F435874

General Info

Members Datasets Scaffolds Average Seq Length
405 202 405 327

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100023328|Ga0070671_1000233282
Length 372
Sequence MVIHRLTLVAQAVRPAFGPGSPTRLRATRFGASTVARARSVRERRWKGLRCLLLXXXVSASCARQQSPAGITIAVIPKGTSHVFWQSIHAGAAKAAQELGVSIIWRGPLREDDRAAQVSEVEGFVSRGVSGIVLAPLDDSALAPPVAAAKRRGIPVVVIDSGLKGDDYVSFVATDNRAGGRLAGEQLAKLLNDTGKVVMLRYAEGSESTAQREAGFLEAIEAHKGIQVVSANQYGGADVESAFKKSESLLGGLKKADGSLDVDGIFTPNESTTVAMVRVLQSNGWAGKRRFIGFDASDLLVKALADGHLDGLVLQDPVNMGYLGVKTMVAHLKGNTVDKRIDTGVRLVTRDHMNDPDAKELLHPDLAKWLKN

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
130 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
131 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
132 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
133 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
134 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
135 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
136 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
137 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
140 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
141 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
148 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
149 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
150 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
170 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.22
Nodule 0
Rhizoplane 2.47
Rhizosphere 95.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_494398 2162886006 Unclassified 1335
2 Ga0065715_10222482 3300005293 Bacteria 1257
3 Ga0070676_10011010 3300005328 Bacteria 4914
4 Ga0070676_10024120 3300005328 Bacteria 3424
5 Ga0070690_100038989 3300005330 Bacteria 3000
6 Ga0070670_100015938 3300005331 Bacteria 6449
7 Ga0068869_100003285 3300005334 Bacteria 9870
8 Ga0068869_100030821 3300005334 Bacteria 3769
9 Ga0068868_100017264 3300005338 Bacteria 5372
10 Ga0070689_100018846 3300005340 Bacteria 5094
11 Ga0070691_10003314 3300005341 Bacteria 7224
12 Ga0070687_100031176 3300005343 Bacteria 2614
13 Ga0070668_100025055 3300005347 Bacteria 4521
14 Ga0070669_100007157 3300005353 Bacteria 8017
15 Ga0070669_100063470 3300005353 Bacteria 2719
16 Ga0070669_100273922 3300005353 Unclassified 1350
17 Ga0070669_100277610 3300005353 Bacteria 1342
18 Ga0070675_100011846 3300005354 Bacteria 6831
19 Ga0070671_100023328 3300005355 Bacteria 5063
20 Ga0070674_100010109 3300005356 Bacteria 5686
21 Ga0070674_100315872 3300005356 Bacteria 1251
22 Ga0070673_100112912 3300005364 Bacteria 2256
23 Ga0070673_100341090 3300005364 Bacteria 1328
24 Ga0070667_100016931 3300005367 Bacteria 6032
25 Ga0070701_10002840 3300005438 Bacteria 6749
26 Ga0070701_10004573 3300005438 Bacteria 5626
27 Ga0070705_100017655 3300005440 Bacteria 3727
28 Ga0070700_100018325 3300005441 Bacteria 4024
29 Ga0070700_100037813 3300005441 Bacteria 2937
30 Ga0070700_100053682 3300005441 Bacteria 2516
31 Ga0070694_100009094 3300005444 Bacteria 6093
32 Ga0070694_100088355 3300005444 Bacteria 2170
33 Ga0070708_100037617 3300005445 Bacteria 4223
34 Ga0070708_100147750 3300005445 Bacteria 2184
35 Ga0070678_100044984 3300005456 Bacteria 3156
36 Ga0070678_100153403 3300005456 Bacteria 1858
37 Ga0070678_100189458 3300005456 Bacteria 1690
38 Ga0068867_100012554 3300005459 Bacteria 5991
39 Ga0068867_100050909 3300005459 Bacteria 3054
40 Ga0068867_100129260 3300005459 Bacteria 1961
41 Ga0068867_100136912 3300005459 Unclassified 1910
42 Ga0070685_10087801 3300005466 Bacteria 1877
43 Ga0070706_100008256 3300005467 Bacteria 9713
44 Ga0070706_100013739 3300005467 Bacteria 7486
45 Ga0070706_100181447 3300005467 Bacteria 1965
46 Ga0070707_100004281 3300005468 Bacteria 13373
47 Ga0070707_100005838 3300005468 Bacteria 11479
48 Ga0070707_100016681 3300005468 Bacteria 6895
49 Ga0070707_100031996 3300005468 Bacteria 5011
50 Ga0070698_100001691 3300005471 Bacteria 24608
51 Ga0070698_100336145 3300005471 Bacteria 1442
52 Ga0070699_100006167 3300005518 Bacteria 10474
53 Ga0070699_100008450 3300005518 Bacteria 8922
54 Ga0070699_100116873 3300005518 Bacteria 2344
55 Ga0070699_100387862 3300005518 Unclassified 1262
56 Ga0070697_100014426 3300005536 Bacteria 6206
57 Ga0070672_100259931 3300005543 Bacteria 1464
58 Ga0070672_100331416 3300005543 Bacteria 1295
59 Ga0070686_100000585 3300005544 Bacteria 21569
60 Ga0070686_100104873 3300005544 Bacteria 1916
61 Ga0070695_100005216 3300005545 Bacteria 7664
62 Ga0070695_100006225 3300005545 Bacteria 7051
63 Ga0070695_100325397 3300005545 Unclassified 1144
64 Ga0070696_100030738 3300005546 Bacteria 3679
65 Ga0070696_100049077 3300005546 Bacteria 2931
66 Ga0070696_100101982 3300005546 Bacteria 2057
67 Ga0070696_100166734 3300005546 Bacteria 1626
68 Ga0070665_100001505 3300005548 Bacteria 27126
69 Ga0070704_100008952 3300005549 Bacteria 6031
70 Ga0070704_100066019 3300005549 Bacteria 2607
71 Ga0070704_100335060 3300005549 Unclassified 1272
72 Ga0068857_100004626 3300005577 Bacteria 11660
73 Ga0068854_100012648 3300005578 Bacteria 5530
74 Ga0068854_100020086 3300005578 Bacteria 4512
75 Ga0070702_100001873 3300005615 Bacteria 8801
76 Ga0070702_100007657 3300005615 Bacteria 5180
77 Ga0068859_100001904 3300005617 Bacteria 21268
78 Ga0068859_100014769 3300005617 Bacteria 7846
79 Ga0068859_100056624 3300005617 Bacteria 3947
80 Ga0068859_100716570 3300005617 Unclassified 1091
81 Ga0068864_100046984 3300005618 Bacteria 3706
82 Ga0068864_100065640 3300005618 Bacteria 3148
83 Ga0068861_100020857 3300005719 Bacteria 4701
84 Ga0068861_100032639 3300005719 Bacteria 3834
85 Ga0068863_100010821 3300005841 Bacteria 8846
86 Ga0068863_100137801 3300005841 Bacteria 2331
87 Ga0068858_100014483 3300005842 Bacteria 7430
88 Ga0068858_100058087 3300005842 Bacteria 3576
89 Ga0068858_100067543 3300005842 Bacteria 3312
90 Ga0068858_100215120 3300005842 Bacteria 1819
91 Ga0068858_100332616 3300005842 Bacteria 1453
92 Ga0068860_100030546 3300005843 Bacteria 5182
93 Ga0068860_100440002 3300005843 Bacteria 1295
94 Ga0068862_100020698 3300005844 Bacteria 5496
95 Ga0068862_100315026 3300005844 Bacteria 1443
96 Ga0068862_100382814 3300005844 Bacteria 1312
97 Ga0081455_10014354 3300005937 Bacteria 7772
98 Ga0081539_10004763 3300005985 Bacteria 14649
99 Ga0075365_10021507 3300006038 Bacteria 4026
100 Ga0075368_10011373 3300006042 Bacteria 3237
101 Ga0075364_10074228 3300006051 Bacteria 2242
102 Ga0075432_10032072 3300006058 Bacteria 1820
103 Ga0075367_10009198 3300006178 Bacteria 5154
104 Ga0075366_10013686 3300006195 Bacteria 4625
105 Ga0075366_10014265 3300006195 Bacteria 4538
106 Ga0068871_100008766 3300006358 Bacteria 7282
107 Ga0068871_100085198 3300006358 Bacteria 2624
108 Ga0068871_100203561 3300006358 Bacteria 1710
109 Ga0075428_100028327 3300006844 Bacteria 6195
110 Ga0075428_100052117 3300006844 Bacteria 4486
111 Ga0075428_100091272 3300006844 Bacteria 3322
112 Ga0075428_100156810 3300006844 Bacteria 2472
113 Ga0075428_100248229 3300006844 Bacteria 1919
114 Ga0075428_100737843 3300006844 Bacteria 1048
115 Ga0075430_100143036 3300006846 Bacteria 1992
116 Ga0075430_100152471 3300006846 Bacteria 1924
117 Ga0075431_100074810 3300006847 Bacteria 3495
118 Ga0075431_100096363 3300006847 Bacteria 3054
119 Ga0075431_100210859 3300006847 Bacteria 1984
120 Ga0075433_10007640 3300006852 Bacteria 8585
121 Ga0075433_10021577 3300006852 Bacteria 5402
122 Ga0075433_10034152 3300006852 Bacteria 4366
123 Ga0075433_10068664 3300006852 Bacteria 3112
124 Ga0075433_10107940 3300006852 Bacteria 2469
125 Ga0075433_10128875 3300006852 Bacteria 2248
126 Ga0075434_100004060 3300006871 Bacteria 13124
127 Ga0075434_100026273 3300006871 Bacteria 5702
128 Ga0075434_100051462 3300006871 Bacteria 4094
129 Ga0075434_100209595 3300006871 Bacteria 1969
130 Ga0075429_100032322 3300006880 Bacteria 4548
131 Ga0075429_100049630 3300006880 Bacteria 3649
132 Ga0068865_100004343 3300006881 Bacteria 8553
133 Ga0068865_100020611 3300006881 Bacteria 4277
134 Ga0068865_100044828 3300006881 Bacteria 3029
135 Ga0075436_100015007 3300006914 Bacteria 5310
136 Ga0075436_100024572 3300006914 Bacteria 4142
137 Ga0075436_100044138 3300006914 Bacteria 3073
138 Ga0075436_100054461 3300006914 Bacteria 2761
139 Ga0097620_100001904 3300006931 Bacteria 21268
140 Ga0097620_100014769 3300006931 Bacteria 7846
141 Ga0097620_100056624 3300006931 Bacteria 3947
142 Ga0075435_100001012 3300007076 Bacteria 17824
143 Ga0075435_100001364 3300007076 Bacteria 15748
144 Ga0075435_100016808 3300007076 Bacteria 5521
145 Ga0075435_100017801 3300007076 Bacteria 5385
146 Ga0075435_100021500 3300007076 Bacteria 4964
147 Ga0075435_100099204 3300007076 Bacteria 2412
148 Ga0105240_10109134 3300009093 Bacteria 3352
149 Ga0105240_10147907 3300009093 Bacteria 2801
150 Ga0111539_10005268 3300009094 Bacteria 16742
151 Ga0111539_10009089 3300009094 Bacteria 12579
152 Ga0111539_10032902 3300009094 Bacteria 6297
153 Ga0111539_10055042 3300009094 Bacteria 4730
154 Ga0111539_10852404 3300009094 Bacteria 1060
155 Ga0105245_10133190 3300009098 Bacteria 2333
156 Ga0105245_10159799 3300009098 Bacteria 2137
157 Ga0105245_10408736 3300009098 Bacteria 1358
158 Ga0105247_10007049 3300009101 Bacteria 6912
159 Ga0114129_10001468 3300009147 Bacteria 31889
160 Ga0114129_10002276 3300009147 Bacteria 26562
161 Ga0114129_10012665 3300009147 Bacteria 12008
162 Ga0114129_10019392 3300009147 Bacteria 9685
163 Ga0114129_10019888 3300009147 Bacteria 9555
164 Ga0114129_10026433 3300009147 Bacteria 8218
165 Ga0114129_10057540 3300009147 Bacteria 5440
166 Ga0114129_10078599 3300009147 Bacteria 4588
167 Ga0114129_10081673 3300009147 Bacteria 4493
168 Ga0114129_10083107 3300009147 Bacteria 4449
169 Ga0114129_10088590 3300009147 Bacteria 4290
170 Ga0114129_10157141 3300009147 Bacteria 3108
171 Ga0114129_10189190 3300009147 Bacteria 2796
172 Ga0114129_10299877 3300009147 Bacteria 2142
173 Ga0114129_10453305 3300009147 Bacteria 1682
174 Ga0105243_10008565 3300009148 Bacteria 7849
175 Ga0105243_10011158 3300009148 Bacteria 6796
176 Ga0105243_10211655 3300009148 Bacteria 1707
177 Ga0105243_10214961 3300009148 Bacteria 1695
178 Ga0105241_10264373 3300009174 Bacteria 1463
179 Ga0105242_10000992 3300009176 Bacteria 22210
180 Ga0105242_10003809 3300009176 Bacteria 11731
181 Ga0105248_10003548 3300009177 Bacteria 17288
182 Ga0105248_10016809 3300009177 Bacteria 8054
183 Ga0105248_10021472 3300009177 Bacteria 7151
184 Ga0105248_10205973 3300009177 Bacteria 2216
185 Ga0105248_10330153 3300009177 Bacteria 1718
186 Ga0105249_10060591 3300009553 Bacteria 3472
187 Ga0105249_10192770 3300009553 Unclassified 1990
188 Ga0105246_10107583 3300011119 Bacteria 2042
189 Ga0157374_10009099 3300013296 Bacteria 8512
190 Ga0157378_10190704 3300013297 Bacteria 1933
191 Ga0163162_10018582 3300013306 Bacteria 6811
192 Ga0157375_10028254 3300013308 Bacteria 5255
193 Ga0157375_10182304 3300013308 Bacteria 2252
194 Ga0163163_10017244 3300014325 Bacteria 6731
195 Ga0163163_10154419 3300014325 Bacteria 2339
196 Ga0157380_10029155 3300014326 Bacteria 4217
197 Ga0157380_10031855 3300014326 Bacteria 4050
198 Ga0157380_10037147 3300014326 Bacteria 3772
199 Ga0157380_10429434 3300014326 Bacteria 1263
200 Ga0157379_10083137 3300014968 Bacteria 2869
201 Ga0157379_10147679 3300014968 Bacteria 2120
202 Ga0157376_10037826 3300014969 Bacteria 3922
203 Ga0157376_10342884 3300014969 Bacteria 1427
204 Ga0207653_10027562 3300025885 Bacteria 1824
205 Ga0207710_10010384 3300025900 Bacteria 3921
206 Ga0207680_10022242 3300025903 Bacteria 3445
207 Ga0207680_10107837 3300025903 Bacteria 1801
208 Ga0207645_10010107 3300025907 Bacteria 6495
209 Ga0207643_10019756 3300025908 Bacteria 3693
210 Ga0207684_10007958 3300025910 Bacteria 9474
211 Ga0207684_10149994 3300025910 Bacteria 2006
212 Ga0207654_10167171 3300025911 Bacteria 1425
213 Ga0207695_10113552 3300025913 Bacteria 2685
214 Ga0207660_10148010 3300025917 Bacteria 1802
215 Ga0207662_10071249 3300025918 Bacteria 2104
216 Ga0207646_10005054 3300025922 Bacteria 14028
217 Ga0207646_10067182 3300025922 Bacteria 3201
218 Ga0207646_10073279 3300025922 Bacteria 3059
219 Ga0207646_10102936 3300025922 Bacteria 2560
220 Ga0207681_10287982 3300025923 Unclassified 1295
221 Ga0207650_10008122 3300025925 Bacteria 7152
222 Ga0207650_10056998 3300025925 Bacteria 2905
223 Ga0207659_10114814 3300025926 Bacteria 2053
224 Ga0207690_10032845 3300025932 Bacteria 3333
225 Ga0207706_10014098 3300025933 Bacteria 7247
226 Ga0207706_10092388 3300025933 Bacteria 2661
227 Ga0207706_10233379 3300025933 Unclassified 1609
228 Ga0207686_10005858 3300025934 Bacteria 6596
229 Ga0207686_10014955 3300025934 Bacteria 4330
230 Ga0207709_10092985 3300025935 Bacteria 1976
231 Ga0207670_10021297 3300025936 Bacteria 3998
232 Ga0207669_10004265 3300025937 Bacteria 6276
233 Ga0207704_10037717 3300025938 Bacteria 2794
234 Ga0207704_10156812 3300025938 Bacteria 1614
235 Ga0207711_10066102 3300025941 Bacteria 3127
236 Ga0207711_10091860 3300025941 Bacteria 2670
237 Ga0207689_10006571 3300025942 Bacteria 10253
238 Ga0207689_10017627 3300025942 Bacteria 6037
239 Ga0207679_10063118 3300025945 Bacteria 2764
240 Ga0207712_10060877 3300025961 Bacteria 2678
241 Ga0207712_10096796 3300025961 Bacteria 2185
242 Ga0207668_10324296 3300025972 Unclassified 1279
243 Ga0207640_10001726 3300025981 Bacteria 11726
244 Ga0207640_10009312 3300025981 Bacteria 5494
245 Ga0207658_10100702 3300025986 Bacteria 2262
246 Ga0207658_10268505 3300025986 Unclassified 1457
247 Ga0207703_10044093 3300026035 Bacteria 3583
248 Ga0207703_10045359 3300026035 Bacteria 3536
249 Ga0207703_10265284 3300026035 Bacteria 1554
250 Ga0207708_10002297 3300026075 Bacteria 14057
251 Ga0207708_10008120 3300026075 Bacteria 7773
252 Ga0207708_10029910 3300026075 Bacteria 4130
253 Ga0207708_10145936 3300026075 Bacteria 1859
254 Ga0207641_10014633 3300026088 Bacteria 6432
255 Ga0207648_10002841 3300026089 Bacteria 18343
256 Ga0207648_10025986 3300026089 Bacteria 5207
257 Ga0207648_10154883 3300026089 Bacteria 2023
258 Ga0207676_10041208 3300026095 Bacteria 3543
259 Ga0207674_10007413 3300026116 Bacteria 12784
260 Ga0207674_10199700 3300026116 Bacteria 1949
261 Ga0207675_100036360 3300026118 Bacteria 4594
262 Ga0207675_100045495 3300026118 Bacteria 4100
263 Ga0207675_100047229 3300026118 Bacteria 4020
264 Ga0207675_100064598 3300026118 Bacteria 3421
265 Ga0207675_100238759 3300026118 Bacteria 1756
266 Ga0207683_10033336 3300026121 Bacteria 4473
267 Ga0207683_10069801 3300026121 Bacteria 3103
268 Ga0207683_10070732 3300026121 Bacteria 3083
269 Ga0207428_10000139 3300027907 Bacteria 98277
270 Ga0207428_10034923 3300027907 Bacteria 4115
271 Ga0207428_10043105 3300027907 Bacteria 3646
272 Ga0207428_10076700 3300027907 Bacteria 2617
273 Ga0268266_10020122 3300028379 Bacteria 5689
274 Ga0268266_10026781 3300028379 Bacteria 4906
275 Ga0268265_10235015 3300028380 Unclassified 1613
276 Ga0268264_10224045 3300028381 Bacteria 1733
277 Ga0307408_100085763 3300031548 Bacteria 2365
278 Ga0307408_100334721 3300031548 Unclassified 1279
279 Ga0307408_100407937 3300031548 Bacteria 1168
280 Ga0307406_10072826 3300031901 Bacteria 2257
281 Ga0307412_10139758 3300031911 Bacteria 1772
282 Ga0307412_10238720 3300031911 Bacteria 1404
283 Ga0307411_10080465 3300032005 Bacteria 2240
284 Ga0373950_0000125 3300034818 Bacteria 13264
285 Ga0373958_0008116 3300034819 Bacteria 1693
286 Ga0373959_0002052 3300034820 Bacteria 3214
287 Ga0373938_0000240 3300034957 Bacteria 8530
288 Ga0373928_0002738 3300035084 Bacteria 3403
289 Ga0373929_0001025 3300035085 Bacteria 5425
290 Ga0373949_0000368 3300035090 Bacteria 15951
291 Ga0373951_0006438 3300035091 Bacteria 2685
292 Ga0373952_0000893 3300035092 Bacteria 5425
293 Ga0373932_0001404 3300035112 Bacteria 6747
294 Ga0373939_0027740 3300035114 Bacteria 1606
295 Ga0373941_0000812 3300035115 Bacteria 6403
296 Ga0373960_0019216 3300035121 Bacteria 1792
297 Ga0373955_0007200 3300035172 Bacteria 5102
298 Ga0373942_0000385 3300035207 Bacteria 12202
299 Ga0373961_0001950 3300035241 Bacteria 5590
300 Ga0373961_0016017 3300035241 Bacteria 1927
301 Ga0373962_0004865 3300035242 Bacteria 3246
302 Ga0373937_0033634 3300036401 Bacteria 4658
303 Ga0373937_0101739 3300036401 Bacteria 2667
304 Ga0373937_0293048 3300036401 Bacteria 1537
305 Ga0439431_0004721 3300041997 Bacteria 2997
306 Ga0439433_0003686 3300041999 Bacteria 3290
307 Ga0439442_024884 3300042002 Bacteria 1246
308 Ga0439464_0000947 3300042439 Bacteria 6547
309 Ga0451576_0029882 3300045051 Bacteria 5829
310 Ga0451576_0035619 3300045051 Bacteria 5279
311 Ga0495638_0001351 3300046460 Bacteria 22516
312 Ga0495638_0007282 3300046460 Bacteria 7953
313 Ga0495653_0275344 3300046463 Unclassified 1107
314 Ga0495584_0000198 3300046491 Bacteria 42784
315 Ga0495585_0067685 3300046492 Bacteria 1952
316 Ga0495634_0079585 3300046642 Bacteria 2146
317 Ga0495635_0102989 3300046663 Bacteria 1951
318 Ga0495661_0080565 3300046665 Bacteria 1878
319 Ga0495647_0087838 3300046681 Bacteria 1270
320 Ga0495658_0053077 3300046683 Bacteria 2301
321 Ga0496102_0433951 3300048905 Bacteria 1233
322 Ga0496104_0125674 3300048907 Unclassified 2463
323 Ga0496106_0345211 3300048909 Bacteria 1195
324 Ga0496107_0283209 3300048910 Bacteria 1234
325 Ga0496108_0030105 3300048911 Bacteria 4499
326 Ga0496112_0060873 3300048915 Bacteria 3720
327 Ga0496112_0162360 3300048915 Bacteria 2201
328 Ga0496114_0137248 3300048917 Bacteria 2115
329 Ga0496114_0168472 3300048917 Bacteria 1908
330 Ga0496115_0132510 3300048918 Bacteria 2054
331 Ga0501291_009976 3300049514 Bacteria 1342
332 Ga0501299_004292 3300049522 Bacteria 2121
333 Ga0501036_0126577 3300049572 Bacteria 2158
334 Ga0501040_0141848 3300049576 Bacteria 1693
335 Ga0501042_0106058 3300049578 Bacteria 2022
336 Ga0501067_0099202 3300049583 Bacteria 1618
337 Ga0501068_0179013 3300049584 Unclassified 1340
338 Ga0501071_0040818 3300049587 Bacteria 3322
339 Ga0501072_0030002 3300049588 Bacteria 4250
340 Ga0501074_0070230 3300049590 Bacteria 2518
341 Ga0501075_0024767 3300049591 Bacteria 4406
342 Ga0501075_0051048 3300049591 Bacteria 3109
343 Ga0501076_0032790 3300049592 Bacteria 4056
344 Ga0501076_0149776 3300049592 Unclassified 1898
345 Ga0501217_012787 3300049661 Bacteria 1875
346 Ga0501079_0050405 3300049741 Bacteria 3214
347 Ga0501080_0225960 3300049742 Bacteria 1712
348 Ga0501081_0081745 3300049743 Bacteria 2263
349 Ga0501081_0257026 3300049743 Bacteria 1276
350 Ga0501045_0092792 3300049824 Bacteria 2233
351 Ga0501045_0169376 3300049824 Bacteria 1627
352 nmdc:mga03683_36138_c1 3300050489 Bacteria 2008
353 nmdc:mga0k408_26282_c1 3300050493 Bacteria 3300
354 nmdc:mga06z11_9707_c1 3300050494 Bacteria 4065
355 nmdc:mga05p37_173510_c1 3300050507 Bacteria 2628
356 nmdc:mga05p37_201177_c1 3300050507 Bacteria 2412
357 nmdc:mga05p37_211576_c1 3300050507 Bacteria 2344
358 nmdc:mga05p37_22199_c1 3300050507 Bacteria 7694
359 nmdc:mga05p37_284204_c1 3300050507 Bacteria 1972
360 nmdc:mga05p37_38721_c1 3300050507 Bacteria 5849
361 nmdc:mga05p37_43831_c1 3300050507 Bacteria 5505
362 nmdc:mga05p37_44628_c1 3300050507 Bacteria 5454
363 nmdc:mga05p37_45501_c1 3300050507 Bacteria 5397
364 nmdc:mga05p37_66140_c1 3300050507 Bacteria 4446
365 nmdc:mga05p37_687_c1 3300050507 Bacteria 37482
366 nmdc:mga05p37_69565_c1 3300050507 Bacteria 3987
367 nmdc:mga09592_112340_c1 3300050508 Bacteria 2337
368 nmdc:mga09592_171042_c1 3300050508 Bacteria 1879
369 nmdc:mga09592_22383_c1 3300050508 Bacteria 5215
370 nmdc:mga09592_39564_c1 3300050508 Bacteria 3961
371 nmdc:mga0qj67_49492_c1 3300050509 Bacteria 3322
372 nmdc:mga06r32_119970_c1 3300050510 Bacteria 2593
373 nmdc:mga06r32_121422_c1 3300050510 Bacteria 2578
374 nmdc:mga06r32_147524_c1 3300050510 Bacteria 2330
375 nmdc:mga06r32_32262_c1 3300050510 Bacteria 4927
376 nmdc:mga06r32_97385_c1 3300050510 Bacteria 2882
377 nmdc:mga08y16_17853_c2 3300050511 Bacteria 7111
378 nmdc:mga08y16_289116_c1 3300050511 Bacteria 1690
379 nmdc:mga08y16_31736_c1 3300050511 Bacteria 5554
380 nmdc:mga08y16_9106_c1 3300050511 Bacteria 10425
381 nmdc:mga0n895_101116_c1 3300050512 Bacteria 2892
382 nmdc:mga0n895_206310_c1 3300050512 Bacteria 1996
383 nmdc:mga0n895_2922_c1 3300050512 Bacteria 13544
384 nmdc:mga0n895_45978_c1 3300050512 Bacteria 4263
385 nmdc:mga0n895_53142_c1 3300050512 Bacteria 3979
386 nmdc:mga0n895_68009_c1 3300050512 Bacteria 3528
387 nmdc:mga0rr50_125354_c1 3300050513 Bacteria 2050
388 nmdc:mga0rr50_21406_c1 3300050513 Bacteria 4414
389 nmdc:mga0rr50_2144_c1 3300050513 Bacteria 11031
390 nmdc:mga0rr50_217175_c1 3300050513 Bacteria 1578
391 nmdc:mga0rr50_63574_c1 3300050513 Bacteria 2787
392 nmdc:mga08x19_10108_c1 3300050514 Bacteria 5660
393 nmdc:mga08x19_30469_c1 3300050514 Bacteria 3389
394 nmdc:mga08x19_7519_c1 3300050514 Bacteria 6473
395 nmdc:mga08x19_97015_c1 3300050514 Bacteria 1951
396 nmdc:mga0a205_15122_c1 3300050515 Bacteria 7208
397 nmdc:mga0a205_23329_c1 3300050515 Bacteria 5868
398 nmdc:mga0a205_4603_c1 3300050515 Bacteria 12368
399 nmdc:mga0a205_97301_c1 3300050515 Bacteria 2842
400 Ga0501084_0019033 3300054114 Bacteria 5718
401 Ga0590071_000567 3300059421 Bacteria 10670
402 Ga0590074_000928 3300059423 Bacteria 4585
403 Ga0590075_001923 3300059424 Bacteria 5034
404 Ga0501082_0099543 3300060353 Bacteria 2514
405 Ga0501082_0210259 3300060353 Bacteria 1693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_10429434 Ga0157380_104294341 298
2 3300035172 Ga0373955_0007200 Ga0373955_0007200_1906_2898 299
3 3300036401 Ga0373937_0101739 Ga0373937_0101739_113_1105 299
4 3300046492 Ga0495585_0067685 Ga0495585_0067685_339_1328 300
5 3300046665 Ga0495661_0080565 Ga0495661_0080565_682_1671 300
6 3300025925 Ga0207650_10056998 Ga0207650_100569983 301
7 3300009147 Ga0114129_10453305 Ga0114129_104533052 302
8 3300046491 Ga0495584_0000198 Ga0495584_0000198_33725_34696 302
9 3300050507 nmdc:mga05p37_173510_c1 nmdc:mga05p37_173510_c1_433_1341 302
10 3300005353 Ga0070669_100063470 Ga0070669_1000634702 306
11 3300007076 Ga0075435_100021500 Ga0075435_1000215002 306
12 3300025933 Ga0207706_10233379 Ga0207706_102333792 306
13 3300050513 nmdc:mga0rr50_125354_c1 nmdc:mga0rr50_125354_c1_870_1847 306
14 3300049522 Ga0501299_004292 Ga0501299_004292_137_1132 307
15 3300009148 Ga0105243_10008565 Ga0105243_100085656 308
16 3300046460 Ga0495638_0001351 Ga0495638_0001351_12842_13831 308
17 3300050510 nmdc:mga06r32_97385_c1 nmdc:mga06r32_97385_c1_1310_2332 308
18 3300005330 Ga0070690_100038989 Ga0070690_1000389893 309
19 3300005544 Ga0070686_100000585 Ga0070686_1000005854 309
20 3300005578 Ga0068854_100020086 Ga0068854_1000200863 309
21 3300007076 Ga0075435_100099204 Ga0075435_1000992042 309
22 3300009093 Ga0105240_10147907 Ga0105240_101479073 309
23 3300009174 Ga0105241_10264373 Ga0105241_102643732 309
24 3300025903 Ga0207680_10022242 Ga0207680_100222422 309
25 3300025911 Ga0207654_10167171 Ga0207654_101671712 309
26 3300025913 Ga0207695_10113552 Ga0207695_101135523 309
27 3300025981 Ga0207640_10001726 Ga0207640_100017266 309
28 3300045051 Ga0451576_0035619 Ga0451576_0035619_3314_4318 309
29 3300048905 Ga0496102_0433951 Ga0496102_0433951_190_1185 309
30 3300048909 Ga0496106_0345211 Ga0496106_0345211_93_1088 309
31 3300049743 Ga0501081_0257026 Ga0501081_0257026_231_1175 309
32 3300050513 nmdc:mga0rr50_63574_c1 nmdc:mga0rr50_63574_c1_652_1647 309
33 3300005293 Ga0065715_10222482 Ga0065715_102224821 310
34 3300005456 Ga0070678_100044984 Ga0070678_1000449842 310
35 3300005545 Ga0070695_100005216 Ga0070695_1000052166 310
36 3300009094 Ga0111539_10055042 Ga0111539_100550423 310
37 3300026121 Ga0207683_10070732 Ga0207683_100707322 310
38 3300005334 Ga0068869_100003285 Ga0068869_1000032856 311
39 3300005356 Ga0070674_100315872 Ga0070674_1003158722 311
40 3300005618 Ga0068864_100046984 Ga0068864_1000469842 311
41 3300005842 Ga0068858_100215120 Ga0068858_1002151202 311
42 3300014326 Ga0157380_10037147 Ga0157380_100371472 311
43 3300025942 Ga0207689_10017627 Ga0207689_100176275 311
44 3300005328 Ga0070676_10024120 Ga0070676_100241203 312
45 3300005546 Ga0070696_100049077 Ga0070696_1000490774 312
46 3300025908 Ga0207643_10019756 Ga0207643_100197564 312
47 3300025935 Ga0207709_10092985 Ga0207709_100929852 312
48 3300025942 Ga0207689_10006571 Ga0207689_100065714 312
49 3300034818 Ga0373950_0000125 Ga0373950_0000125_1340_2335 312
50 3300035084 Ga0373928_0002738 Ga0373928_0002738_1027_2022 312
51 3300035090 Ga0373949_0000368 Ga0373949_0000368_7631_8626 312
52 3300035092 Ga0373952_0000893 Ga0373952_0000893_23_1018 312
53 3300035112 Ga0373932_0001404 Ga0373932_0001404_220_1215 312
54 3300035114 Ga0373939_0027740 Ga0373939_0027740_66_1061 312
55 3300035207 Ga0373942_0000385 Ga0373942_0000385_6749_7744 312
56 3300035242 Ga0373962_0004865 Ga0373962_0004865_2186_3181 312
57 3300045051 Ga0451576_0029882 Ga0451576_0029882_4179_5174 312
58 3300050514 nmdc:mga08x19_97015_c1 nmdc:mga08x19_97015_c1_248_1240 312
59 3300049584 Ga0501068_0179013 Ga0501068_0179013_323_1273 313
60 3300006852 Ga0075433_10021577 Ga0075433_100215772 314
61 3300009147 Ga0114129_10081673 Ga0114129_100816733 314
62 3300034819 Ga0373958_0008116 Ga0373958_0008116_633_1628 314
63 3300034820 Ga0373959_0002052 Ga0373959_0002052_391_1386 314
64 3300034957 Ga0373938_0000240 Ga0373938_0000240_4545_5540 314
65 3300035085 Ga0373929_0001025 Ga0373929_0001025_3612_4607 314
66 3300035091 Ga0373951_0006438 Ga0373951_0006438_126_1121 314
67 3300035115 Ga0373941_0000812 Ga0373941_0000812_3323_4318 314
68 3300035121 Ga0373960_0019216 Ga0373960_0019216_731_1726 314
69 3300035241 Ga0373961_0001950 Ga0373961_0001950_1864_2859 314
70 3300005334 Ga0068869_100030821 Ga0068869_1000308213 315
71 3300005338 Ga0068868_100017264 Ga0068868_1000172644 315
72 3300005340 Ga0070689_100018846 Ga0070689_1000188463 315
73 3300005343 Ga0070687_100031176 Ga0070687_1000311761 315
74 3300005354 Ga0070675_100011846 Ga0070675_1000118464 315
75 3300005356 Ga0070674_100010109 Ga0070674_1000101091 315
76 3300005364 Ga0070673_100112912 Ga0070673_1001129122 315
77 3300005438 Ga0070701_10004573 Ga0070701_100045732 315
78 3300005441 Ga0070700_100037813 Ga0070700_1000378133 315
79 3300005456 Ga0070678_100189458 Ga0070678_1001894582 315
80 3300005459 Ga0068867_100012554 Ga0068867_1000125543 315
81 3300005543 Ga0070672_100331416 Ga0070672_1003314162 315
82 3300005544 Ga0070686_100104873 Ga0070686_1001048732 315
83 3300005615 Ga0070702_100007657 Ga0070702_1000076573 315
84 3300005617 Ga0068859_100014769 Ga0068859_1000147696 315
85 3300005844 Ga0068862_100382814 Ga0068862_1003828142 315
86 3300006871 Ga0075434_100004060 Ga0075434_10000406011 315
87 3300006881 Ga0068865_100004343 Ga0068865_1000043436 315
88 3300006914 Ga0075436_100015007 Ga0075436_1000150073 315
89 3300006931 Ga0097620_100014769 Ga0097620_1000147696 315
90 3300007076 Ga0075435_100001012 Ga0075435_10000101213 315
91 3300009147 Ga0114129_10019392 Ga0114129_100193924 315
92 3300009147 Ga0114129_10157141 Ga0114129_101571413 315
93 3300009177 Ga0105248_10021472 Ga0105248_100214723 315
94 3300011119 Ga0105246_10107583 Ga0105246_101075832 315
95 3300013306 Ga0163162_10018582 Ga0163162_100185827 315
96 3300013308 Ga0157375_10028254 Ga0157375_100282544 315
97 3300013308 Ga0157375_10182304 Ga0157375_101823042 315
98 3300014969 Ga0157376_10342884 Ga0157376_103428842 315
99 3300025917 Ga0207660_10148010 Ga0207660_101480102 315
100 3300025918 Ga0207662_10071249 Ga0207662_100712492 315
101 3300025938 Ga0207704_10037717 Ga0207704_100377172 315
102 3300025961 Ga0207712_10060877 Ga0207712_100608772 315
103 3300026075 Ga0207708_10008120 Ga0207708_100081204 315
104 3300026089 Ga0207648_10002841 Ga0207648_100028416 315
105 3300026118 Ga0207675_100045495 Ga0207675_1000454952 315
106 3300026121 Ga0207683_10033336 Ga0207683_100333362 315
107 3300027907 Ga0207428_10076700 Ga0207428_100767002 315
108 3300050507 nmdc:mga05p37_38721_c1 nmdc:mga05p37_38721_c1_1763_2719 315
109 3300050507 nmdc:mga05p37_45501_c1 nmdc:mga05p37_45501_c1_3190_4146 315
110 3300050511 nmdc:mga08y16_31736_c1 nmdc:mga08y16_31736_c1_2079_3035 315
111 3300050512 nmdc:mga0n895_45978_c1 nmdc:mga0n895_45978_c1_2037_2993 315
112 3300050513 nmdc:mga0rr50_217175_c1 nmdc:mga0rr50_217175_c1_489_1445 315
113 3300050514 nmdc:mga08x19_7519_c1 nmdc:mga08x19_7519_c1_1232_2251 315
114 3300006844 Ga0075428_100091272 Ga0075428_1000912723 316
115 3300046460 Ga0495638_0007282 Ga0495638_0007282_6352_7359 316
116 3300050507 nmdc:mga05p37_44628_c1 nmdc:mga05p37_44628_c1_2928_3887 316
117 3300050511 nmdc:mga08y16_289116_c1 nmdc:mga08y16_289116_c1_611_1603 316
118 3300005456 Ga0070678_100153403 Ga0070678_1001534031 317
119 3300006038 Ga0075365_10021507 Ga0075365_100215074 317
120 3300006051 Ga0075364_10074228 Ga0075364_100742282 317
121 3300006195 Ga0075366_10014265 Ga0075366_100142652 317
122 3300006358 Ga0068871_100203561 Ga0068871_1002035612 317
123 3300006844 Ga0075428_100028327 Ga0075428_1000283272 317
124 3300006880 Ga0075429_100032322 Ga0075429_1000323222 317
125 3300009094 Ga0111539_10009089 Ga0111539_100090897 317
126 3300009098 Ga0105245_10159799 Ga0105245_101597991 317
127 3300009098 Ga0105245_10408736 Ga0105245_104087362 317
128 3300009147 Ga0114129_10078599 Ga0114129_100785992 317
129 3300009176 Ga0105242_10003809 Ga0105242_100038092 317
130 3300009177 Ga0105248_10205973 Ga0105248_102059732 317
131 3300027907 Ga0207428_10000139 Ga0207428_1000013963 317
132 3300035241 Ga0373961_0016017 Ga0373961_0016017_118_1080 317
133 3300036401 Ga0373937_0033634 Ga0373937_0033634_2941_3906 317
134 3300036401 Ga0373937_0293048 Ga0373937_0293048_389_1351 317
135 3300046463 Ga0495653_0275344 Ga0495653_0275344_98_1060 317
136 3300046642 Ga0495634_0079585 Ga0495634_0079585_504_1466 317
137 3300046663 Ga0495635_0102989 Ga0495635_0102989_601_1563 317
138 3300046681 Ga0495647_0087838 Ga0495647_0087838_79_1041 317
139 3300046683 Ga0495658_0053077 Ga0495658_0053077_184_1146 317
140 3300048917 Ga0496114_0168472 Ga0496114_0168472_195_1157 317
141 3300050489 nmdc:mga03683_36138_c1 nmdc:mga03683_36138_c1_95_1126 317
142 3300050493 nmdc:mga0k408_26282_c1 nmdc:mga0k408_26282_c1_1546_2577 317
143 3300050507 nmdc:mga05p37_201177_c1 nmdc:mga05p37_201177_c1_730_1761 317
144 3300050507 nmdc:mga05p37_66140_c1 nmdc:mga05p37_66140_c1_1067_2056 317
145 3300050508 nmdc:mga09592_171042_c1 nmdc:mga09592_171042_c1_164_1195 317
146 3300031548 Ga0307408_100085763 Ga0307408_1000857632 318
147 3300005331 Ga0070670_100015938 Ga0070670_1000159384 319
148 3300005518 Ga0070699_100387862 Ga0070699_1003878621 319
149 3300005577 Ga0068857_100004626 Ga0068857_1000046262 319
150 3300005842 Ga0068858_100058087 Ga0068858_1000580872 319
151 3300005843 Ga0068860_100030546 Ga0068860_1000305465 319
152 3300006358 Ga0068871_100085198 Ga0068871_1000851982 319
153 3300006844 Ga0075428_100737843 Ga0075428_1007378431 319
154 3300006847 Ga0075431_100096363 Ga0075431_1000963633 319
155 3300006852 Ga0075433_10107940 Ga0075433_101079402 319
156 3300007076 Ga0075435_100017801 Ga0075435_1000178015 319
157 3300009094 Ga0111539_10852404 Ga0111539_108524041 319
158 3300013297 Ga0157378_10190704 Ga0157378_101907042 319
159 3300025903 Ga0207680_10107837 Ga0207680_101078372 319
160 3300025925 Ga0207650_10008122 Ga0207650_100081224 319
161 3300025933 Ga0207706_10092388 Ga0207706_100923882 319
162 3300025941 Ga0207711_10091860 Ga0207711_100918602 319
163 3300025945 Ga0207679_10063118 Ga0207679_100631181 319
164 3300025986 Ga0207658_10100702 Ga0207658_101007022 319
165 3300026116 Ga0207674_10007413 Ga0207674_100074135 319
166 3300026118 Ga0207675_100238759 Ga0207675_1002387591 319
167 3300026121 Ga0207683_10069801 Ga0207683_100698012 319
168 3300050507 nmdc:mga05p37_22199_c1 nmdc:mga05p37_22199_c1_4188_5156 319
169 3300050507 nmdc:mga05p37_284204_c1 nmdc:mga05p37_284204_c1_899_1882 319
170 3300050510 nmdc:mga06r32_119970_c1 nmdc:mga06r32_119970_c1_109_1101 319
171 3300050512 nmdc:mga0n895_206310_c1 nmdc:mga0n895_206310_c1_855_1886 319
172 3300050512 nmdc:mga0n895_68009_c1 nmdc:mga0n895_68009_c1_62_1039 319
173 3300050513 nmdc:mga0rr50_21406_c1 nmdc:mga0rr50_21406_c1_795_1826 319
174 3300050513 nmdc:mga0rr50_2144_c1 nmdc:mga0rr50_2144_c1_7587_8564 319
175 3300050515 nmdc:mga0a205_97301_c1 nmdc:mga0a205_97301_c1_843_1874 319
176 3300005328 Ga0070676_10011010 Ga0070676_100110103 320
177 3300005341 Ga0070691_10003314 Ga0070691_100033147 320
178 3300005347 Ga0070668_100025055 Ga0070668_1000250552 320
179 3300005353 Ga0070669_100277610 Ga0070669_1002776102 320
180 3300005438 Ga0070701_10002840 Ga0070701_100028402 320
181 3300005440 Ga0070705_100017655 Ga0070705_1000176554 320
182 3300005441 Ga0070700_100018325 Ga0070700_1000183253 320
183 3300005441 Ga0070700_100053682 Ga0070700_1000536822 320
184 3300005444 Ga0070694_100088355 Ga0070694_1000883552 320
185 3300005459 Ga0068867_100136912 Ga0068867_1001369122 320
186 3300005546 Ga0070696_100030738 Ga0070696_1000307384 320
187 3300005548 Ga0070665_100001505 Ga0070665_1000015059 320
188 3300005549 Ga0070704_100008952 Ga0070704_1000089524 320
189 3300005578 Ga0068854_100012648 Ga0068854_1000126482 320
190 3300005615 Ga0070702_100001873 Ga0070702_1000018735 320
191 3300005719 Ga0068861_100032639 Ga0068861_1000326393 320
192 3300005842 Ga0068858_100014483 Ga0068858_1000144833 320
193 3300005842 Ga0068858_100332616 Ga0068858_1003326162 320
194 3300005843 Ga0068860_100440002 Ga0068860_1004400022 320
195 3300006058 Ga0075432_10032072 Ga0075432_100320722 320
196 3300006844 Ga0075428_100052117 Ga0075428_1000521174 320
197 3300006846 Ga0075430_100152471 Ga0075430_1001524712 320
198 3300009094 Ga0111539_10005268 Ga0111539_100052687 320
199 3300009148 Ga0105243_10214961 Ga0105243_102149611 320
200 3300025907 Ga0207645_10010107 Ga0207645_100101073 320
201 3300025933 Ga0207706_10014098 Ga0207706_100140985 320
202 3300025934 Ga0207686_10014955 Ga0207686_100149552 320
203 3300025941 Ga0207711_10066102 Ga0207711_100661022 320
204 3300025981 Ga0207640_10009312 Ga0207640_100093125 320
205 3300026035 Ga0207703_10044093 Ga0207703_100440933 320
206 3300026035 Ga0207703_10265284 Ga0207703_102652842 320
207 3300026075 Ga0207708_10002297 Ga0207708_100022975 320
208 3300026075 Ga0207708_10029910 Ga0207708_100299103 320
209 3300027907 Ga0207428_10043105 Ga0207428_100431054 320
210 3300028379 Ga0268266_10020122 Ga0268266_100201224 320
211 3300028379 Ga0268266_10026781 Ga0268266_100267815 320
212 3300042439 Ga0439464_0000947 Ga0439464_0000947_1952_2947 320
213 3300049514 Ga0501291_009976 Ga0501291_009976_12_1007 320
214 3300049588 Ga0501072_0030002 Ga0501072_0030002_3257_4228 320
215 3300050508 nmdc:mga09592_22383_c1 nmdc:mga09592_22383_c1_2535_3515 320
216 3300050508 nmdc:mga09592_39564_c1 nmdc:mga09592_39564_c1_2460_3455 320
217 3300050509 nmdc:mga0qj67_49492_c1 nmdc:mga0qj67_49492_c1_418_1413 320
218 3300050510 nmdc:mga06r32_121422_c1 nmdc:mga06r32_121422_c1_37_1017 320
219 3300050510 nmdc:mga06r32_32262_c1 nmdc:mga06r32_32262_c1_1522_2517 320
220 3300050511 nmdc:mga08y16_9106_c1 nmdc:mga08y16_9106_c1_1418_2413 320
221 3300005445 Ga0070708_100037617 Ga0070708_1000376173 321
222 3300005467 Ga0070706_100008256 Ga0070706_1000082566 321
223 3300005467 Ga0070706_100013739 Ga0070706_1000137393 321
224 3300005468 Ga0070707_100005838 Ga0070707_1000058386 321
225 3300005471 Ga0070698_100001691 Ga0070698_1000016917 321
226 3300005518 Ga0070699_100008450 Ga0070699_1000084504 321
227 3300005518 Ga0070699_100116873 Ga0070699_1001168733 321
228 3300005536 Ga0070697_100014426 Ga0070697_1000144263 321
229 3300006852 Ga0075433_10007640 Ga0075433_100076404 321
230 3300006852 Ga0075433_10128875 Ga0075433_101288752 321
231 3300006871 Ga0075434_100051462 Ga0075434_1000514623 321
232 3300006871 Ga0075434_100209595 Ga0075434_1002095951 321
233 3300006914 Ga0075436_100024572 Ga0075436_1000245722 321
234 3300009147 Ga0114129_10083107 Ga0114129_100831074 321
235 3300009147 Ga0114129_10299877 Ga0114129_102998772 321
236 3300025910 Ga0207684_10007958 Ga0207684_100079586 321
237 3300025922 Ga0207646_10102936 Ga0207646_101029362 321
238 3300041997 Ga0439431_0004721 Ga0439431_0004721_1888_2880 321
239 3300041999 Ga0439433_0003686 Ga0439433_0003686_333_1325 321
240 3300042002 Ga0439442_024884 Ga0439442_024884_218_1210 321
241 3300050507 nmdc:mga05p37_211576_c1 nmdc:mga05p37_211576_c1_894_1883 321
242 3300050512 nmdc:mga0n895_101116_c1 nmdc:mga0n895_101116_c1_1688_2677 321
243 3300050514 nmdc:mga08x19_10108_c1 nmdc:mga08x19_10108_c1_3095_4084 321
244 3300050515 nmdc:mga0a205_4603_c1 nmdc:mga0a205_4603_c1_1063_2052 321
245 3300005353 Ga0070669_100273922 Ga0070669_1002739221 322
246 3300005466 Ga0070685_10087801 Ga0070685_100878011 322
247 3300005618 Ga0068864_100065640 Ga0068864_1000656404 322
248 3300005841 Ga0068863_100137801 Ga0068863_1001378012 322
249 3300006042 Ga0075368_10011373 Ga0075368_100113733 322
250 3300006178 Ga0075367_10009198 Ga0075367_100091984 322
251 3300006195 Ga0075366_10013686 Ga0075366_100136862 322
252 3300006844 Ga0075428_100156810 Ga0075428_1001568102 322
253 3300009101 Ga0105247_10007049 Ga0105247_100070497 322
254 3300009177 Ga0105248_10003548 Ga0105248_1000354812 322
255 3300014325 Ga0163163_10017244 Ga0163163_100172442 322
256 3300014968 Ga0157379_10147679 Ga0157379_101476792 322
257 3300025900 Ga0207710_10010384 Ga0207710_100103842 322
258 3300025923 Ga0207681_10287982 Ga0207681_102879822 322
259 3300025972 Ga0207668_10324296 Ga0207668_103242962 322
260 3300026035 Ga0207703_10045359 Ga0207703_100453592 322
261 3300026095 Ga0207676_10041208 Ga0207676_100412082 322
262 3300026116 Ga0207674_10199700 Ga0207674_101997002 322
263 3300026118 Ga0207675_100036360 Ga0207675_1000363602 322
264 3300028380 Ga0268265_10235015 Ga0268265_102350152 322
265 3300028381 Ga0268264_10224045 Ga0268264_102240452 322
266 3300048907 Ga0496104_0125674 Ga0496104_0125674_1295_2344 322
267 3300048911 Ga0496108_0030105 Ga0496108_0030105_833_1882 322
268 3300048915 Ga0496112_0060873 Ga0496112_0060873_1461_2510 322
269 3300050494 nmdc:mga06z11_9707_c1 nmdc:mga06z11_9707_c1_24_1019 322
270 3300050515 nmdc:mga0a205_23329_c1 nmdc:mga0a205_23329_c1_3227_4276 322
271 3300059421 Ga0590071_000567 Ga0590071_000567_6066_7061 322
272 3300059423 Ga0590074_000928 Ga0590074_000928_3145_4140 322
273 3300059424 Ga0590075_001923 Ga0590075_001923_2755_3750 322
274 3300005445 Ga0070708_100147750 Ga0070708_1001477502 323
275 3300005467 Ga0070706_100181447 Ga0070706_1001814472 323
276 3300005468 Ga0070707_100004281 Ga0070707_1000042812 323
277 3300005468 Ga0070707_100031996 Ga0070707_1000319962 323
278 3300005545 Ga0070695_100006225 Ga0070695_1000062254 323
279 3300005549 Ga0070704_100066019 Ga0070704_1000660192 323
280 3300005617 Ga0068859_100001904 Ga0068859_10000190422 323
281 3300005617 Ga0068859_100716570 Ga0068859_1007165701 323
282 3300005844 Ga0068862_100020698 Ga0068862_1000206986 323
283 3300006852 Ga0075433_10034152 Ga0075433_100341523 323
284 3300006871 Ga0075434_100026273 Ga0075434_1000262735 323
285 3300006914 Ga0075436_100054461 Ga0075436_1000544612 323
286 3300006931 Ga0097620_100001904 Ga0097620_10000190422 323
287 3300009098 Ga0105245_10133190 Ga0105245_101331903 323
288 3300009147 Ga0114129_10001468 Ga0114129_1000146816 323
289 3300009147 Ga0114129_10026433 Ga0114129_100264336 323
290 3300014325 Ga0163163_10154419 Ga0163163_101544192 323
291 3300025885 Ga0207653_10027562 Ga0207653_100275622 323
292 3300025910 Ga0207684_10149994 Ga0207684_101499942 323
293 3300025922 Ga0207646_10005054 Ga0207646_100050544 323
294 3300025922 Ga0207646_10067182 Ga0207646_100671822 323
295 3300025922 Ga0207646_10073279 Ga0207646_100732794 323
296 3300025926 Ga0207659_10114814 Ga0207659_101148142 323
297 3300026118 Ga0207675_100064598 Ga0207675_1000645982 323
298 3300048915 Ga0496112_0162360 Ga0496112_0162360_1034_2047 323
299 3300049583 Ga0501067_0099202 Ga0501067_0099202_331_1317 323
300 3300050507 nmdc:mga05p37_687_c1 nmdc:mga05p37_687_c1_21028_22017 323
301 3300050512 nmdc:mga0n895_2922_c1 nmdc:mga0n895_2922_c1_7342_8334 323
302 3300050512 nmdc:mga0n895_53142_c1 nmdc:mga0n895_53142_c1_2404_3393 323
303 3300050515 nmdc:mga0a205_15122_c1 nmdc:mga0a205_15122_c1_4287_5276 323
304 3300005459 Ga0068867_100129260 Ga0068867_1001292602 324
305 3300005518 Ga0070699_100006167 Ga0070699_10000616710 324
306 3300005617 Ga0068859_100056624 Ga0068859_1000566244 324
307 3300005842 Ga0068858_100067543 Ga0068858_1000675432 324
308 3300005937 Ga0081455_10014354 Ga0081455_100143548 324
309 3300006844 Ga0075428_100248229 Ga0075428_1002482292 324
310 3300006852 Ga0075433_10068664 Ga0075433_100686642 324
311 3300006881 Ga0068865_100020611 Ga0068865_1000206112 324
312 3300006931 Ga0097620_100056624 Ga0097620_1000566244 324
313 3300009147 Ga0114129_10012665 Ga0114129_100126659 324
314 3300025986 Ga0207658_10268505 Ga0207658_102685052 324
315 3300026089 Ga0207648_10154883 Ga0207648_101548832 324
316 3300048910 Ga0496107_0283209 Ga0496107_0283209_208_1194 324
317 3300050514 nmdc:mga08x19_30469_c1 nmdc:mga08x19_30469_c1_1706_2710 324
318 3300005719 Ga0068861_100020857 Ga0068861_1000208572 325
319 3300005985 Ga0081539_10004763 Ga0081539_100047639 325
320 3300006846 Ga0075430_100143036 Ga0075430_1001430362 325
321 3300006847 Ga0075431_100074810 Ga0075431_1000748103 325
322 3300006847 Ga0075431_100210859 Ga0075431_1002108592 325
323 3300006880 Ga0075429_100049630 Ga0075429_1000496304 325
324 3300007076 Ga0075435_100001364 Ga0075435_1000013648 325
325 3300009094 Ga0111539_10032902 Ga0111539_100329025 325
326 3300009147 Ga0114129_10002276 Ga0114129_1000227615 325
327 3300009147 Ga0114129_10057540 Ga0114129_100575403 325
328 3300009147 Ga0114129_10088590 Ga0114129_100885904 325
329 3300025932 Ga0207690_10032845 Ga0207690_100328452 325
330 3300025936 Ga0207670_10021297 Ga0207670_100212973 325
331 3300026118 Ga0207675_100047229 Ga0207675_1000472292 325
332 3300027907 Ga0207428_10034923 Ga0207428_100349233 325
333 3300031548 Ga0307408_100334721 Ga0307408_1003347212 325
334 3300031548 Ga0307408_100407937 Ga0307408_1004079371 325
335 3300031901 Ga0307406_10072826 Ga0307406_100728262 325
336 3300031911 Ga0307412_10139758 Ga0307412_101397582 325
337 3300031911 Ga0307412_10238720 Ga0307412_102387202 325
338 3300032005 Ga0307411_10080465 Ga0307411_100804652 325
339 3300049572 Ga0501036_0126577 Ga0501036_0126577_338_1330 325
340 3300049576 Ga0501040_0141848 Ga0501040_0141848_593_1585 325
341 3300049578 Ga0501042_0106058 Ga0501042_0106058_94_1086 325
342 3300049587 Ga0501071_0040818 Ga0501071_0040818_465_1457 325
343 3300049590 Ga0501074_0070230 Ga0501074_0070230_553_1545 325
344 3300049591 Ga0501075_0024767 Ga0501075_0024767_3228_4220 325
345 3300049591 Ga0501075_0051048 Ga0501075_0051048_756_1748 325
346 3300049592 Ga0501076_0032790 Ga0501076_0032790_1689_2681 325
347 3300049592 Ga0501076_0149776 Ga0501076_0149776_643_1635 325
348 3300049661 Ga0501217_012787 Ga0501217_012787_112_1107 325
349 3300049741 Ga0501079_0050405 Ga0501079_0050405_1316_2308 325
350 3300049742 Ga0501080_0225960 Ga0501080_0225960_91_1083 325
351 3300049743 Ga0501081_0081745 Ga0501081_0081745_69_1061 325
352 3300049824 Ga0501045_0092792 Ga0501045_0092792_1078_2070 325
353 3300049824 Ga0501045_0169376 Ga0501045_0169376_95_1087 325
354 3300050507 nmdc:mga05p37_43831_c1 nmdc:mga05p37_43831_c1_1938_2924 325
355 3300050508 nmdc:mga09592_112340_c1 nmdc:mga09592_112340_c1_1108_2103 325
356 3300050511 nmdc:mga08y16_17853_c2 nmdc:mga08y16_17853_c2_2319_3305 325
357 3300054114 Ga0501084_0019033 Ga0501084_0019033_2786_3778 325
358 3300060353 Ga0501082_0099543 Ga0501082_0099543_202_1194 325
359 3300060353 Ga0501082_0210259 Ga0501082_0210259_228_1220 325
360 3300005353 Ga0070669_100007157 Ga0070669_1000071573 326
361 3300005355 Ga0070671_100023328 Ga0070671_1000233282 326
362 3300005364 Ga0070673_100341090 Ga0070673_1003410902 326
363 3300005367 Ga0070667_100016931 Ga0070667_1000169313 326
364 3300005841 Ga0068863_100010821 Ga0068863_1000108215 326
365 3300005844 Ga0068862_100315026 Ga0068862_1003150262 326
366 3300006358 Ga0068871_100008766 Ga0068871_1000087663 326
367 3300006881 Ga0068865_100044828 Ga0068865_1000448282 326
368 3300009093 Ga0105240_10109134 Ga0105240_101091342 326
369 3300009147 Ga0114129_10189190 Ga0114129_101891903 326
370 3300009148 Ga0105243_10211655 Ga0105243_102116551 326
371 3300009176 Ga0105242_10000992 Ga0105242_1000099221 326
372 3300009177 Ga0105248_10016809 Ga0105248_100168092 326
373 3300009177 Ga0105248_10330153 Ga0105248_103301532 326
374 3300013296 Ga0157374_10009099 Ga0157374_100090994 326
375 3300014968 Ga0157379_10083137 Ga0157379_100831372 326
376 3300014969 Ga0157376_10037826 Ga0157376_100378264 326
377 3300025934 Ga0207686_10005858 Ga0207686_100058582 326
378 3300026088 Ga0207641_10014633 Ga0207641_100146332 326
379 3300048917 Ga0496114_0137248 Ga0496114_0137248_201_1214 326
380 3300048918 Ga0496115_0132510 Ga0496115_0132510_744_1757 326
381 3300050507 nmdc:mga05p37_69565_c1 nmdc:mga05p37_69565_c1_303_1307 326
382 3300005444 Ga0070694_100009094 Ga0070694_1000090942 327
383 3300005459 Ga0068867_100050909 Ga0068867_1000509092 327
384 3300005468 Ga0070707_100016681 Ga0070707_1000166812 327
385 3300005471 Ga0070698_100336145 Ga0070698_1003361452 327
386 3300005543 Ga0070672_100259931 Ga0070672_1002599312 327
387 3300005545 Ga0070695_100325397 Ga0070695_1003253971 327
388 3300005546 Ga0070696_100101982 Ga0070696_1001019822 327
389 3300005546 Ga0070696_100166734 Ga0070696_1001667342 327
390 3300005549 Ga0070704_100335060 Ga0070704_1003350602 327
391 3300006914 Ga0075436_100044138 Ga0075436_1000441384 327
392 3300007076 Ga0075435_100016808 Ga0075435_1000168082 327
393 3300009147 Ga0114129_10019888 Ga0114129_100198883 327
394 3300009148 Ga0105243_10011158 Ga0105243_100111584 327
395 3300009553 Ga0105249_10192770 Ga0105249_101927702 327
396 3300014326 Ga0157380_10029155 Ga0157380_100291553 327
397 3300025937 Ga0207669_10004265 Ga0207669_100042655 327
398 3300025938 Ga0207704_10156812 Ga0207704_101568122 327
399 3300025961 Ga0207712_10096796 Ga0207712_100967962 327
400 3300026089 Ga0207648_10025986 Ga0207648_100259862 327
401 3300050510 nmdc:mga06r32_147524_c1 nmdc:mga06r32_147524_c1_1197_2219 328
402 2162886006 SwRhRL3b_contig_494398 SwRhRL3b_0584.00000470 336
403 3300009553 Ga0105249_10060591 Ga0105249_100605912 336
404 3300014326 Ga0157380_10031855 Ga0157380_100318552 336
405 3300026075 Ga0207708_10145936 Ga0207708_101459362 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

73

336

0.97

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

70

325

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ksm-assembly3.cif.gz_B crystal structure of abc-type sugar transport system, periplasmic component from hahella chejuensis 0.9493 30 306
6gq0-assembly1.cif.gz_A crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus 0.9472 27 313
2gx6-assembly1.cif.gz_A rational stabilization of e. coli ribose binding protein 0.9452 27 307
3ksm-assembly2.cif.gz_A crystal structure of abc-type sugar transport system, periplasmic component from hahella chejuensis 0.9424 29 306
3ksm-assembly3.cif.gz_B crystal structure of abc-type sugar transport system, periplasmic component from hahella chejuensis 0.9393 30 306
ID Description Score Start End Superfamily
3ksmB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9653 30 128 3.40.50.2300
6dspB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9632 29 130 3.40.50.2300
af_P39265_27_132_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9594 31 124 3.40.50.2300
af_P76142_29_128_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9578 30 128 3.40.50.2300
5dteD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9389 27 124 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3M1X2L0-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9652 20 318 GO:0030246
GO:0030313
AF-A0A2D5ISX9-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9614 61 321 GO:0030246
GO:0030313
AF-A0A7V2TS05-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9595 237 322 GO:0030246
GO:0030313
AF-A0A536JKV2-F1-model_v4 Substrate-binding domain-containing protein 0.9583 26 319 GO:0030246
GO:0030313
AF-A0A2V9IGR4-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9553 19 324 GO:0030246
GO:0030313

Feature Viewer

pLDDT pTM Quality
88.79 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map