ga0097621_100432357 3300006237 Bacteria 1183
130 Ga0068871_100025290 3300006358 Bacteria 4617
131 Ga0068871_100237891 3300006358 Bacteria 1582
132 Ga0068871_100247724 3300006358 Bacteria 1551
133 Ga0075428_100000607 3300006844 Bacteria 36552
134 Ga0075428_100001280 3300006844 Bacteria 26808
135 Ga0075428_100011749 3300006844 Bacteria 9748
136 Ga0075428_100108950 3300006844 Bacteria 3019
137 Ga0075428_100575325 3300006844 Bacteria 1204
138 Ga0075430_100001572 3300006846 Bacteria 18678
139 Ga0075430_100004185 3300006846 Bacteria 12176
140 Ga0075430_100068393 3300006846 Bacteria 2980
141 Ga0075430_100073792 3300006846 Unclassified 2860
142 Ga0075431_100002665 3300006847 Bacteria 17289
143 Ga0075431_100011953 3300006847 Bacteria 8758
144 Ga0075431_100123227 3300006847 Bacteria 2674
145 Ga0075433_10020715 3300006852 Bacteria 5503
146 Ga0075433_10022945 3300006852 Bacteria 5245
147 Ga0075433_10031706 3300006852 Bacteria 4520
148 Ga0075433_10069749 3300006852 Bacteria 3088
149 Ga0075434_100000553 3300006871 Bacteria 28642
150 Ga0075434_100002820 3300006871 Bacteria 15389
151 Ga0075434_100007812 3300006871 Bacteria 9910
152 Ga0075434_100195249 3300006871 Bacteria 2044
153 Ga0075434_100345764 3300006871 Bacteria 1508
154 Ga0075429_100000181 3300006880 Bacteria 41066
155 Ga0075429_100067113 3300006880 Bacteria 3122
156 Ga0075429_100351808 3300006880 Bacteria 1290
157 Ga0097620_100013648 3300006931 Bacteria 8143
158 Ga0097620_100021731 3300006931 Bacteria 6437
159 Ga0097620_100137803 3300006931 Unclassified 2514
160 Ga0075435_100229558 3300007076 Bacteria 1577
161 Ga0111539_10000324 3300009094 Bacteria 58406
162 Ga0111539_10001197 3300009094 Bacteria 34523
163 Ga0111539_10003864 3300009094 Bacteria 19722
164 Ga0111539_10049988 3300009094 Bacteria 4982
165 Ga0111539_10063595 3300009094 Unclassified 4366
166 Ga0111539_10080919 3300009094 Bacteria 3821
167 Ga0111539_10122736 3300009094 Bacteria 3045
168 Ga0105245_10236264 3300009098 Bacteria 1770
169 Ga0114129_10002976 3300009147 Bacteria 23733
170 Ga0114129_10016230 3300009147 Bacteria 10597
171 Ga0114129_10027426 3300009147 Bacteria 8062
172 Ga0114129_10057341 3300009147 Bacteria 5451
173 Ga0114129_10252072 3300009147 Bacteria 2369
174 Ga0105243_10038268 3300009148 Bacteria 3735
175 Ga0105242_10150347 3300009176 Bacteria 2030
176 Ga0105248_10101435 3300009177 Bacteria 3244
177 Ga0105248_10263823 3300009177 Unclassified 1939
178 Ga0105249_10000918 3300009553 Bacteria 26060
179 Ga0105249_10197116 3300009553 Bacteria 1969
180 Ga0105249_10419299 3300009553 Bacteria 1372
181 Ga0105246_10009021 3300011119 Bacteria 6141
182 Ga0157378_10032310 3300013297 Bacteria 4625
183 Ga0157378_10046818 3300013297 Bacteria 3843
184 Ga0157375_10255871 3300013308 Unclassified 1912
185 Ga0157375_10317935 3300013308 Bacteria 1721
186 Ga0163163_10011235 3300014325 Bacteria 8114
187 Ga0163163_10036276 3300014325 Bacteria 4789
188 Ga0157380_10008748 3300014326 Bacteria 7233
189 Ga0157380_10009758 3300014326 Bacteria 6889
190 Ga0157377_10003692 3300014745 Bacteria 6944
191 Ga0157377_10020487 3300014745 Bacteria 3466
192 Ga0163161_10021667 3300017792 Bacteria 4516
193 Ga0163161_10057022 3300017792 Unclassified 2838
194 Ga0207697_10001216 3300025315 Bacteria 14092
195 Ga0207697_10016986 3300025315 Unclassified 2993
196 Ga0207682_10000256 3300025893 Bacteria 23951
197 Ga0207688_10007265 3300025901 Bacteria 6029
198 Ga0207688_10020554 3300025901 Bacteria 3605
199 Ga0207680_10116832 3300025903 Bacteria 1739
200 Ga0207645_10001189 3300025907 Bacteria 21501
201 Ga0207643_10009439 3300025908 Bacteria 5243
202 Ga0207643_10015276 3300025908 Bacteria 4178
203 Ga0207643_10058397 3300025908 Unclassified 2199
204 Ga0207662_10032685 3300025918 Bacteria 3030
205 Ga0207662_10087136 3300025918 Bacteria 1915
206 Ga0207657_10464841 3300025919 Bacteria 992
207 Ga0207649_10018941 3300025920 Bacteria 3927
208 Ga0207646_10082472 3300025922 Bacteria 2875
209 Ga0207646_10182646 3300025922 Unclassified 1895
210 Ga0207646_10204946 3300025922 Bacteria 1782
211 Ga0207681_10171679 3300025923 Bacteria 1644
212 Ga0207681_10193131 3300025923 Bacteria 1559
213 Ga0207650_10285500 3300025925 Bacteria 1345
214 Ga0207659_10011871 3300025926 Bacteria 5519
215 Ga0207659_10048884 3300025926 Bacteria 2998
216 Ga0207659_10080868 3300025926 Unclassified 2401
217 Ga0207659_10267060 3300025926 Bacteria 1394
218 Ga0207659_10428355 3300025926 Bacteria 1111
219 Ga0207687_10377230 3300025927 Bacteria 1161
220 Ga0207644_10004067 3300025931 Bacteria 9485
221 Ga0207706_10000390 3300025933 Bacteria 47471
222 Ga0207706_10129896 3300025933 Unclassified 2216
223 Ga0207706_10535756 3300025933 Bacteria 1009
224 Ga0207686_10138500 3300025934 Bacteria 1679
225 Ga0207670_10098065 3300025936 Bacteria 2088
226 Ga0207669_10001315 3300025937 Bacteria 10568
227 Ga0207669_10288328 3300025937 Bacteria 1242
228 Ga0207704_10403785 3300025938 Bacteria 1079
229 Ga0207691_10003570 3300025940 Bacteria 15135
230 Ga0207691_10008721 3300025940 Bacteria 9726
231 Ga0207691_10011389 3300025940 Bacteria 8536
232 Ga0207691_10056446 3300025940 Unclassified 3577
233 Ga0207691_10135641 3300025940 Bacteria 2170
234 Ga0207711_10033184 3300025941 Unclassified 4366
235 Ga0207689_10015707 3300025942 Bacteria 6410
236 Ga0207689_10043869 3300025942 Bacteria 3697
237 Ga0207689_10456035 3300025942 Unclassified 1069
238 Ga0207661_10206666 3300025944 Bacteria 1729
239 Ga0207679_10006630 3300025945 Bacteria 7325
240 Ga0207679_10050412 3300025945 Bacteria 3042
241 Ga0207651_10013572 3300025960 Bacteria 4668
242 Ga0207651_10018299 3300025960 Bacteria 4164
243 Ga0207651_10034020 3300025960 Bacteria 3295
244 Ga0207712_10005085 3300025961 Bacteria 8316
245 Ga0207668_10339083 3300025972 Unclassified 1253
246 Ga0207640_10114782 3300025981 Bacteria 1917
247 Ga0207658_10076056 3300025986 Bacteria 2557
248 Ga0207678_10200737 3300026067 Bacteria 1705
249 Ga0207708_10009222 3300026075 Bacteria 7304
250 Ga0207708_10075136 3300026075 Bacteria 2591
251 Ga0207708_10075600 3300026075 Bacteria 2583
252 Ga0207708_10123178 3300026075 Bacteria 2021
253 Ga0207648_10027493 3300026089 Bacteria 5049
254 Ga0207648_10049813 3300026089 Bacteria 3664
255 Ga0207648_10197153 3300026089 Bacteria 1785
256 Ga0207648_10541489 3300026089 Archaea 1068
257 Ga0207676_10035206 3300026095 Bacteria 3798
258 Ga0207674_10074662 3300026116 Unclassified 3402
259 Ga0207674_10256419 3300026116 Unclassified 1696
260 Ga0207674_10531290 3300026116 Bacteria 1136
261 Ga0207675_100011352 3300026118 Bacteria 8337
262 Ga0207675_100119205 3300026118 Unclassified 2496
263 Ga0207683_10001056 3300026121 Bacteria 25103
264 Ga0207683_10066263 3300026121 Unclassified 3184
265 Ga0207683_10076646 3300026121 Bacteria 2960
266 Ga0207683_10088414 3300026121 Unclassified 2756
267 Ga0268265_10008166 3300028380 Bacteria 7071
268 Ga0268265_10031877 3300028380 Unclassified 3811
269 Ga0268265_10046541 3300028380 Unclassified 3244
270 Ga0268265_10599069 3300028380 Bacteria 1053
271 Ga0307405_10061946 3300031731 Bacteria 2367
272 Ga0307411_10021505 3300032005 Bacteria 3777
273 Ga0373958_0022369 3300034819 Unclassified 1181
274 Ga0373932_0035712 3300035112 Bacteria 1407
275 Ga0373955_0133176 3300035172 Bacteria 1452
276 Ga0373935_0236068 3300035692 Bacteria 1275
277 Ga0450908_009879 3300042184 Bacteria 1766
278 Ga0439435_0015511 3300042436 Bacteria 1898
279 Ga0453683_0026774 3300044673 Bacteria 3661
280 Ga0451576_0006590 3300045051 Bacteria 14199
281 Ga0451576_0044131 3300045051 Bacteria 4701
282 Ga0495603_0088390 3300046455 Bacteria 1813
283 Ga0495629_0057321 3300046459 Bacteria 2724
284 Ga0495582_0156836 3300046473 Bacteria 1294
285 Ga0495584_0057969 3300046491 Bacteria 1948
286 Ga0495663_0028317 3300046525 Bacteria 1648
287 Ga0495598_0015356 3300046537 Bacteria 1932
288 Ga0495621_0004158 3300046539 Bacteria 4039
289 Ga0495621_0035034 3300046539 Bacteria 1736
290 Ga0495635_0027213 3300046663 Bacteria 3978
291 Ga0495659_0040166 3300046664 Bacteria 1666
292 Ga0495659_0117272 3300046664 Unclassified 1045
293 Ga0495658_0353367 3300046683 Unclassified 934
294 Ga0495669_0021187 3300046684 Bacteria 2819
295 Ga0495636_0065495 3300047318 Unclassified 1543
296 Ga0495676_0020998 3300047321 Bacteria 5715
297 Ga0495677_0056415 3300047445 Bacteria 1451
298 Ga0495685_020804 3300047447 Bacteria 2256
299 Ga0496100_0358304 3300048903 Bacteria 1103
300 Ga0496101_0531037 3300048904 Unclassified 930
301 Ga0496104_0044216 3300048907 Unclassified 4185
302 Ga0496108_0233833 3300048911 Bacteria 1598
303 Ga0496108_0519132 3300048911 Bacteria 1040
304 Ga0496109_0004075 3300048912 Bacteria 12214
305 Ga0496110_0072018 3300048913 Bacteria 3066
306 Ga0501031_0005681 3300049568 Bacteria 8127
307 Ga0501031_0041982 3300049568 Bacteria 2986
308 Ga0501032_0009519 3300049569 Bacteria 7040
309 Ga0501032_0025499 3300049569 Bacteria 4075
310 Ga0501033_0000468 3300049570 Bacteria 38258
311 Ga0501033_0012216 3300049570 Bacteria 6555
312 Ga0501033_0019271 3300049570 Bacteria 5156
313 Ga0501034_0007511 3300049571 Bacteria 11596
314 Ga0501034_0054494 3300049571 Bacteria 4025
315 Ga0501036_0003443 3300049572 Bacteria 12639
316 Ga0501036_0008878 3300049572 Bacteria 8254
317 Ga0501036_0032613 3300049572 Bacteria 4402
318 Ga0501037_0002140 3300049573 Bacteria 14294
319 Ga0501038_0005382 3300049574 Bacteria 11892
320 Ga0501038_0006096 3300049574 Bacteria 11156
321 Ga0501038_0034586 3300049574 Bacteria 4442
322 Ga0501039_0003770 3300049575 Bacteria 11396
323 Ga0501041_0043831 3300049577 Unclassified 2720
324 Ga0501042_0008787 3300049578 Bacteria 6697
325 Ga0501043_0010864 3300049579 Bacteria 7129
326 Ga0501043_0037405 3300049579 Bacteria 3817
327 Ga0501043_0048854 3300049579 Bacteria 3325
328 Ga0501046_0004454 3300049580 Bacteria 12707
329 Ga0501046_0019269 3300049580 Bacteria 5659
330 Ga0501046_0177555 3300049580 Bacteria 1594
331 Ga0501047_0009075 3300049581 Bacteria 9391
332 Ga0501047_0070390 3300049581 Bacteria 3368
333 Ga0501048_0002710 3300049582 Bacteria 13512
334 Ga0501048_0014280 3300049582 Bacteria 5882
335 Ga0501048_0018089 3300049582 Bacteria 5185
336 Ga0501067_0000350 3300049583 Bacteria 25133
337 Ga0501068_0001746 3300049584 Bacteria 11555
338 Ga0501068_0040053 3300049584 Bacteria 2811
339 Ga0501069_0001158 3300049585 Bacteria 12763
340 Ga0501069_0011560 3300049585 Bacteria 4678
341 Ga0501069_0020568 3300049585 Bacteria 3576
342 Ga0501070_0007306 3300049586 Bacteria 9382
343 Ga0501070_0024467 3300049586 Bacteria 5064
344 Ga0501071_0036522 3300049587 Unclassified 3505
345 Ga0501071_0077537 3300049587 Bacteria 2427
346 Ga0501072_0031998 3300049588 Bacteria 4118
347 Ga0501073_0004471 3300049589 Bacteria 10499
348 Ga0501073_0014209 3300049589 Bacteria 5782
349 Ga0501073_0064652 3300049589 Bacteria 2551
350 Ga0501074_0002277 3300049590 Bacteria 13353
351 Ga0501074_0008235 3300049590 Bacteria 7559
352 Ga0501074_0063127 3300049590 Bacteria 2668
353 Ga0501075_0115244 3300049591 Unclassified 2043
354 Ga0501076_0087340 3300049592 Bacteria 2507
355 Ga0501079_0007827 3300049741 Bacteria 8090
356 Ga0501079_0008910 3300049741 Bacteria 7597
357 Ga0501079_0013088 3300049741 Bacteria 6327
358 Ga0501080_0005023 3300049742 Bacteria 11784
359 Ga0501080_0019306 3300049742 Bacteria 6314
360 Ga0501080_0050189 3300049742 Bacteria 3884
361 Ga0501083_0013506 3300049744 Bacteria 5708
362 Ga0501083_0017269 3300049744 Bacteria 5031
363 Ga0501035_0010139 3300049822 Bacteria 8744
364 Ga0501035_0016240 3300049822 Bacteria 6870
365 Ga0501035_0038683 3300049822 Bacteria 4318
366 Ga0501044_0012129 3300049823 Bacteria 9332
367 Ga0501044_0165657 3300049823 Bacteria 2184
368 Ga0501045_0048871 3300049824 Bacteria 3083
369 Ga0501045_0052800 3300049824 Bacteria 2969
370 nmdc:mga05p37_61461_c1 3300050507 Bacteria 4624
371 nmdc:mga05p37_7663_c1 3300050507 Bacteria 12739
372 nmdc:mga09592_17655_c1 3300050508 Bacteria 5848
373 nmdc:mga09592_392447_c1 3300050508 Bacteria 1200
374 nmdc:mga09592_9218_c1 3300050508 Bacteria 8026
375 nmdc:mga0qj67_169030_c1 3300050509 Unclassified 1775
376 nmdc:mga0qj67_402_c1 3300050509 Bacteria 29827
377 nmdc:mga0qj67_66376_c1 3300050509 Bacteria 2874
378 nmdc:mga0qj67_937_c1 3300050509 Bacteria 20089
379 nmdc:mga06r32_21926_c1 3300050510 Bacteria 5898
380 nmdc:mga06r32_27812_c1 3300050510 Bacteria 5286
381 nmdc:mga06r32_3800_c1 3300050510 Unclassified 4217
382 nmdc:mga06r32_55180_c1 3300050510 Bacteria 3811
383 nmdc:mga06r32_90819_c1 3300050510 Bacteria 2984
384 nmdc:mga08y16_46813_c1 3300050511 Bacteria 4528
385 nmdc:mga08y16_610436_c1 3300050511 Bacteria 1099
386 nmdc:mga0n895_123465_c1 3300050512 Bacteria 2612
387 nmdc:mga0n895_14275_c1 3300050512 Bacteria 7207
388 nmdc:mga0n895_368946_c1 3300050512 Bacteria 1453
389 nmdc:mga0n895_3887_c1 3300050512 Bacteria 12137
390 nmdc:mga0n895_4653_c1 3300050512 Bacteria 11318
391 nmdc:mga0n895_522408_c1 3300050512 Bacteria 1195
392 nmdc:mga0rr50_114490_c1 3300050513 Bacteria 2139
393 nmdc:mga0rr50_203944_c1 3300050513 Bacteria 1626
394 nmdc:mga0rr50_24440_c1 3300050513 Bacteria 4184
395 nmdc:mga0rr50_310125_c1 3300050513 Unclassified 1321
396 nmdc:mga0a205_21905_c1 3300050515 Bacteria 6044
397 nmdc:mga0a205_39916_c1 3300050515 Bacteria 1601
398 nmdc:mga0a205_52311_c1 3300050515 Bacteria 3942
399 Ga0495601_0021083 3300053077 Unclassified 3987
400 Ga0495595_0029562 3300053084 Unclassified 2453
401 Ga0501084_0003177 3300054114 Bacteria 13288
402 Ga0501084_0064879 3300054114 Bacteria 3055
403 Ga0501084_0101786 3300054114 Bacteria 2412
404 Ga0501082_0006845 3300060353 Bacteria 9856
405 Ga0501082_0010821 3300060353 Bacteria 7855

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025919 Ga0207657_10464841 Ga0207657_104648411 222
2 3300046683 Ga0495658_0353367 Ga0495658_0353367_17_814 262
3 3300006358 Ga0068871_100237891 Ga0068871_1002378912 268
4 3300025933 Ga0207706_10535756 Ga0207706_105357561 269
5 3300006847 Ga0075431_100123227 Ga0075431_1001232272 273
6 3300009147 Ga0114129_10057341 Ga0114129_100573412 273
7 3300050507 nmdc:mga05p37_61461_c1 nmdc:mga05p37_61461_c1_732_1619 273
8 3300050510 nmdc:mga06r32_55180_c1 nmdc:mga06r32_55180_c1_2032_2919 273
9 3300005345 Ga0070692_10000087 Ga0070692_1000008712 276
10 3300005444 Ga0070694_100002505 Ga0070694_1000025059 276
11 3300005549 Ga0070704_100122239 Ga0070704_1001222392 276
12 3300032005 Ga0307411_10021505 Ga0307411_100215053 277
13 3300003203 JGI25406J46586_10000701 JGI25406J46586_100007012 285
14 3300005985 Ga0081539_10000093 Ga0081539_10000093158 285
15 3300044673 Ga0453683_0026774 Ga0453683_0026774_1454_2320 285
16 3300003203 JGI25406J46586_10004848 JGI25406J46586_100048482 286
17 3300003203 JGI25406J46586_10027343 JGI25406J46586_100273432 286
18 3300005295 Ga0065707_10117658 Ga0065707_101176582 286
19 3300005518 Ga0070699_100005528 Ga0070699_10000552811 286
20 3300005985 Ga0081539_10001136 Ga0081539_1000113616 286
21 3300005985 Ga0081539_10009894 Ga0081539_100098943 286
22 3300025933 Ga0207706_10129896 Ga0207706_101298962 286
23 3300025942 Ga0207689_10456035 Ga0207689_104560352 286
24 3300005354 Ga0070675_100039970 Ga0070675_1000399703 287
25 3300005356 Ga0070674_100310588 Ga0070674_1003105882 287
26 3300005364 Ga0070673_100034412 Ga0070673_1000344122 287
27 3300005543 Ga0070672_100149792 Ga0070672_1001497922 287
28 3300005544 Ga0070686_100328961 Ga0070686_1003289611 287
29 3300006844 Ga0075428_100000607 Ga0075428_10000060726 287
30 3300006846 Ga0075430_100068393 Ga0075430_1000683933 287
31 3300006847 Ga0075431_100011953 Ga0075431_1000119537 287
32 3300009094 Ga0111539_10001197 Ga0111539_1000119729 287
33 3300009094 Ga0111539_10003864 Ga0111539_1000386415 287
34 3300009094 Ga0111539_10049988 Ga0111539_100499885 287
35 3300009094 Ga0111539_10063595 Ga0111539_100635952 287
36 3300009147 Ga0114129_10002976 Ga0114129_1000297621 287
37 3300009553 Ga0105249_10197116 Ga0105249_101971162 287
38 3300013308 Ga0157375_10255871 Ga0157375_102558712 287
39 3300014326 Ga0157380_10009758 Ga0157380_100097587 287
40 3300025918 Ga0207662_10087136 Ga0207662_100871362 287
41 3300025923 Ga0207681_10193131 Ga0207681_101931312 287
42 3300025926 Ga0207659_10011871 Ga0207659_100118714 287
43 3300025937 Ga0207669_10288328 Ga0207669_102883282 287
44 3300025940 Ga0207691_10135641 Ga0207691_101356412 287
45 3300025960 Ga0207651_10013572 Ga0207651_100135725 287
46 3300028380 Ga0268265_10599069 Ga0268265_105990692 287
47 3300045051 Ga0451576_0006590 Ga0451576_0006590_143_1039 287
48 3300050507 nmdc:mga05p37_7663_c1 nmdc:mga05p37_7663_c1_236_1111 287
49 3300005290 Ga0065712_10006902 Ga0065712_100069023 288
50 3300005293 Ga0065715_10001450 Ga0065715_100014503 288
51 3300005295 Ga0065707_10009483 Ga0065707_100094832 288
52 3300005295 Ga0065707_10114792 Ga0065707_101147921 288
53 3300005328 Ga0070676_10011129 Ga0070676_100111294 288
54 3300005331 Ga0070670_100001433 Ga0070670_10000143319 288
55 3300005333 Ga0070677_10000843 Ga0070677_100008438 288
56 3300005333 Ga0070677_10051186 Ga0070677_100511862 288
57 3300005334 Ga0068869_100026379 Ga0068869_1000263795 288
58 3300005334 Ga0068869_100099569 Ga0068869_1000995692 288
59 3300005335 Ga0070666_10002720 Ga0070666_100027208 288
60 3300005338 Ga0068868_100477513 Ga0068868_1004775131 288
61 3300005340 Ga0070689_100035095 Ga0070689_1000350952 288
62 3300005340 Ga0070689_100058506 Ga0070689_1000585062 288
63 3300005344 Ga0070661_100013533 Ga0070661_1000135334 288
64 3300005347 Ga0070668_100304805 Ga0070668_1003048052 288
65 3300005353 Ga0070669_100289601 Ga0070669_1002896011 288
66 3300005354 Ga0070675_100079977 Ga0070675_1000799772 288
67 3300005356 Ga0070674_100000192 Ga0070674_10000019226 288
68 3300005356 Ga0070674_100104130 Ga0070674_1001041302 288
69 3300005364 Ga0070673_100006411 Ga0070673_1000064112 288
70 3300005364 Ga0070673_100027254 Ga0070673_1000272543 288
71 3300005364 Ga0070673_100194493 Ga0070673_1001944932 288
72 3300005365 Ga0070688_100013169 Ga0070688_1000131693 288
73 3300005367 Ga0070667_100013748 Ga0070667_1000137485 288
74 3300005441 Ga0070700_100043878 Ga0070700_1000438783 288
75 3300005441 Ga0070700_100167787 Ga0070700_1001677872 288
76 3300005455 Ga0070663_100423316 Ga0070663_1004233161 288
77 3300005456 Ga0070678_100127992 Ga0070678_1001279922 288
78 3300005457 Ga0070662_100025846 Ga0070662_1000258463 288
79 3300005466 Ga0070685_10001382 Ga0070685_100013823 288
80 3300005468 Ga0070707_100259620 Ga0070707_1002596201 288
81 3300005543 Ga0070672_100019473 Ga0070672_1000194733 288
82 3300005543 Ga0070672_100039953 Ga0070672_1000399532 288
83 3300005543 Ga0070672_100062025 Ga0070672_1000620253 288
84 3300005544 Ga0070686_100017209 Ga0070686_1000172092 288
85 3300005544 Ga0070686_100085887 Ga0070686_1000858871 288
86 3300005544 Ga0070686_100338579 Ga0070686_1003385791 288
87 3300005564 Ga0070664_100010026 Ga0070664_1000100266 288
88 3300005564 Ga0070664_100033709 Ga0070664_1000337094 288
89 3300005577 Ga0068857_100161724 Ga0068857_1001617242 288
90 3300005617 Ga0068859_100013649 Ga0068859_1000136497 288
91 3300005617 Ga0068859_100021732 Ga0068859_1000217324 288
92 3300005617 Ga0068859_100137800 Ga0068859_1001378003 288
93 3300005618 Ga0068864_100018848 Ga0068864_1000188483 288
94 3300005618 Ga0068864_100022739 Ga0068864_1000227394 288
95 3300005719 Ga0068861_100016529 Ga0068861_1000165293 288
96 3300005840 Ga0068870_10014057 Ga0068870_100140572 288
97 3300005840 Ga0068870_10029164 Ga0068870_100291643 288
98 3300005840 Ga0068870_10154392 Ga0068870_101543922 288
99 3300005840 Ga0068870_10201163 Ga0068870_102011632 288
100 3300005841 Ga0068863_100012665 Ga0068863_1000126655 288
101 3300005842 Ga0068858_100048179 Ga0068858_1000481793 288
102 3300005843 Ga0068860_100010476 Ga0068860_1000104766 288
103 3300005844 Ga0068862_100007446 Ga0068862_1000074467 288
104 3300005844 Ga0068862_100053872 Ga0068862_1000538721 288
105 3300006358 Ga0068871_100025290 Ga0068871_1000252903 288
106 3300006844 Ga0075428_100001280 Ga0075428_10000128025 288
107 3300006846 Ga0075430_100001572 Ga0075430_1000015729 288
108 3300006846 Ga0075430_100004185 Ga0075430_10000418512 288
109 3300006846 Ga0075430_100073792 Ga0075430_1000737924 288
110 3300006847 Ga0075431_100002665 Ga0075431_10000266515 288
111 3300006852 Ga0075433_10022945 Ga0075433_100229455 288
112 3300006871 Ga0075434_100007812 Ga0075434_1000078128 288
113 3300006880 Ga0075429_100000181 Ga0075429_1000001815 288
114 3300006880 Ga0075429_100351808 Ga0075429_1003518082 288
115 3300006931 Ga0097620_100013648 Ga0097620_1000136487 288
116 3300006931 Ga0097620_100021731 Ga0097620_1000217314 288
117 3300006931 Ga0097620_100137803 Ga0097620_1001378033 288
118 3300009094 Ga0111539_10000324 Ga0111539_1000032446 288
119 3300009094 Ga0111539_10122736 Ga0111539_101227363 288
120 3300009177 Ga0105248_10263823 Ga0105248_102638232 288
121 3300009553 Ga0105249_10000918 Ga0105249_100009182 288
122 3300009553 Ga0105249_10419299 Ga0105249_104192992 288
123 3300011119 Ga0105246_10009021 Ga0105246_100090216 288
124 3300014325 Ga0163163_10036276 Ga0163163_100362762 288
125 3300014326 Ga0157380_10008748 Ga0157380_100087487 288
126 3300014745 Ga0157377_10003692 Ga0157377_100036921 288
127 3300017792 Ga0163161_10021667 Ga0163161_100216675 288
128 3300017792 Ga0163161_10057022 Ga0163161_100570222 288
129 3300025315 Ga0207697_10001216 Ga0207697_100012164 288
130 3300025315 Ga0207697_10016986 Ga0207697_100169863 288
131 3300025893 Ga0207682_10000256 Ga0207682_100002569 288
132 3300025901 Ga0207688_10007265 Ga0207688_100072651 288
133 3300025901 Ga0207688_10020554 Ga0207688_100205542 288
134 3300025903 Ga0207680_10116832 Ga0207680_101168322 288
135 3300025907 Ga0207645_10001189 Ga0207645_1000118915 288
136 3300025908 Ga0207643_10009439 Ga0207643_100094392 288
137 3300025908 Ga0207643_10015276 Ga0207643_100152763 288
138 3300025908 Ga0207643_10058397 Ga0207643_100583973 288
139 3300025918 Ga0207662_10032685 Ga0207662_100326853 288
140 3300025920 Ga0207649_10018941 Ga0207649_100189413 288
141 3300025922 Ga0207646_10182646 Ga0207646_101826462 288
142 3300025926 Ga0207659_10048884 Ga0207659_100488842 288
143 3300025926 Ga0207659_10080868 Ga0207659_100808682 288
144 3300025933 Ga0207706_10000390 Ga0207706_100003906 288
145 3300025936 Ga0207670_10098065 Ga0207670_100980651 288
146 3300025937 Ga0207669_10001315 Ga0207669_100013156 288
147 3300025940 Ga0207691_10003570 Ga0207691_100035709 288
148 3300025940 Ga0207691_10008721 Ga0207691_100087217 288
149 3300025940 Ga0207691_10011389 Ga0207691_100113895 288
150 3300025942 Ga0207689_10015707 Ga0207689_100157075 288
151 3300025942 Ga0207689_10043869 Ga0207689_100438694 288
152 3300025945 Ga0207679_10006630 Ga0207679_100066303 288
153 3300025945 Ga0207679_10050412 Ga0207679_100504122 288
154 3300025960 Ga0207651_10018299 Ga0207651_100182992 288
155 3300025960 Ga0207651_10034020 Ga0207651_100340204 288
156 3300025961 Ga0207712_10005085 Ga0207712_100050854 288
157 3300025972 Ga0207668_10339083 Ga0207668_103390832 288
158 3300025981 Ga0207640_10114782 Ga0207640_101147822 288
159 3300026067 Ga0207678_10200737 Ga0207678_102007372 288
160 3300026075 Ga0207708_10009222 Ga0207708_100092225 288
161 3300026075 Ga0207708_10075600 Ga0207708_100756003 288
162 3300026089 Ga0207648_10027493 Ga0207648_100274933 288
163 3300026089 Ga0207648_10197153 Ga0207648_101971532 288
164 3300026095 Ga0207676_10035206 Ga0207676_100352062 288
165 3300026116 Ga0207674_10074662 Ga0207674_100746623 288
166 3300026116 Ga0207674_10256419 Ga0207674_102564191 288
167 3300026118 Ga0207675_100011352 Ga0207675_1000113525 288
168 3300026121 Ga0207683_10001056 Ga0207683_1000105610 288
169 3300026121 Ga0207683_10088414 Ga0207683_100884143 288
170 3300028380 Ga0268265_10008166 Ga0268265_100081665 288
171 3300028380 Ga0268265_10031877 Ga0268265_100318773 288
172 3300031731 Ga0307405_10061946 Ga0307405_100619461 288
173 3300034819 Ga0373958_0022369 Ga0373958_0022369_35_919 288
174 3300035112 Ga0373932_0035712 Ga0373932_0035712_396_1280 288
175 3300042184 Ga0450908_009879 Ga0450908_009879_715_1611 288
176 3300042436 Ga0439435_0015511 Ga0439435_0015511_997_1884 288
177 3300048911 Ga0496108_0519132 Ga0496108_0519132_59_943 288
178 3300049577 Ga0501041_0043831 Ga0501041_0043831_1631_2533 288
179 3300049580 Ga0501046_0177555 Ga0501046_0177555_217_1119 288
180 3300049585 Ga0501069_0011560 Ga0501069_0011560_356_1252 288
181 3300049587 Ga0501071_0036522 Ga0501071_0036522_1180_2082 288
182 3300049591 Ga0501075_0115244 Ga0501075_0115244_929_1831 288
183 3300049824 Ga0501045_0052800 Ga0501045_0052800_1150_2052 288
184 3300050508 nmdc:mga09592_392447_c1 nmdc:mga09592_392447_c1_116_1000 288
185 3300050508 nmdc:mga09592_9218_c1 nmdc:mga09592_9218_c1_2718_3602 288
186 3300050509 nmdc:mga0qj67_169030_c1 nmdc:mga0qj67_169030_c1_163_1044 288
187 3300050509 nmdc:mga0qj67_402_c1 nmdc:mga0qj67_402_c1_2498_3382 288
188 3300050509 nmdc:mga0qj67_66376_c1 nmdc:mga0qj67_66376_c1_875_1771 288
189 3300050509 nmdc:mga0qj67_937_c1 nmdc:mga0qj67_937_c1_2592_3476 288
190 3300050510 nmdc:mga06r32_21926_c1 nmdc:mga06r32_21926_c1_4482_5378 288
191 3300050510 nmdc:mga06r32_27812_c1 nmdc:mga06r32_27812_c1_1236_2132 288
192 3300050510 nmdc:mga06r32_3800_c1 nmdc:mga06r32_3800_c1_1038_1922 288
193 3300050510 nmdc:mga06r32_90819_c1 nmdc:mga06r32_90819_c1_2079_2963 288
194 3300050511 nmdc:mga08y16_46813_c1 nmdc:mga08y16_46813_c1_471_1355 288
195 3300050511 nmdc:mga08y16_610436_c1 nmdc:mga08y16_610436_c1_161_1057 288
196 3300050512 nmdc:mga0n895_3887_c1 nmdc:mga0n895_3887_c1_4513_5397 288
197 3300050513 nmdc:mga0rr50_310125_c1 nmdc:mga0rr50_310125_c1_392_1276 288
198 3300054114 Ga0501084_0064879 Ga0501084_0064879_960_1862 288
199 2162886011 MRS1b_contig_6635214 MRS1b_0007.00002250 289
200 3300005288 Ga0065714_10078145 Ga0065714_100781452 289
201 3300005289 Ga0065704_10084663 Ga0065704_100846633 289
202 3300005290 Ga0065712_10000375 Ga0065712_100003752 289
203 3300005293 Ga0065715_10000319 Ga0065715_100003194 289
204 3300005293 Ga0065715_10171088 Ga0065715_101710882 289
205 3300005328 Ga0070676_10108258 Ga0070676_101082582 289
206 3300005329 Ga0070683_100063512 Ga0070683_1000635123 289
207 3300005331 Ga0070670_100060217 Ga0070670_1000602173 289
208 3300005331 Ga0070670_100391328 Ga0070670_1003913281 289
209 3300005331 Ga0070670_100554806 Ga0070670_1005548061 289
210 3300005354 Ga0070675_100227246 Ga0070675_1002272462 289
211 3300005355 Ga0070671_100008027 Ga0070671_1000080277 289
212 3300005356 Ga0070674_100369816 Ga0070674_1003698162 289
213 3300005367 Ga0070667_100099993 Ga0070667_1000999932 289
214 3300005440 Ga0070705_100004014 Ga0070705_1000040145 289
215 3300005440 Ga0070705_100020385 Ga0070705_1000203852 289
216 3300005444 Ga0070694_100001263 Ga0070694_10000126312 289
217 3300005444 Ga0070694_100001421 Ga0070694_10000142115 289
218 3300005445 Ga0070708_100235796 Ga0070708_1002357962 289
219 3300005456 Ga0070678_100246460 Ga0070678_1002464602 289
220 3300005458 Ga0070681_10078581 Ga0070681_100785812 289
221 3300005459 Ga0068867_100072093 Ga0068867_1000720932 289
222 3300005466 Ga0070685_10041081 Ga0070685_100410812 289
223 3300005467 Ga0070706_100078007 Ga0070706_1000780073 289
224 3300005467 Ga0070706_100130016 Ga0070706_1001300162 289
225 3300005468 Ga0070707_100060306 Ga0070707_1000603063 289
226 3300005468 Ga0070707_100228695 Ga0070707_1002286952 289
227 3300005471 Ga0070698_100006494 Ga0070698_1000064948 289
228 3300005471 Ga0070698_100024963 Ga0070698_1000249633 289
229 3300005518 Ga0070699_100011804 Ga0070699_1000118049 289
230 3300005535 Ga0070684_100061250 Ga0070684_1000612502 289
231 3300005536 Ga0070697_100210635 Ga0070697_1002106352 289
232 3300005544 Ga0070686_100013152 Ga0070686_1000131524 289
233 3300005545 Ga0070695_100000155 Ga0070695_10000015510 289
234 3300005545 Ga0070695_100012116 Ga0070695_1000121164 289
235 3300005545 Ga0070695_100139586 Ga0070695_1001395863 289
236 3300005546 Ga0070696_100000499 Ga0070696_10000049924 289
237 3300005546 Ga0070696_100018420 Ga0070696_1000184203 289
238 3300005546 Ga0070696_100020527 Ga0070696_1000205272 289
239 3300005548 Ga0070665_100127266 Ga0070665_1001272662 289
240 3300005548 Ga0070665_100542356 Ga0070665_1005423562 289
241 3300005549 Ga0070704_100001916 Ga0070704_1000019163 289
242 3300005549 Ga0070704_100021875 Ga0070704_1000218754 289
243 3300005549 Ga0070704_100022977 Ga0070704_1000229773 289
244 3300005549 Ga0070704_100062787 Ga0070704_1000627872 289
245 3300005577 Ga0068857_100034333 Ga0068857_1000343333 289
246 3300005615 Ga0070702_100121131 Ga0070702_1001211312 289
247 3300005615 Ga0070702_100133334 Ga0070702_1001333342 289
248 3300005616 Ga0068852_100354186 Ga0068852_1003541861 289
249 3300005618 Ga0068864_100006351 Ga0068864_1000063518 289
250 3300005618 Ga0068864_100031978 Ga0068864_1000319782 289
251 3300005841 Ga0068863_100060573 Ga0068863_1000605734 289
252 3300005844 Ga0068862_100067718 Ga0068862_1000677182 289
253 3300006028 Ga0070717_10610844 Ga0070717_106108442 289
254 3300006237 Ga0097621_100054679 Ga0097621_1000546791 289
255 3300006237 Ga0097621_100432357 Ga0097621_1004323571 289
256 3300006358 Ga0068871_100247724 Ga0068871_1002477242 289
257 3300006844 Ga0075428_100011749 Ga0075428_1000117493 289
258 3300006844 Ga0075428_100108950 Ga0075428_1001089502 289
259 3300006844 Ga0075428_100575325 Ga0075428_1005753251 289
260 3300006852 Ga0075433_10020715 Ga0075433_100207153 289
261 3300006852 Ga0075433_10031706 Ga0075433_100317062 289
262 3300006852 Ga0075433_10069749 Ga0075433_100697491 289
263 3300006871 Ga0075434_100000553 Ga0075434_10000055315 289
264 3300006871 Ga0075434_100002820 Ga0075434_1000028203 289
265 3300006871 Ga0075434_100195249 Ga0075434_1001952492 289
266 3300006871 Ga0075434_100345764 Ga0075434_1003457641 289
267 3300006880 Ga0075429_100067113 Ga0075429_1000671132 289
268 3300007076 Ga0075435_100229558 Ga0075435_1002295582 289
269 3300009094 Ga0111539_10080919 Ga0111539_100809192 289
270 3300009098 Ga0105245_10236264 Ga0105245_102362642 289
271 3300009147 Ga0114129_10016230 Ga0114129_100162305 289
272 3300009147 Ga0114129_10027426 Ga0114129_100274268 289
273 3300009147 Ga0114129_10252072 Ga0114129_102520723 289
274 3300009148 Ga0105243_10038268 Ga0105243_100382684 289
275 3300009176 Ga0105242_10150347 Ga0105242_101503472 289
276 3300009177 Ga0105248_10101435 Ga0105248_101014353 289
277 3300013297 Ga0157378_10032310 Ga0157378_100323103 289
278 3300013297 Ga0157378_10046818 Ga0157378_100468184 289
279 3300013308 Ga0157375_10317935 Ga0157375_103179352 289
280 3300014325 Ga0163163_10011235 Ga0163163_100112354 289
281 3300014745 Ga0157377_10020487 Ga0157377_100204873 289
282 3300025922 Ga0207646_10082472 Ga0207646_100824723 289
283 3300025922 Ga0207646_10204946 Ga0207646_102049462 289
284 3300025923 Ga0207681_10171679 Ga0207681_101716792 289
285 3300025925 Ga0207650_10285500 Ga0207650_102855002 289
286 3300025926 Ga0207659_10267060 Ga0207659_102670602 289
287 3300025926 Ga0207659_10428355 Ga0207659_104283552 289
288 3300025927 Ga0207687_10377230 Ga0207687_103772302 289
289 3300025931 Ga0207644_10004067 Ga0207644_100040671 289
290 3300025934 Ga0207686_10138500 Ga0207686_101385002 289
291 3300025938 Ga0207704_10403785 Ga0207704_104037852 289
292 3300025940 Ga0207691_10056446 Ga0207691_100564462 289
293 3300025941 Ga0207711_10033184 Ga0207711_100331844 289
294 3300025944 Ga0207661_10206666 Ga0207661_102066661 289
295 3300025986 Ga0207658_10076056 Ga0207658_100760562 289
296 3300026075 Ga0207708_10075136 Ga0207708_100751362 289
297 3300026075 Ga0207708_10123178 Ga0207708_101231783 289
298 3300026089 Ga0207648_10049813 Ga0207648_100498132 289
299 3300026089 Ga0207648_10541489 Ga0207648_105414892 289
300 3300026116 Ga0207674_10531290 Ga0207674_105312902 289
301 3300026118 Ga0207675_100119205 Ga0207675_1001192051 289
302 3300026121 Ga0207683_10066263 Ga0207683_100662633 289
303 3300026121 Ga0207683_10076646 Ga0207683_100766463 289
304 3300028380 Ga0268265_10046541 Ga0268265_100465412 289
305 3300035172 Ga0373955_0133176 Ga0373955_0133176_411_1289 289
306 3300035692 Ga0373935_0236068 Ga0373935_0236068_76_954 289
307 3300045051 Ga0451576_0044131 Ga0451576_0044131_2691_3581 289
308 3300046455 Ga0495603_0088390 Ga0495603_0088390_602_1492 289
309 3300046459 Ga0495629_0057321 Ga0495629_0057321_1270_2148 289
310 3300046473 Ga0495582_0156836 Ga0495582_0156836_53_943 289
311 3300046491 Ga0495584_0057969 Ga0495584_0057969_119_1009 289
312 3300046525 Ga0495663_0028317 Ga0495663_0028317_174_1064 289
313 3300046537 Ga0495598_0015356 Ga0495598_0015356_901_1797 289
314 3300046539 Ga0495621_0004158 Ga0495621_0004158_137_1027 289
315 3300046539 Ga0495621_0035034 Ga0495621_0035034_124_1014 289
316 3300046663 Ga0495635_0027213 Ga0495635_0027213_2297_3175 289
317 3300046664 Ga0495659_0040166 Ga0495659_0040166_633_1529 289
318 3300046664 Ga0495659_0117272 Ga0495659_0117272_64_960 289
319 3300046684 Ga0495669_0021187 Ga0495669_0021187_1289_2185 289
320 3300047318 Ga0495636_0065495 Ga0495636_0065495_458_1354 289
321 3300047321 Ga0495676_0020998 Ga0495676_0020998_4750_5628 289
322 3300047445 Ga0495677_0056415 Ga0495677_0056415_72_962 289
323 3300047447 Ga0495685_020804 Ga0495685_020804_376_1266 289
324 3300048903 Ga0496100_0358304 Ga0496100_0358304_210_1079 289
325 3300048904 Ga0496101_0531037 Ga0496101_0531037_36_905 289
326 3300048907 Ga0496104_0044216 Ga0496104_0044216_2984_3853 289
327 3300048911 Ga0496108_0233833 Ga0496108_0233833_103_972 289
328 3300048912 Ga0496109_0004075 Ga0496109_0004075_9909_10778 289
329 3300048913 Ga0496110_0072018 Ga0496110_0072018_1335_2204 289
330 3300049568 Ga0501031_0005681 Ga0501031_0005681_832_1731 289
331 3300049568 Ga0501031_0041982 Ga0501031_0041982_648_1547 289
332 3300049569 Ga0501032_0009519 Ga0501032_0009519_5329_6228 289
333 3300049569 Ga0501032_0025499 Ga0501032_0025499_1015_1914 289
334 3300049570 Ga0501033_0000468 Ga0501033_0000468_30180_31079 289
335 3300049570 Ga0501033_0012216 Ga0501033_0012216_4865_5767 289
336 3300049570 Ga0501033_0019271 Ga0501033_0019271_2068_2967 289
337 3300049571 Ga0501034_0007511 Ga0501034_0007511_7911_8810 289
338 3300049571 Ga0501034_0054494 Ga0501034_0054494_2836_3735 289
339 3300049572 Ga0501036_0003443 Ga0501036_0003443_3063_3962 289
340 3300049572 Ga0501036_0008878 Ga0501036_0008878_2355_3257 289
341 3300049572 Ga0501036_0032613 Ga0501036_0032613_2058_2957 289
342 3300049573 Ga0501037_0002140 Ga0501037_0002140_5869_6768 289
343 3300049574 Ga0501038_0005382 Ga0501038_0005382_5634_6533 289
344 3300049574 Ga0501038_0006096 Ga0501038_0006096_4407_5306 289
345 3300049574 Ga0501038_0034586 Ga0501038_0034586_112_1014 289
346 3300049575 Ga0501039_0003770 Ga0501039_0003770_8130_9029 289
347 3300049578 Ga0501042_0008787 Ga0501042_0008787_3130_4029 289
348 3300049579 Ga0501043_0010864 Ga0501043_0010864_1485_2384 289
349 3300049579 Ga0501043_0037405 Ga0501043_0037405_842_1741 289
350 3300049579 Ga0501043_0048854 Ga0501043_0048854_405_1307 289
351 3300049580 Ga0501046_0004454 Ga0501046_0004454_2244_3143 289
352 3300049580 Ga0501046_0019269 Ga0501046_0019269_2699_3598 289
353 3300049581 Ga0501047_0009075 Ga0501047_0009075_1515_2414 289
354 3300049581 Ga0501047_0070390 Ga0501047_0070390_535_1434 289
355 3300049582 Ga0501048_0002710 Ga0501048_0002710_2959_3858 289
356 3300049582 Ga0501048_0014280 Ga0501048_0014280_345_1247 289
357 3300049582 Ga0501048_0018089 Ga0501048_0018089_428_1327 289
358 3300049583 Ga0501067_0000350 Ga0501067_0000350_16267_17166 289
359 3300049584 Ga0501068_0001746 Ga0501068_0001746_9088_9987 289
360 3300049584 Ga0501068_0040053 Ga0501068_0040053_495_1394 289
361 3300049585 Ga0501069_0001158 Ga0501069_0001158_7236_8135 289
362 3300049585 Ga0501069_0020568 Ga0501069_0020568_2090_2992 289
363 3300049586 Ga0501070_0007306 Ga0501070_0007306_6999_7898 289
364 3300049586 Ga0501070_0024467 Ga0501070_0024467_2104_3003 289
365 3300049587 Ga0501071_0077537 Ga0501071_0077537_937_1836 289
366 3300049588 Ga0501072_0031998 Ga0501072_0031998_1325_2224 289
367 3300049589 Ga0501073_0004471 Ga0501073_0004471_8995_9894 289
368 3300049589 Ga0501073_0014209 Ga0501073_0014209_3953_4852 289
369 3300049589 Ga0501073_0064652 Ga0501073_0064652_1418_2320 289
370 3300049590 Ga0501074_0002277 Ga0501074_0002277_2667_3566 289
371 3300049590 Ga0501074_0008235 Ga0501074_0008235_885_1787 289
372 3300049590 Ga0501074_0063127 Ga0501074_0063127_712_1611 289
373 3300049592 Ga0501076_0087340 Ga0501076_0087340_373_1275 289
374 3300049741 Ga0501079_0007827 Ga0501079_0007827_731_1633 289
375 3300049741 Ga0501079_0008910 Ga0501079_0008910_5232_6131 289
376 3300049741 Ga0501079_0013088 Ga0501079_0013088_1760_2659 289
377 3300049742 Ga0501080_0005023 Ga0501080_0005023_9614_10513 289
378 3300049742 Ga0501080_0019306 Ga0501080_0019306_4866_5768 289
379 3300049742 Ga0501080_0050189 Ga0501080_0050189_1927_2826 289
380 3300049744 Ga0501083_0013506 Ga0501083_0013506_801_1703 289
381 3300049744 Ga0501083_0017269 Ga0501083_0017269_3177_4076 289
382 3300049822 Ga0501035_0010139 Ga0501035_0010139_870_1772 289
383 3300049822 Ga0501035_0016240 Ga0501035_0016240_2062_2961 289
384 3300049822 Ga0501035_0038683 Ga0501035_0038683_1485_2384 289
385 3300049823 Ga0501044_0012129 Ga0501044_0012129_2166_3065 289
386 3300049823 Ga0501044_0165657 Ga0501044_0165657_347_1246 289
387 3300049824 Ga0501045_0048871 Ga0501045_0048871_1374_2273 289
388 3300050508 nmdc:mga09592_17655_c1 nmdc:mga09592_17655_c1_3985_4881 289
389 3300050512 nmdc:mga0n895_123465_c1 nmdc:mga0n895_123465_c1_123_1013 289
390 3300050512 nmdc:mga0n895_14275_c1 nmdc:mga0n895_14275_c1_5886_6776 289
391 3300050512 nmdc:mga0n895_368946_c1 nmdc:mga0n895_368946_c1_478_1374 289
392 3300050512 nmdc:mga0n895_4653_c1 nmdc:mga0n895_4653_c1_9441_10331 289
393 3300050512 nmdc:mga0n895_522408_c1 nmdc:mga0n895_522408_c1_257_1147 289
394 3300050513 nmdc:mga0rr50_114490_c1 nmdc:mga0rr50_114490_c1_491_1381 289
395 3300050513 nmdc:mga0rr50_203944_c1 nmdc:mga0rr50_203944_c1_236_1132 289
396 3300050513 nmdc:mga0rr50_24440_c1 nmdc:mga0rr50_24440_c1_2329_3225 289
397 3300050515 nmdc:mga0a205_21905_c1 nmdc:mga0a205_21905_c1_3283_4173 289
398 3300050515 nmdc:mga0a205_39916_c1 nmdc:mga0a205_39916_c1_421_1311 289
399 3300050515 nmdc:mga0a205_52311_c1 nmdc:mga0a205_52311_c1_2151_3041 289
400 3300053077 Ga0495601_0021083 Ga0495601_0021083_189_1067 289
401 3300053084 Ga0495595_0029562 Ga0495595_0029562_1200_2078 289
402 3300054114 Ga0501084_0003177 Ga0501084_0003177_3214_4113 289
403 3300054114 Ga0501084_0101786 Ga0501084_0101786_1183_2085 289
404 3300060353 Ga0501082_0006845 Ga0501082_0006845_6849_7751 289
405 3300060353 Ga0501082_0010821 Ga0501082_0010821_2626_3525 289

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02274

ADI

Arginine deiminase

223

306

0.91

PF02274

ADI

Arginine deiminase

91

226

0.87

PF19420

DDAH_eukar

N,N dimethylarginine dimethylhydrolase, eukaryotic

53

305

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6juy-assembly1.cif.gz_D crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.886 6 287
6juy-assembly1.cif.gz_B crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.8854 8 287
6juy-assembly1.cif.gz_A crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.8849 8 287
1h70-assembly1.cif.gz_A ddah from pseudomonas aeruginosa. c249s mutant complexed with citrulline 0.8763 7 281
6juz-assembly1.cif.gz_A crystal structure of n-terminal domain of argz(n71s) covalently bond to a reaction intermediate 0.8761 10 286
ID Description Score Start End Superfamily
af_P71889_53_299_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9069 36 280 3.75.10.10
af_A0A1D6JTA1_151_233_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8941 240 265 3.40.50.1100
af_A0A7I9BCB0_10_272_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8844 8 284 3.75.10.10
af_Q6NKY5_75_177_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8802 240 265 3.40.50.1100
af_A0A7I9BCB0_10_272_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8781 8 284 3.75.10.10
ID Description Score Start End GO Terms
AF-A0A2E0PKF6-F1-model_v4 Amidinotransferase 0.9945 6 287 GO:0016990
GO:0019546
AF-A0A1Q7Z7V1-F1-model_v4 Amidinotransferase 0.9932 12 248 GO:0016990
GO:0019546
AF-A0A382ZF63-F1-model_v4 Amidinotransferase 0.9926 31 287 GO:0016990
GO:0019546
AF-A0A388NYZ8-F1-model_v4 Arginine deiminase 0.9917 187 287 GO:0006527
GO:0016990
AF-A0A5C7MN02-F1-model_v4 Amidinotransferase 0.9912 3 155 GO:0016990
GO:0019546

Feature Viewer

pLDDT pTM Quality
95.16 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map