F435898

General Info

Members Datasets Scaffolds Average Seq Length
405 188 810 153

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_101453115|Ga0068856_1014531151
Length 177
Sequence LTSFRDSADVDAQARLDTFIDKYSPEVAGEARQALAFLNARLPGAFRLVYDNYNALVVGFGTSEKVGGIILSIALYPRYVTLFFLKGTSLPDPQGLLQGGGVTVRSVRLSPISRLETAEVAALIDAAVAQASPLSAGEGPLIIKSISAKQRSRRPKSERPRFFLCVSKSRTADSSSG

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.67
Rhizosphere 92.35
Stem 0
Stem Tuber 0
Unclassified 4.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_101453115 3300005614 Bacteria 700
2 JGI24737J22298_10068407 3300001990 Bacteria 1062
3 JGI24743J22301_10013624 3300001991 Bacteria 1491
4 JGI24743J22301_10037847 3300001991 Bacteria 962
5 Ga0065712_10000331 3300005290 Bacteria 19331
6 Ga0065712_10253958 3300005290 Bacteria 953
7 Ga0065715_10089542 3300005293 Bacteria 9611
8 Ga0070658_10000001 3300005327 Bacteria 856789
9 Ga0070658_10226606 3300005327 Bacteria 1582
10 Ga0070658_10442234 3300005327 Bacteria 1120
11 Ga0070658_10801950 3300005327 Bacteria 818
12 Ga0070658_11435698 3300005327 Unclassified 599
13 Ga0070676_10239676 3300005328 Bacteria 1206
14 Ga0070676_10316687 3300005328 Bacteria 1062
15 Ga0070676_10369936 3300005328 Bacteria 990
16 Ga0070683_100315947 3300005329 Bacteria 1486
17 Ga0070683_100925843 3300005329 Unclassified 836
18 Ga0070683_101465864 3300005329 Unclassified 656
19 Ga0070690_100433738 3300005330 Bacteria 971
20 Ga0070670_100003765 3300005331 Bacteria 12627
21 Ga0070670_100010136 3300005331 Bacteria 8038
22 Ga0070670_100284387 3300005331 Bacteria 1444
23 Ga0070670_100650587 3300005331 Bacteria 945
24 Ga0070677_10074184 3300005333 Bacteria 1439
25 Ga0070677_10260201 3300005333 Bacteria 865
26 Ga0068869_100176974 3300005334 Bacteria 1670
27 Ga0070666_10066550 3300005335 Bacteria 2445
28 Ga0070666_10220839 3300005335 Bacteria 1337
29 Ga0070666_10545803 3300005335 Bacteria 843
30 Ga0070666_10768118 3300005335 Bacteria 709
31 Ga0070680_100011939 3300005336 Bacteria 6739
32 Ga0070682_100493848 3300005337 Bacteria 947
33 Ga0068868_100052653 3300005338 Bacteria 3204
34 Ga0068868_100089457 3300005338 Bacteria 2479
35 Ga0068868_100117818 3300005338 Bacteria 2164
36 Ga0068868_100171634 3300005338 Bacteria 1795
37 Ga0070660_100000862 3300005339 Bacteria 20203
38 Ga0070660_100138459 3300005339 Bacteria 1951
39 Ga0070660_100545607 3300005339 Bacteria 967
40 Ga0070660_100759970 3300005339 Bacteria 814
41 Ga0070689_101338942 3300005340 Bacteria 646
42 Ga0070661_100021154 3300005344 Bacteria 4644
43 Ga0070661_100103001 3300005344 Bacteria 2125
44 Ga0070661_100279577 3300005344 Bacteria 1294
45 Ga0070661_101279004 3300005344 Bacteria 615
46 Ga0070668_100582903 3300005347 Bacteria 977
47 Ga0070669_100215193 3300005353 Bacteria 1517
48 Ga0070675_100009993 3300005354 Bacteria 7398
49 Ga0070675_100041218 3300005354 Bacteria 3771
50 Ga0070675_100103265 3300005354 Bacteria 2403
51 Ga0070675_100183790 3300005354 Bacteria 1809
52 Ga0070675_100188403 3300005354 Bacteria 1786
53 Ga0070675_100870699 3300005354 Bacteria 825
54 Ga0070675_101073283 3300005354 Bacteria 740
55 Ga0070671_100466503 3300005355 Bacteria 1084
56 Ga0070671_100800748 3300005355 Bacteria 820
57 Ga0070674_100018195 3300005356 Bacteria 4437
58 Ga0070673_100042723 3300005364 Bacteria 3497
59 Ga0070673_100062405 3300005364 Bacteria 2960
60 Ga0070673_100219901 3300005364 Bacteria 1643
61 Ga0070688_100012971 3300005365 Bacteria 4688
62 Ga0070659_100250993 3300005366 Bacteria 1466
63 Ga0070659_100361430 3300005366 Bacteria 1220
64 Ga0070659_100523589 3300005366 Bacteria 1012
65 Ga0070659_100525502 3300005366 Bacteria 1011
66 Ga0070667_100134595 3300005367 Bacteria 2160
67 Ga0070667_100301190 3300005367 Bacteria 1444
68 Ga0070667_100346673 3300005367 Bacteria 1344
69 Ga0070667_100470616 3300005367 Bacteria 1150
70 Ga0070667_100544179 3300005367 Bacteria 1067
71 Ga0070714_100340467 3300005435 Bacteria 1407
72 Ga0070663_100013864 3300005455 Bacteria 5156
73 Ga0070663_100091040 3300005455 Bacteria 2259
74 Ga0070663_100266775 3300005455 Bacteria 1360
75 Ga0070678_100002055 3300005456 Bacteria 10907
76 Ga0070678_100093936 3300005456 Bacteria 2307
77 Ga0070678_100146588 3300005456 Bacteria 1896
78 Ga0070678_100374284 3300005456 Bacteria 1231
79 Ga0070662_100099868 3300005457 Bacteria 2195
80 Ga0070662_100132189 3300005457 Bacteria 1925
81 Ga0070662_100236462 3300005457 Bacteria 1463
82 Ga0070681_11311053 3300005458 Bacteria 647
83 Ga0068867_100113370 3300005459 Bacteria 2086
84 Ga0068867_100151577 3300005459 Bacteria 1821
85 Ga0068867_100356677 3300005459 Bacteria 1222
86 Ga0070707_101276827 3300005468 Bacteria 700
87 Ga0070679_100259027 3300005530 Bacteria 1695
88 Ga0070684_100823562 3300005535 Bacteria 868
89 Ga0070684_101907189 3300005535 Unclassified 561
90 Ga0068853_100378492 3300005539 Bacteria 1322
91 Ga0070672_100003314 3300005543 Bacteria 10425
92 Ga0070672_100182219 3300005543 Bacteria 1750
93 Ga0070686_101524112 3300005544 Bacteria 564
94 Ga0070696_100279555 3300005546 Unclassified 1272
95 Ga0070693_100024008 3300005547 Bacteria 3265
96 Ga0070693_100054067 3300005547 Bacteria 2307
97 Ga0070693_100177824 3300005547 Bacteria 1368
98 Ga0070693_100259035 3300005547 Bacteria 1156
99 Ga0070665_100043533 3300005548 Bacteria 4512
100 Ga0070665_100214728 3300005548 Bacteria 1925
101 Ga0068855_100063522 3300005563 Bacteria 4309
102 Ga0068855_100421637 3300005563 Bacteria 1460
103 Ga0068855_101075374 3300005563 Unclassified 842
104 Ga0070664_100018503 3300005564 Bacteria 5725
105 Ga0070664_100128864 3300005564 Bacteria 2221
106 Ga0070664_100185568 3300005564 Bacteria 1851
107 Ga0070664_100955155 3300005564 Bacteria 805
108 Ga0068857_100324033 3300005577 Bacteria 1423
109 Ga0068854_100013859 3300005578 Bacteria 5302
110 Ga0068854_100034924 3300005578 Bacteria 3517
111 Ga0068854_100193591 3300005578 Bacteria 1594
112 Ga0070702_100160517 3300005615 Unclassified 1453
113 Ga0068852_100114262 3300005616 Bacteria 2460
114 Ga0068852_100734233 3300005616 Bacteria 999
115 Ga0068852_100791557 3300005616 Bacteria 962
116 Ga0068852_100821215 3300005616 Bacteria 944
117 Ga0068859_100237075 3300005617 Bacteria 1913
118 Ga0068864_100004905 3300005618 Bacteria 10962
119 Ga0068864_100022589 3300005618 Bacteria 5275
120 Ga0068864_100278514 3300005618 Bacteria 1560
121 Ga0068864_100279632 3300005618 Bacteria 1557
122 Ga0068864_100443539 3300005618 Bacteria 1240
123 Ga0068864_101354200 3300005618 Bacteria 713
124 Ga0068866_10014247 3300005718 Bacteria 3506
125 Ga0068863_100029526 3300005841 Bacteria 5234
126 Ga0068863_100069207 3300005841 Bacteria 3337
127 Ga0068858_100002681 3300005842 Bacteria 17926
128 Ga0068860_101003030 3300005843 Bacteria 853
129 Ga0068860_101416607 3300005843 Bacteria 716
130 Ga0068862_100804080 3300005844 Bacteria 918
131 Ga0070717_10506192 3300006028 Bacteria 1092
132 Ga0070716_100136384 3300006173 Unclassified 1559
133 Ga0097621_100018075 3300006237 Bacteria 5375
134 Ga0097621_100929750 3300006237 Bacteria 811
135 Ga0068871_100006672 3300006358 Bacteria 8186
136 Ga0068871_101308483 3300006358 Bacteria 682
137 Ga0075431_101869858 3300006847 Bacteria 556
138 Ga0075434_100001049 3300006871 Bacteria 22542
139 Ga0075434_100030195 3300006871 Bacteria 5336
140 Ga0068865_101521929 3300006881 Bacteria 600
141 Ga0075436_100001088 3300006914 Bacteria 18303
142 Ga0075436_100001106 3300006914 Bacteria 18215
143 Ga0075436_100116048 3300006914 Bacteria 1871
144 Ga0075436_100548396 3300006914 Bacteria 848
145 Ga0075436_100583535 3300006914 Bacteria 822
146 Ga0097620_100237081 3300006931 Bacteria 1913
147 Ga0075435_100000213 3300007076 Bacteria 35518
148 Ga0075435_100000632 3300007076 Bacteria 21607
149 Ga0075435_100529907 3300007076 Bacteria 1019
150 Ga0105240_10820492 3300009093 Bacteria 1006
151 Ga0111539_10880304 3300009094 Bacteria 1042
152 Ga0105243_10268407 3300009148 Bacteria 1531
153 Ga0105241_10469993 3300009174 Bacteria 1116
154 Ga0105241_11040787 3300009174 Bacteria 768
155 Ga0105242_10538874 3300009176 Bacteria 1117
156 Ga0105248_10069391 3300009177 Bacteria 3957
157 Ga0105248_10168037 3300009177 Bacteria 2472
158 Ga0105248_10410117 3300009177 Bacteria 1525
159 Ga0105248_10672133 3300009177 Bacteria 1168
160 Ga0105248_12468718 3300009177 Bacteria 592
161 Ga0105238_10443107 3300009551 Bacteria 1295
162 Ga0105249_10042746 3300009553 Bacteria 4123
163 Ga0105249_10946059 3300009553 Bacteria 929
164 Ga0105239_12784976 3300010375 Bacteria 571
165 Ga0105246_10476892 3300011119 Bacteria 1054
166 Ga0157373_10117142 3300013100 Bacteria 1872
167 Ga0157373_10168402 3300013100 Bacteria 1542
168 Ga0157373_10684490 3300013100 Bacteria 751
169 Ga0157373_11321258 3300013100 Bacteria 546
170 Ga0157371_10054189 3300013102 Bacteria 2849
171 Ga0157371_10149173 3300013102 Bacteria 1667
172 Ga0157371_10451723 3300013102 Bacteria 945
173 Ga0157371_10496978 3300013102 Bacteria 900
174 Ga0157371_10632571 3300013102 Bacteria 798
175 Ga0157370_10001258 3300013104 Bacteria 31653
176 Ga0157370_10042854 3300013104 Bacteria 4358
177 Ga0157370_10126071 3300013104 Bacteria 2389
178 Ga0157369_10086608 3300013105 Bacteria 3345
179 Ga0157369_10108262 3300013105 Bacteria 2956
180 Ga0157374_10002117 3300013296 Bacteria 16704
181 Ga0157374_10008502 3300013296 Bacteria 8781
182 Ga0157374_12005888 3300013296 Bacteria 605
183 Ga0157378_10077621 3300013297 Bacteria 2994
184 Ga0157378_10286061 3300013297 Bacteria 1591
185 Ga0157378_10329552 3300013297 Bacteria 1485
186 Ga0157378_11890641 3300013297 Unclassified 646
187 Ga0163162_10048011 3300013306 Bacteria 4277
188 Ga0163162_10059996 3300013306 Bacteria 3837
189 Ga0157372_10700800 3300013307 Bacteria 1178
190 Ga0157375_10002436 3300013308 Bacteria 16100
191 Ga0157375_10009604 3300013308 Bacteria 8498
192 Ga0157375_10034173 3300013308 Bacteria 4841
193 Ga0157375_12153202 3300013308 Bacteria 664
194 Ga0163163_10030946 3300014325 Bacteria 5161
195 Ga0157380_11424813 3300014326 Unclassified 744
196 Ga0157377_10137536 3300014745 Unclassified 1498
197 Ga0157379_10172270 3300014968 Bacteria 1954
198 Ga0157379_10683563 3300014968 Bacteria 962
199 Ga0157376_10126205 3300014969 Bacteria 2276
200 Ga0213872_10064582 3300021361 Bacteria 1654
201 Ga0213876_10000332 3300021384 Bacteria 41214
202 Ga0213876_10010995 3300021384 Bacteria 4845
203 Ga0207697_10098732 3300025315 Bacteria 1243
204 Ga0207697_10184573 3300025315 Bacteria 915
205 Ga0207682_10006199 3300025893 Bacteria 4833
206 Ga0207642_10204889 3300025899 Bacteria 1092
207 Ga0207680_10034145 3300025903 Bacteria 2908
208 Ga0207680_10043797 3300025903 Bacteria 2627
209 Ga0207680_10332210 3300025903 Bacteria 1065
210 Ga0207645_10060995 3300025907 Bacteria 2409
211 Ga0207645_10166361 3300025907 Bacteria 1444
212 Ga0207645_10235075 3300025907 Bacteria 1210
213 Ga0207705_10000002 3300025909 Bacteria 2046852
214 Ga0207705_10345893 3300025909 Bacteria 1145
215 Ga0207705_10461168 3300025909 Bacteria 986
216 Ga0207684_10504062 3300025910 Bacteria 1037
217 Ga0207707_10601905 3300025912 Unclassified 930
218 Ga0207660_10018588 3300025917 Bacteria 4635
219 Ga0207660_11006870 3300025917 Bacteria 679
220 Ga0207657_10011456 3300025919 Bacteria 8805
221 Ga0207657_10173373 3300025919 Bacteria 1747
222 Ga0207657_10216508 3300025919 Bacteria 1536
223 Ga0207657_10649826 3300025919 Bacteria 821
224 Ga0207649_10021113 3300025920 Bacteria 3743
225 Ga0207649_10078414 3300025920 Bacteria 2131
226 Ga0207649_10106767 3300025920 Bacteria 1863
227 Ga0207649_11320990 3300025920 Archaea 570
228 Ga0207652_10611242 3300025921 Bacteria 977
229 Ga0207652_10711329 3300025921 Bacteria 896
230 Ga0207650_10004449 3300025925 Bacteria 9574
231 Ga0207650_10016499 3300025925 Bacteria 5164
232 Ga0207650_10105505 3300025925 Bacteria 2175
233 Ga0207659_10090140 3300025926 Bacteria 2288
234 Ga0207659_10097927 3300025926 Bacteria 2204
235 Ga0207659_10135335 3300025926 Bacteria 1907
236 Ga0207659_10149827 3300025926 Bacteria 1821
237 Ga0207659_10751418 3300025926 Bacteria 837
238 Ga0207659_11327304 3300025926 Bacteria 617
239 Ga0207687_10255781 3300025927 Bacteria 1394
240 Ga0207687_11178144 3300025927 Bacteria 658
241 Ga0207664_10650476 3300025929 Bacteria 947
242 Ga0207644_10005983 3300025931 Bacteria 7929
243 Ga0207644_10019287 3300025931 Bacteria 4624
244 Ga0207644_10033759 3300025931 Bacteria 3579
245 Ga0207690_10485354 3300025932 Bacteria 998
246 Ga0207706_10004181 3300025933 Bacteria 13592
247 Ga0207706_10196914 3300025933 Bacteria 1767
248 Ga0207669_10079617 3300025937 Bacteria 2092
249 Ga0207669_10084130 3300025937 Bacteria 2049
250 Ga0207704_10118098 3300025938 Bacteria 1808
251 Ga0207704_10192108 3300025938 Bacteria 1486
252 Ga0207665_10030374 3300025939 Bacteria 3570
253 Ga0207691_10002062 3300025940 Bacteria 19627
254 Ga0207691_10186783 3300025940 Bacteria 1809
255 Ga0207691_10260232 3300025940 Bacteria 1496
256 Ga0207691_10274785 3300025940 Bacteria 1450
257 Ga0207691_11355102 3300025940 Unclassified 586
258 Ga0207711_10028294 3300025941 Bacteria 4715
259 Ga0207711_10104306 3300025941 Bacteria 2512
260 Ga0207711_10188195 3300025941 Bacteria 1880
261 Ga0207689_10178442 3300025942 Bacteria 1752
262 Ga0207689_10228601 3300025942 Bacteria 1538
263 Ga0207661_10509803 3300025944 Bacteria 1099
264 Ga0207661_11772755 3300025944 Bacteria 563
265 Ga0207661_11818809 3300025944 Bacteria 555
266 Ga0207679_10011221 3300025945 Bacteria 5791
267 Ga0207679_10391594 3300025945 Bacteria 1220
268 Ga0207679_10478198 3300025945 Bacteria 1108
269 Ga0207667_10112744 3300025949 Bacteria 2804
270 Ga0207667_10496714 3300025949 Bacteria 1238
271 Ga0207667_10586845 3300025949 Bacteria 1125
272 Ga0207667_11280820 3300025949 Archaea 710
273 Ga0207651_10006617 3300025960 Bacteria 6089
274 Ga0207651_10014585 3300025960 Bacteria 4543
275 Ga0207651_10099180 3300025960 Bacteria 2156
276 Ga0207668_10576799 3300025972 Bacteria 977
277 Ga0207658_10060336 3300025986 Bacteria 2829
278 Ga0207658_10270912 3300025986 Bacteria 1451
279 Ga0207658_10737125 3300025986 Bacteria 892
280 Ga0207677_10069141 3300026023 Bacteria 2482
281 Ga0207677_10229042 3300026023 Bacteria 1496
282 Ga0207677_10396092 3300026023 Bacteria 1170
283 Ga0207677_10510394 3300026023 Bacteria 1041
284 Ga0207703_10040111 3300026035 Bacteria 3745
285 Ga0207639_10275253 3300026041 Bacteria 1478
286 Ga0207678_10017428 3300026067 Bacteria 6309
287 Ga0207678_10292977 3300026067 Bacteria 1398
288 Ga0207678_10296454 3300026067 Bacteria 1389
289 Ga0207708_10551441 3300026075 Bacteria 972
290 Ga0207702_10117684 3300026078 Bacteria 2373
291 Ga0207702_11258305 3300026078 Bacteria 734
292 Ga0207641_10004486 3300026088 Bacteria 12077
293 Ga0207648_10016932 3300026089 Bacteria 6642
294 Ga0207648_10566101 3300026089 Bacteria 1045
295 Ga0207676_10003805 3300026095 Bacteria 10670
296 Ga0207676_10252442 3300026095 Bacteria 1588
297 Ga0207676_10359814 3300026095 Bacteria 1348
298 Ga0207676_10776406 3300026095 Bacteria 933
299 Ga0207676_10990108 3300026095 Bacteria 828
300 Ga0207675_100719520 3300026118 Bacteria 1008
301 Ga0207683_10005966 3300026121 Bacteria 10436
302 Ga0207683_10008629 3300026121 Bacteria 8714
303 Ga0207683_10216485 3300026121 Bacteria 1745
304 Ga0207683_10343920 3300026121 Bacteria 1368
305 Ga0207698_10281069 3300026142 Bacteria 1539
306 Ga0207698_10325403 3300026142 Bacteria 1442
307 Ga0207698_10618502 3300026142 Bacteria 1070
308 Ga0207698_11633469 3300026142 Bacteria 660
309 Ga0268266_10025926 3300028379 Bacteria 4987
310 Ga0268266_10030425 3300028379 Bacteria 4587
311 Ga0268266_10641907 3300028379 Bacteria 1021
312 Ga0268264_10930306 3300028381 Bacteria 874
313 Ga0395900_0299000 3300037418 Bacteria 1596
314 Ga0395900_0302277 3300037418 Bacteria 1586
315 Ga0395900_0484780 3300037418 Bacteria 1188
316 Ga0395900_0906484 3300037418 Bacteria 805
317 Ga0395900_1065217 3300037418 Unclassified 727
318 Ga0395900_1303928 3300037418 Unclassified 640
319 Ga0395898_0134495 3300037466 Bacteria 2367
320 Ga0395905_0013011 3300037471 Bacteria 7995
321 Ga0395905_0030989 3300037471 Bacteria 5037
322 Ga0395905_0325980 3300037471 Unclassified 1426
323 Ga0395905_0719419 3300037471 Bacteria 901
324 Ga0395901_0057737 3300038443 Bacteria 4036
325 Ga0395901_0383590 3300038443 Bacteria 1446
326 Ga0395901_0769696 3300038443 Bacteria 954
327 Ga0395901_1645199 3300038443 Bacteria 594
328 Ga0436365_0010969 3300039437 Bacteria 175809
329 Ga0436365_1623269 3300039437 Bacteria 2080
330 Ga0436360_0541431 3300039438 Bacteria 1040
331 Ga0436361_0955442 3300039447 Bacteria 3679
332 Ga0436362_1136156 3300039453 Bacteria 864
333 Ga0439455_0208135 3300042012 Unclassified 567
334 Ga0466966_0044059 3300044684 Bacteria 2858
335 Ga0466966_0202132 3300044684 Bacteria 1202
336 Ga0466961_0000742 3300044693 Bacteria 20416
337 Ga0466961_0007548 3300044693 Bacteria 6922
338 Ga0466961_0206253 3300044693 Bacteria 1214
339 Ga0466963_0007693 3300044694 Bacteria 6435
340 Ga0466963_0411691 3300044694 Bacteria 953
341 Ga0466964_0011029 3300044706 Bacteria 3415
342 Ga0466968_0002444 3300044735 Bacteria 6811
343 Ga0466970_0056120 3300044765 Bacteria 2104
344 Ga0466970_0387098 3300044765 Bacteria 797
345 Ga0466959_0030165 3300045049 Bacteria 4016
346 Ga0451576_1898814 3300045051 Bacteria 615
347 Ga0466958_0017748 3300045836 Bacteria 4120
348 Ga0466958_0040488 3300045836 Bacteria 2800
349 Ga0466967_0083723 3300045976 Bacteria 2885
350 Ga0466967_0084153 3300045976 Bacteria 2878
351 Ga0466967_0311076 3300045976 Bacteria 1517
352 Ga0466967_0661138 3300045976 Bacteria 1034
353 Ga0466967_1570244 3300045976 Bacteria 655
354 Ga0495580_0127202 3300046472 Bacteria 1769
355 Ga0495643_0000008 3300046522 Bacteria 367010
356 Ga0495663_0288330 3300046525 Bacteria 589
357 Ga0495598_0006622 3300046537 Bacteria 2625
358 Ga0495598_0279562 3300046537 Bacteria 626
359 Ga0495669_0060374 3300046684 Bacteria 1714
360 Ga0495669_0361036 3300046684 Bacteria 702
361 Ga0495670_0017219 3300046691 Bacteria 3556
362 Ga0495671_0199032 3300046692 Bacteria 972
363 Ga0495636_0366119 3300047318 Bacteria 682
364 Ga0496101_0100431 3300048904 Bacteria 2165
365 Ga0496101_0208247 3300048904 Bacteria 1514
366 Ga0496101_0346007 3300048904 Bacteria 1168
367 Ga0496102_0250245 3300048905 Bacteria 1671
368 Ga0496103_0194718 3300048906 Bacteria 1303
369 Ga0496104_0418790 3300048907 Bacteria 1251
370 Ga0496105_0314995 3300048908 Bacteria 1255
371 Ga0496106_0181472 3300048909 Bacteria 1671
372 Ga0496107_0122238 3300048910 Bacteria 1918
373 Ga0496107_0143194 3300048910 Unclassified 1767
374 Ga0496107_0280936 3300048910 Bacteria 1239
375 Ga0496107_0443170 3300048910 Bacteria 965
376 Ga0496108_0071248 3300048911 Bacteria 2932
377 Ga0496108_0246676 3300048911 Unclassified 1553
378 Ga0496109_0008875 3300048912 Bacteria 8561
379 Ga0496109_0052367 3300048912 Bacteria 3720
380 Ga0496110_0002993 3300048913 Bacteria 12815
381 Ga0496110_0029394 3300048913 Bacteria 4729
382 Ga0496110_0721888 3300048913 Bacteria 899
383 Ga0496111_0139175 3300048914 Bacteria 1798
384 Ga0496111_0145523 3300048914 Bacteria 1757
385 Ga0496111_0264042 3300048914 Bacteria 1277
386 Ga0496112_0000175 3300048915 Bacteria 40859
387 Ga0496112_0037389 3300048915 Bacteria 4738
388 Ga0496112_0679193 3300048915 Bacteria 958
389 Ga0496113_0042043 3300048916 Bacteria 3375
390 Ga0496113_0108365 3300048916 Bacteria 2159
391 Ga0501040_0622374 3300049576 Unclassified 780
392 Ga0501076_0228863 3300049592 Bacteria 1520
393 Ga0501079_0062711 3300049741 Bacteria 2867
394 nmdc:mga06r32_1853180_c1 3300050510 Bacteria 538
395 nmdc:mga08y16_759056_c1 3300050511 Bacteria 965
396 nmdc:mga0n895_173_c1 3300050512 Bacteria 39986
397 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
398 nmdc:mga0rr50_461_c1 3300050513 Bacteria 21669
399 nmdc:mga08x19_3660_c1 3300050514 Bacteria 9153
400 nmdc:mga08x19_452_c1 3300050514 Bacteria 27982
401 nmdc:mga08x19_70084_c1 3300050514 Bacteria 2284
402 nmdc:mga08x19_941_c1 3300050514 Bacteria 18307
403 Ga0501082_0064803 3300060353 Bacteria 3147
404 Ga0466962_0006197 3300061719 Bacteria 5745
405 Ga0530510_0420090 3300061734 Bacteria 1009
406 Ga0068856_101453115
407 JGI24737J22298_10068407
408 JGI24743J22301_10013624
409 JGI24743J22301_10037847
410 Ga0065712_10000331
411 Ga0065712_10253958
412 Ga0065715_10089542
413 Ga0070658_10000001
414 Ga0070658_10226606
415 Ga0070658_10442234
416 Ga0070658_10801950
417 Ga0070658_11435698
418 Ga0070676_10239676
419 Ga0070676_10316687
420 Ga0070676_10369936
421 Ga0070683_100315947
422 Ga0070683_100925843
423 Ga0070683_101465864
424 Ga0070690_100433738
425 Ga0070670_100003765
426 Ga0070670_100010136
427 Ga0070670_100284387
428 Ga0070670_100650587
429 Ga0070677_10074184
430 Ga0070677_10260201
431 Ga0068869_100176974
432 Ga0070666_10066550
433 Ga0070666_10220839
434 Ga0070666_10545803
435 Ga0070666_10768118
436 Ga0070680_100011939
437 Ga0070682_100493848
438 Ga0068868_100052653
439 Ga0068868_100089457
440 Ga0068868_100117818
441 Ga0068868_100171634
442 Ga0070660_100000862
443 Ga0070660_100138459
444 Ga0070660_100545607
445 Ga0070660_100759970
446 Ga0070689_101338942
447 Ga0070661_100021154
448 Ga0070661_100103001
449 Ga0070661_100279577
450 Ga0070661_101279004
451 Ga0070668_100582903
452 Ga0070669_100215193
453 Ga0070675_100009993
454 Ga0070675_100041218
455 Ga0070675_100103265
456 Ga0070675_100183790
457 Ga0070675_100188403
458 Ga0070675_100870699
459 Ga0070675_101073283
460 Ga0070671_100466503
461 Ga0070671_100800748
462 Ga0070674_100018195
463 Ga0070673_100042723
464 Ga0070673_100062405
465 Ga0070673_100219901
466 Ga0070688_100012971
467 Ga0070659_100250993
468 Ga0070659_100361430
469 Ga0070659_100523589
470 Ga0070659_100525502
471 Ga0070667_100134595
472 Ga0070667_100301190
473 Ga0070667_100346673
474 Ga0070667_100470616
475 Ga0070667_100544179
476 Ga0070714_100340467
477 Ga0070663_100013864
478 Ga0070663_100091040
479 Ga0070663_100266775
480 Ga0070678_100002055
481 Ga0070678_100093936
482 Ga0070678_100146588
483 Ga0070678_100374284
484 Ga0070662_100099868
485 Ga0070662_100132189
486 Ga0070662_100236462
487 Ga0070681_11311053
488 Ga0068867_100113370
489 Ga0068867_100151577
490 Ga0068867_100356677
491 Ga0070707_101276827
492 Ga0070679_100259027
493 Ga0070684_100823562
494 Ga0070684_101907189
495 Ga0068853_100378492
496 Ga0070672_100003314
497 Ga0070672_100182219
498 Ga0070686_101524112
499 Ga0070696_100279555
500 Ga0070693_100024008
501 Ga0070693_100054067
502 Ga0070693_100177824
503 Ga0070693_100259035
504 Ga0070665_100043533
505 Ga0070665_100214728
506 Ga0068855_100063522
507 Ga0068855_100421637
508 Ga0068855_101075374
509 Ga0070664_100018503
510 Ga0070664_100128864
511 Ga0070664_100185568
512 Ga0070664_100955155
513 Ga0068857_100324033
514 Ga0068854_100013859
515 Ga0068854_100034924
516 Ga0068854_100193591
517 Ga0070702_100160517
518 Ga0068852_100114262
519 Ga0068852_100734233
520 Ga0068852_100791557
521 Ga0068852_100821215
522 Ga0068859_100237075
523 Ga0068864_100004905
524 Ga0068864_100022589
525 Ga0068864_100278514
526 Ga0068864_100279632
527 Ga0068864_100443539
528 Ga0068864_101354200
529 Ga0068866_10014247
530 Ga0068863_100029526
531 Ga0068863_100069207
532 Ga0068858_100002681
533 Ga0068860_101003030
534 Ga0068860_101416607
535 Ga0068862_100804080
536 Ga0070717_10506192
537 Ga0070716_100136384
538 Ga0097621_100018075
539 Ga0097621_100929750
540 Ga0068871_100006672
541 Ga0068871_101308483
542 Ga0075431_101869858
543 Ga0075434_100001049
544 Ga0075434_100030195
545 Ga0068865_101521929
546 Ga0075436_100001088
547 Ga0075436_100001106
548 Ga0075436_100116048
549 Ga0075436_100548396
550 Ga0075436_100583535
551 Ga0097620_100237081
552 Ga0075435_100000213
553 Ga0075435_100000632
554 Ga0075435_100529907
555 Ga0105240_10820492
556 Ga0111539_10880304
557 Ga0105243_10268407
558 Ga0105241_10469993
559 Ga0105241_11040787
560 Ga0105242_10538874
561 Ga0105248_10069391
562 Ga0105248_10168037
563 Ga0105248_10410117
564 Ga0105248_10672133
565 Ga0105248_12468718
566 Ga0105238_10443107
567 Ga0105249_10042746
568 Ga0105249_10946059
569 Ga0105239_12784976
570 Ga0105246_10476892
571 Ga0157373_10117142
572 Ga0157373_10168402
573 Ga0157373_10684490
574 Ga0157373_11321258
575 Ga0157371_10054189
576 Ga0157371_10149173
577 Ga0157371_10451723
578 Ga0157371_10496978
579 Ga0157371_10632571
580 Ga0157370_10001258
581 Ga0157370_10042854
582 Ga0157370_10126071
583 Ga0157369_10086608
584 Ga0157369_10108262
585 Ga0157374_10002117
586 Ga0157374_10008502
587 Ga0157374_12005888
588 Ga0157378_10077621
589 Ga0157378_10286061
590 Ga0157378_10329552
591 Ga0157378_11890641
592 Ga0163162_10048011
593 Ga0163162_10059996
594 Ga0157372_10700800
595 Ga0157375_10002436
596 Ga0157375_10009604
597 Ga0157375_10034173
598 Ga0157375_12153202
599 Ga0163163_10030946
600 Ga0157380_11424813
601 Ga0157377_10137536
602 Ga0157379_10172270
603 Ga0157379_10683563
604 Ga0157376_10126205
605 Ga0213872_10064582
606 Ga0213876_10000332
607 Ga0213876_10010995
608 Ga0207697_10098732
609 Ga0207697_10184573
610 Ga0207682_10006199
611 Ga0207642_10204889
612 Ga0207680_10034145
613 Ga0207680_10043797
614 Ga0207680_10332210
615 Ga0207645_10060995
616 Ga0207645_10166361
617 Ga0207645_10235075
618 Ga0207705_10000002
619 Ga0207705_10345893
620 Ga0207705_10461168
621 Ga0207684_10504062
622 Ga0207707_10601905
623 Ga0207660_10018588
624 Ga0207660_11006870
625 Ga0207657_10011456
626 Ga0207657_10173373
627 Ga0207657_10216508
628 Ga0207657_10649826
629 Ga0207649_10021113
630 Ga0207649_10078414
631 Ga0207649_10106767
632 Ga0207649_11320990
633 Ga0207652_10611242
634 Ga0207652_10711329
635 Ga0207650_10004449
636 Ga0207650_10016499
637 Ga0207650_10105505
638 Ga0207659_10090140
639 Ga0207659_10097927
640 Ga0207659_10135335
641 Ga0207659_10149827
642 Ga0207659_10751418
643 Ga0207659_11327304
644 Ga0207687_10255781
645 Ga0207687_11178144
646 Ga0207664_10650476
647 Ga0207644_10005983
648 Ga0207644_10019287
649 Ga0207644_10033759
650 Ga0207690_10485354
651 Ga0207706_10004181
652 Ga0207706_10196914
653 Ga0207669_10079617
654 Ga0207669_10084130
655 Ga0207704_10118098
656 Ga0207704_10192108
657 Ga0207665_10030374
658 Ga0207691_10002062
659 Ga0207691_10186783
660 Ga0207691_10260232
661 Ga0207691_10274785
662 Ga0207691_11355102
663 Ga0207711_10028294
664 Ga0207711_10104306
665 Ga0207711_10188195
666 Ga0207689_10178442
667 Ga0207689_10228601
668 Ga0207661_10509803
669 Ga0207661_11772755
670 Ga0207661_11818809
671 Ga0207679_10011221
672 Ga0207679_10391594
673 Ga0207679_10478198
674 Ga0207667_10112744
675 Ga0207667_10496714
676 Ga0207667_10586845
677 Ga0207667_11280820
678 Ga0207651_10006617
679 Ga0207651_10014585
680 Ga0207651_10099180
681 Ga0207668_10576799
682 Ga0207658_10060336
683 Ga0207658_10270912
684 Ga0207658_10737125
685 Ga0207677_10069141
686 Ga0207677_10229042
687 Ga0207677_10396092
688 Ga0207677_10510394
689 Ga0207703_10040111
690 Ga0207639_10275253
691 Ga0207678_10017428
692 Ga0207678_10292977
693 Ga0207678_10296454
694 Ga0207708_10551441
695 Ga0207702_10117684
696 Ga0207702_11258305
697 Ga0207641_10004486
698 Ga0207648_10016932
699 Ga0207648_10566101
700 Ga0207676_10003805
701 Ga0207676_10252442
702 Ga0207676_10359814
703 Ga0207676_10776406
704 Ga0207676_10990108
705 Ga0207675_100719520
706 Ga0207683_10005966
707 Ga0207683_10008629
708 Ga0207683_10216485
709 Ga0207683_10343920
710 Ga0207698_10281069
711 Ga0207698_10325403
712 Ga0207698_10618502
713 Ga0207698_11633469
714 Ga0268266_10025926
715 Ga0268266_10030425
716 Ga0268266_10641907
717 Ga0268264_10930306
718 Ga0395900_0299000
719 Ga0395900_0302277
720 Ga0395900_0484780
721 Ga0395900_0906484
722 Ga0395900_1065217
723 Ga0395900_1303928
724 Ga0395898_0134495
725 Ga0395905_0013011
726 Ga0395905_0030989
727 Ga0395905_0325980
728 Ga0395905_0719419
729 Ga0395901_0057737
730 Ga0395901_0383590
731 Ga0395901_0769696
732 Ga0395901_1645199
733 Ga0436365_0010969
734 Ga0436365_1623269
735 Ga0436360_0541431
736 Ga0436361_0955442
737 Ga0436362_1136156
738 Ga0439455_0208135
739 Ga0466966_0044059
740 Ga0466966_0202132
741 Ga0466961_0000742
742 Ga0466961_0007548
743 Ga0466961_0206253
744 Ga0466963_0007693
745 Ga0466963_0411691
746 Ga0466964_0011029
747 Ga0466968_0002444
748 Ga0466970_0056120
749 Ga0466970_0387098
750 Ga0466959_0030165
751 Ga0451576_1898814
752 Ga0466958_0017748
753 Ga0466958_0040488
754 Ga0466967_0083723
755 Ga0466967_0084153
756 Ga0466967_0311076
757 Ga0466967_0661138
758 Ga0466967_1570244
759 Ga0495580_0127202
760 Ga0495643_0000008
761 Ga0495663_0288330
762 Ga0495598_0006622
763 Ga0495598_0279562
764 Ga0495669_0060374
765 Ga0495669_0361036
766 Ga0495670_0017219
767 Ga0495671_0199032
768 Ga0495636_0366119
769 Ga0496101_0100431
770 Ga0496101_0208247
771 Ga0496101_0346007
772 Ga0496102_0250245
773 Ga0496103_0194718
774 Ga0496104_0418790
775 Ga0496105_0314995
776 Ga0496106_0181472
777 Ga0496107_0122238
778 Ga0496107_0143194
779 Ga0496107_0280936
780 Ga0496107_0443170
781 Ga0496108_0071248
782 Ga0496108_0246676
783 Ga0496109_0008875
784 Ga0496109_0052367
785 Ga0496110_0002993
786 Ga0496110_0029394
787 Ga0496110_0721888
788 Ga0496111_0139175
789 Ga0496111_0145523
790 Ga0496111_0264042
791 Ga0496112_0000175
792 Ga0496112_0037389
793 Ga0496112_0679193
794 Ga0496113_0042043
795 Ga0496113_0108365
796 Ga0501040_0622374
797 Ga0501076_0228863
798 Ga0501079_0062711
799 nmdc:mga06r32_1853180_c1
800 nmdc:mga08y16_759056_c1
801 nmdc:mga0n895_173_c1
802 nmdc:mga0rr50_2_c1
803 nmdc:mga0rr50_461_c1
804 nmdc:mga08x19_3660_c1
805 nmdc:mga08x19_452_c1
806 nmdc:mga08x19_70084_c1
807 nmdc:mga08x19_941_c1
808 Ga0501082_0064803
809 Ga0466962_0006197
810 Ga0530510_0420090

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h0o-assembly1.cif.gz_A crystal structure of acetate kinase from entamoeba histolytica 0.7109 36 73
5f7r-assembly1.cif.gz_E rok repressor lmo0178 from listeria monocytogenes bound to inducer 0.6612 35 66
8cwo-assembly1.cif.gz_K cutibacterium acnes 30s ribosomal subunit with sarecycline bound, body domain only in the local refined map 0.6147 33 65
7pkq-assembly1.cif.gz_k small subunit of the chlamydomonas reinhardtii mitoribosome 0.6136 36 65
7jil-assembly1.cif.gz_p 70s ribosome flavobacterium johnsoniae 0.6066 34 65
ID Description Score Start End Superfamily
4h0oA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7109 36 73 3.30.420.40
1xc3A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7103 36 65 3.30.420.40
af_P9WKV1_107_237_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7096 36 65 3.30.420.40
af_Q9VEQ0_8_287_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.681 36 66 3.30.420.40
af_Q7JVK1_21_159_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.6616 35 65 3.30.420.80
ID Description Score Start End GO Terms
AF-A0A2U1G343-F1-model_v4 deleted 1.001 1 149
AF-A0A258RKT7-F1-model_v4 YdhG-like domain-containing protein 0.9963 1 149
AF-A0A258RKT7-F1-model_v4 YdhG-like domain-containing protein 0.9896 1 149
AF-A0A7G8BCU4-F1-model_v4 Uncharacterized protein 0.9894 1 149
AF-A0A7Y5QLH9-F1-model_v4 YdhG-like domain-containing protein 0.9843 1 149

Map