F435939
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 405 | 239 | 405 | 127 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10812154|Ga0157370_108121541 |
| Length | 127 |
| Sequence | MIDHTGLQVSNPSKSRSFYTHALAPLGYKVITEVPTEFTGGSIVLGYGVPPKADFWIQEEKPTHRTHIAFRAESRKQVDDFFKAAIAAGGKDNGKPGIRPHYHENYYAAFVLDPDGHNIEAVFHGKM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 163 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 165 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 167 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 169 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 170 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 171 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 172 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 173 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 177 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 179 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 181 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 188 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 189 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 190 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 191 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 192 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 193 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 194 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 207 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 208 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 209 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 210 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 213 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 214 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 215 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 216 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 230 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 231 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 235 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 236 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 238 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.48 |
| Nodule | 0 |
| Rhizoplane | 4.94 |
| Rhizosphere | 90.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_1166386 | 2162886012 | Bacteria | 1772 |
| 2 | MBSR1b_contig_2865194 | 2162886012 | Bacteria | 2997 |
| 3 | JGI24743J22301_10023691 | 3300001991 | Bacteria | 1182 |
| 4 | JGI24745J21846_1007364 | 3300002073 | Bacteria | 1231 |
| 5 | JGI24749J21850_1004601 | 3300002076 | Bacteria | 1930 |
| 6 | JGI24744J21845_10016069 | 3300002077 | Bacteria | 1491 |
| 7 | Ga0070658_10001909 | 3300005327 | Bacteria | 17592 |
| 8 | Ga0070658_10014530 | 3300005327 | Bacteria | 6319 |
| 9 | Ga0070676_10006254 | 3300005328 | Bacteria | 6360 |
| 10 | Ga0070676_10014844 | 3300005328 | Bacteria | 4287 |
| 11 | Ga0070683_100015855 | 3300005329 | Bacteria | 6628 |
| 12 | Ga0070683_100684951 | 3300005329 | Bacteria | 982 |
| 13 | Ga0070683_101726336 | 3300005329 | Bacteria | 602 |
| 14 | Ga0070690_100002004 | 3300005330 | Bacteria | 10847 |
| 15 | Ga0070690_100097149 | 3300005330 | Bacteria | 1948 |
| 16 | Ga0070670_100041614 | 3300005331 | Bacteria | 3948 |
| 17 | Ga0070670_100295793 | 3300005331 | Bacteria | 1415 |
| 18 | Ga0070670_101441438 | 3300005331 | Bacteria | 632 |
| 19 | Ga0070677_10000065 | 3300005333 | Bacteria | 33290 |
| 20 | Ga0068869_100002869 | 3300005334 | Bacteria | 10461 |
| 21 | Ga0068869_100046853 | 3300005334 | Bacteria | 3119 |
| 22 | Ga0070666_10000818 | 3300005335 | Bacteria | 18868 |
| 23 | Ga0070666_10024904 | 3300005335 | Bacteria | 3900 |
| 24 | Ga0070680_100209795 | 3300005336 | Bacteria | 1643 |
| 25 | Ga0070682_100004623 | 3300005337 | Bacteria | 7649 |
| 26 | Ga0070682_100179090 | 3300005337 | Bacteria | 1479 |
| 27 | Ga0070682_100739512 | 3300005337 | Unclassified | 793 |
| 28 | Ga0070682_101600957 | 3300005337 | Bacteria | 563 |
| 29 | Ga0068868_100010629 | 3300005338 | Bacteria | 6670 |
| 30 | Ga0068868_100084942 | 3300005338 | Bacteria | 2542 |
| 31 | Ga0068868_100110768 | 3300005338 | Bacteria | 2230 |
| 32 | Ga0068868_101138663 | 3300005338 | Bacteria | 719 |
| 33 | Ga0068868_101638510 | 3300005338 | Bacteria | 605 |
| 34 | Ga0070660_100001727 | 3300005339 | Bacteria | 14984 |
| 35 | Ga0070660_100363073 | 3300005339 | Bacteria | 1194 |
| 36 | Ga0070689_100108605 | 3300005340 | Bacteria | 2204 |
| 37 | Ga0070689_100227406 | 3300005340 | Bacteria | 1532 |
| 38 | Ga0070687_100009554 | 3300005343 | Bacteria | 4162 |
| 39 | Ga0070687_100122973 | 3300005343 | Bacteria | 1487 |
| 40 | Ga0070687_100631110 | 3300005343 | Bacteria | 740 |
| 41 | Ga0070661_100012516 | 3300005344 | Bacteria | 5936 |
| 42 | Ga0070692_10032577 | 3300005345 | Bacteria | 2621 |
| 43 | Ga0070668_100003452 | 3300005347 | Bacteria | 11671 |
| 44 | Ga0070669_100001988 | 3300005353 | Bacteria | 14788 |
| 45 | Ga0070669_100062384 | 3300005353 | Bacteria | 2740 |
| 46 | Ga0070675_100002005 | 3300005354 | Bacteria | 15104 |
| 47 | Ga0070675_100111796 | 3300005354 | Bacteria | 2312 |
| 48 | Ga0070671_100010855 | 3300005355 | Bacteria | 7309 |
| 49 | Ga0070671_100014821 | 3300005355 | Bacteria | 6298 |
| 50 | Ga0070671_100340125 | 3300005355 | Bacteria | 1280 |
| 51 | Ga0070671_101126022 | 3300005355 | Bacteria | 690 |
| 52 | Ga0070674_100009991 | 3300005356 | Bacteria | 5715 |
| 53 | Ga0070674_100018479 | 3300005356 | Bacteria | 4409 |
| 54 | Ga0070673_100006569 | 3300005364 | Bacteria | 7568 |
| 55 | Ga0070673_100013092 | 3300005364 | Bacteria | 5725 |
| 56 | Ga0070688_100000751 | 3300005365 | Bacteria | 15988 |
| 57 | Ga0070688_100118624 | 3300005365 | Bacteria | 1769 |
| 58 | Ga0070659_100009060 | 3300005366 | Bacteria | 7303 |
| 59 | Ga0070659_100063270 | 3300005366 | Bacteria | 2927 |
| 60 | Ga0070667_100000924 | 3300005367 | Bacteria | 27115 |
| 61 | Ga0070667_100233260 | 3300005367 | Bacteria | 1641 |
| 62 | Ga0070703_10086193 | 3300005406 | Bacteria | 1080 |
| 63 | Ga0070701_10009212 | 3300005438 | Bacteria | 4317 |
| 64 | Ga0070701_11251266 | 3300005438 | Bacteria | 528 |
| 65 | Ga0070705_100001864 | 3300005440 | Bacteria | 10866 |
| 66 | Ga0070705_101054007 | 3300005440 | Bacteria | 663 |
| 67 | Ga0070700_100340541 | 3300005441 | Bacteria | 1108 |
| 68 | Ga0070700_100409777 | 3300005441 | Bacteria | 1021 |
| 69 | Ga0070663_100001408 | 3300005455 | Bacteria | 13144 |
| 70 | Ga0070678_100000969 | 3300005456 | Bacteria | 14804 |
| 71 | Ga0070678_100063015 | 3300005456 | Bacteria | 2741 |
| 72 | Ga0070678_100231739 | 3300005456 | Bacteria | 1540 |
| 73 | Ga0070662_100006588 | 3300005457 | Bacteria | 7494 |
| 74 | Ga0070681_10148487 | 3300005458 | Bacteria | 2272 |
| 75 | Ga0068867_100000370 | 3300005459 | Bacteria | 29942 |
| 76 | Ga0068867_100001116 | 3300005459 | Bacteria | 18372 |
| 77 | Ga0068867_100723192 | 3300005459 | Bacteria | 881 |
| 78 | Ga0070685_10000339 | 3300005466 | Bacteria | 28730 |
| 79 | Ga0070685_10196082 | 3300005466 | Bacteria | 1310 |
| 80 | Ga0070707_100597442 | 3300005468 | Bacteria | 1066 |
| 81 | Ga0070679_100326194 | 3300005530 | Bacteria | 1484 |
| 82 | Ga0070684_100001468 | 3300005535 | Bacteria | 17003 |
| 83 | Ga0070684_100029696 | 3300005535 | Bacteria | 4636 |
| 84 | Ga0070684_100763829 | 3300005535 | Bacteria | 903 |
| 85 | Ga0068853_100005141 | 3300005539 | Bacteria | 10231 |
| 86 | Ga0070672_100002488 | 3300005543 | Bacteria | 11722 |
| 87 | Ga0070672_100032730 | 3300005543 | Bacteria | 3928 |
| 88 | Ga0070672_101240434 | 3300005543 | Unclassified | 665 |
| 89 | Ga0070686_100000321 | 3300005544 | Bacteria | 31535 |
| 90 | Ga0070696_100011318 | 3300005546 | Bacteria | 5974 |
| 91 | Ga0070693_100000957 | 3300005547 | Bacteria | 12805 |
| 92 | Ga0070665_100001475 | 3300005548 | Bacteria | 27559 |
| 93 | Ga0070665_100382218 | 3300005548 | Bacteria | 1415 |
| 94 | Ga0070665_100839514 | 3300005548 | Bacteria | 932 |
| 95 | Ga0070665_101884714 | 3300005548 | Bacteria | 604 |
| 96 | Ga0070704_101053083 | 3300005549 | Bacteria | 737 |
| 97 | Ga0068855_100000068 | 3300005563 | Bacteria | 124575 |
| 98 | Ga0068855_100004620 | 3300005563 | Bacteria | 16802 |
| 99 | Ga0068855_100215803 | 3300005563 | Bacteria | 2154 |
| 100 | Ga0068855_101278516 | 3300005563 | Bacteria | 760 |
| 101 | Ga0070664_100011858 | 3300005564 | Bacteria | 7074 |
| 102 | Ga0068857_100021570 | 3300005577 | Bacteria | 5667 |
| 103 | Ga0068857_101748525 | 3300005577 | Bacteria | 608 |
| 104 | Ga0068854_100000649 | 3300005578 | Bacteria | 20632 |
| 105 | Ga0068854_100896738 | 3300005578 | Bacteria | 779 |
| 106 | Ga0068856_100052358 | 3300005614 | Bacteria | 4025 |
| 107 | Ga0068856_100814988 | 3300005614 | Bacteria | 953 |
| 108 | Ga0070702_100101130 | 3300005615 | Bacteria | 1768 |
| 109 | Ga0070702_100128340 | 3300005615 | Bacteria | 1598 |
| 110 | Ga0068852_100004965 | 3300005616 | Bacteria | 9455 |
| 111 | Ga0068859_100000699 | 3300005617 | Bacteria | 33623 |
| 112 | Ga0068859_100108592 | 3300005617 | Bacteria | 2836 |
| 113 | Ga0068864_100008802 | 3300005618 | Bacteria | 8322 |
| 114 | Ga0068864_100076767 | 3300005618 | Bacteria | 2920 |
| 115 | Ga0068864_101894110 | 3300005618 | Bacteria | 602 |
| 116 | Ga0068866_10000626 | 3300005718 | Bacteria | 16065 |
| 117 | Ga0068866_10457664 | 3300005718 | Bacteria | 836 |
| 118 | Ga0068861_100001208 | 3300005719 | Bacteria | 16084 |
| 119 | Ga0068861_100101238 | 3300005719 | Bacteria | 2291 |
| 120 | Ga0068861_100551854 | 3300005719 | Bacteria | 1050 |
| 121 | Ga0068851_10017938 | 3300005834 | Bacteria | 3407 |
| 122 | Ga0068870_10000035 | 3300005840 | Bacteria | 43532 |
| 123 | Ga0068870_10140435 | 3300005840 | Bacteria | 1413 |
| 124 | Ga0068863_100003321 | 3300005841 | Bacteria | 15886 |
| 125 | Ga0068863_100013566 | 3300005841 | Bacteria | 7861 |
| 126 | Ga0068863_100995013 | 3300005841 | Bacteria | 841 |
| 127 | Ga0068858_100005884 | 3300005842 | Bacteria | 11971 |
| 128 | Ga0068858_100049809 | 3300005842 | Bacteria | 3878 |
| 129 | Ga0068860_100001362 | 3300005843 | Bacteria | 26563 |
| 130 | Ga0068860_100141521 | 3300005843 | Bacteria | 2312 |
| 131 | Ga0068862_100020865 | 3300005844 | Bacteria | 5472 |
| 132 | Ga0068862_100838254 | 3300005844 | Bacteria | 900 |
| 133 | Ga0068862_102136166 | 3300005844 | Bacteria | 571 |
| 134 | Ga0081455_10024922 | 3300005937 | Bacteria | 5529 |
| 135 | Ga0070715_10942103 | 3300006163 | Bacteria | 534 |
| 136 | Ga0075366_10109938 | 3300006195 | Bacteria | 1658 |
| 137 | Ga0097621_100002576 | 3300006237 | Bacteria | 12422 |
| 138 | Ga0097621_100006302 | 3300006237 | Bacteria | 8415 |
| 139 | Ga0097621_100089657 | 3300006237 | Bacteria | 2572 |
| 140 | Ga0075370_10235008 | 3300006353 | Bacteria | 1085 |
| 141 | Ga0068871_100001652 | 3300006358 | Bacteria | 14998 |
| 142 | Ga0068871_100007381 | 3300006358 | Bacteria | 7847 |
| 143 | Ga0075434_101256011 | 3300006871 | Bacteria | 752 |
| 144 | Ga0068865_100001859 | 3300006881 | Bacteria | 12395 |
| 145 | Ga0068865_100025611 | 3300006881 | Bacteria | 3882 |
| 146 | Ga0068865_100068846 | 3300006881 | Bacteria | 2503 |
| 147 | Ga0097620_100000699 | 3300006931 | Bacteria | 33623 |
| 148 | Ga0097620_100108587 | 3300006931 | Bacteria | 2836 |
| 149 | Ga0105240_10001794 | 3300009093 | Bacteria | 36131 |
| 150 | Ga0111539_10382358 | 3300009094 | Bacteria | 1639 |
| 151 | Ga0111539_11551158 | 3300009094 | Bacteria | 768 |
| 152 | Ga0105245_10006833 | 3300009098 | Bacteria | 10009 |
| 153 | Ga0105245_10191287 | 3300009098 | Bacteria | 1960 |
| 154 | Ga0105245_10756032 | 3300009098 | Bacteria | 1008 |
| 155 | Ga0105247_10000863 | 3300009101 | Bacteria | 22935 |
| 156 | Ga0105243_10014879 | 3300009148 | Bacteria | 5888 |
| 157 | Ga0105243_10076410 | 3300009148 | Bacteria | 2721 |
| 158 | Ga0105241_10000244 | 3300009174 | Bacteria | 41239 |
| 159 | Ga0105242_10003018 | 3300009176 | Bacteria | 13157 |
| 160 | Ga0105242_11369384 | 3300009176 | Bacteria | 734 |
| 161 | Ga0105248_10012105 | 3300009177 | Bacteria | 9517 |
| 162 | Ga0105248_10150092 | 3300009177 | Bacteria | 2629 |
| 163 | Ga0105237_10000050 | 3300009545 | Bacteria | 160580 |
| 164 | Ga0105237_10001821 | 3300009545 | Bacteria | 27502 |
| 165 | Ga0105238_10000705 | 3300009551 | Bacteria | 34903 |
| 166 | Ga0105238_10009993 | 3300009551 | Bacteria | 9516 |
| 167 | Ga0105249_10000549 | 3300009553 | Bacteria | 34738 |
| 168 | Ga0105249_11811159 | 3300009553 | Bacteria | 683 |
| 169 | Ga0105239_10020787 | 3300010375 | Bacteria | 7243 |
| 170 | Ga0105239_10034279 | 3300010375 | Bacteria | 5574 |
| 171 | Ga0105239_11618797 | 3300010375 | Bacteria | 749 |
| 172 | Ga0105246_10004199 | 3300011119 | Bacteria | 8754 |
| 173 | Ga0157373_10008204 | 3300013100 | Bacteria | 7767 |
| 174 | Ga0157371_10002774 | 3300013102 | Bacteria | 16440 |
| 175 | Ga0157370_10303705 | 3300013104 | Bacteria | 1473 |
| 176 | Ga0157370_10812154 | 3300013104 | Unclassified | 851 |
| 177 | Ga0157369_10001108 | 3300013105 | Bacteria | 33690 |
| 178 | Ga0157374_10001654 | 3300013296 | Bacteria | 18651 |
| 179 | Ga0157374_10006404 | 3300013296 | Bacteria | 9994 |
| 180 | Ga0157378_10001798 | 3300013297 | Bacteria | 19261 |
| 181 | Ga0163162_10002320 | 3300013306 | Bacteria | 17852 |
| 182 | Ga0163162_10014111 | 3300013306 | Bacteria | 7808 |
| 183 | Ga0157372_10016419 | 3300013307 | Bacteria | 7943 |
| 184 | Ga0157375_10015212 | 3300013308 | Bacteria | 6885 |
| 185 | Ga0157375_10045089 | 3300013308 | Bacteria | 4290 |
| 186 | Ga0163163_10290331 | 3300014325 | Bacteria | 1687 |
| 187 | Ga0163163_10335341 | 3300014325 | Bacteria | 1567 |
| 188 | Ga0163163_10886889 | 3300014325 | Bacteria | 955 |
| 189 | Ga0157380_10044322 | 3300014326 | Bacteria | 3486 |
| 190 | Ga0157377_10018494 | 3300014745 | Bacteria | 3622 |
| 191 | Ga0157379_10001549 | 3300014968 | Bacteria | 18909 |
| 192 | Ga0157379_10006476 | 3300014968 | Bacteria | 10093 |
| 193 | Ga0157376_10002532 | 3300014969 | Bacteria | 12387 |
| 194 | Ga0157376_10041240 | 3300014969 | Bacteria | 3778 |
| 195 | Ga0157376_12738309 | 3300014969 | Bacteria | 533 |
| 196 | Ga0163161_10015440 | 3300017792 | Bacteria | 5324 |
| 197 | Ga0207697_10000520 | 3300025315 | Bacteria | 21713 |
| 198 | Ga0207656_10000802 | 3300025321 | Bacteria | 10265 |
| 199 | Ga0207653_10155433 | 3300025885 | Bacteria | 844 |
| 200 | Ga0207682_10008703 | 3300025893 | Bacteria | 4014 |
| 201 | Ga0207682_10162114 | 3300025893 | Bacteria | 1014 |
| 202 | Ga0207642_10014340 | 3300025899 | Bacteria | 2922 |
| 203 | Ga0207688_10000098 | 3300025901 | Bacteria | 34240 |
| 204 | Ga0207680_10016444 | 3300025903 | Bacteria | 3884 |
| 205 | Ga0207680_10040136 | 3300025903 | Bacteria | 2721 |
| 206 | Ga0207647_10011704 | 3300025904 | Bacteria | 6141 |
| 207 | Ga0207645_10000055 | 3300025907 | Bacteria | 83041 |
| 208 | Ga0207645_10001888 | 3300025907 | Bacteria | 16919 |
| 209 | Ga0207643_10000054 | 3300025908 | Bacteria | 74219 |
| 210 | Ga0207705_10002159 | 3300025909 | Bacteria | 15239 |
| 211 | Ga0207705_10161762 | 3300025909 | Bacteria | 1682 |
| 212 | Ga0207654_10083008 | 3300025911 | Bacteria | 1934 |
| 213 | Ga0207695_10236746 | 3300025913 | Bacteria | 1728 |
| 214 | Ga0207671_10031518 | 3300025914 | Bacteria | 3950 |
| 215 | Ga0207662_10000418 | 3300025918 | Bacteria | 18784 |
| 216 | Ga0207662_10976684 | 3300025918 | Bacteria | 601 |
| 217 | Ga0207657_10000070 | 3300025919 | Bacteria | 94634 |
| 218 | Ga0207657_10457847 | 3300025919 | Bacteria | 1001 |
| 219 | Ga0207649_10005707 | 3300025920 | Bacteria | 6739 |
| 220 | Ga0207652_10001423 | 3300025921 | Bacteria | 21202 |
| 221 | Ga0207681_10012683 | 3300025923 | Bacteria | 5204 |
| 222 | Ga0207694_10006446 | 3300025924 | Bacteria | 8942 |
| 223 | Ga0207650_10008881 | 3300025925 | Bacteria | 6866 |
| 224 | Ga0207650_10013666 | 3300025925 | Bacteria | 5627 |
| 225 | Ga0207650_10143617 | 3300025925 | Bacteria | 1878 |
| 226 | Ga0207659_10000136 | 3300025926 | Bacteria | 43133 |
| 227 | Ga0207659_10000389 | 3300025926 | Bacteria | 26469 |
| 228 | Ga0207687_10066209 | 3300025927 | Bacteria | 2568 |
| 229 | Ga0207687_10141119 | 3300025927 | Bacteria | 1828 |
| 230 | Ga0207687_10894268 | 3300025927 | Bacteria | 760 |
| 231 | Ga0207644_10011800 | 3300025931 | Bacteria | 5786 |
| 232 | Ga0207644_10120792 | 3300025931 | Bacteria | 1994 |
| 233 | Ga0207644_10792526 | 3300025931 | Bacteria | 792 |
| 234 | Ga0207690_10043956 | 3300025932 | Bacteria | 2943 |
| 235 | Ga0207690_10047307 | 3300025932 | Bacteria | 2853 |
| 236 | Ga0207706_10000094 | 3300025933 | Bacteria | 92942 |
| 237 | Ga0207686_10067871 | 3300025934 | Bacteria | 2283 |
| 238 | Ga0207686_10705521 | 3300025934 | Bacteria | 802 |
| 239 | Ga0207709_10062906 | 3300025935 | Bacteria | 2325 |
| 240 | Ga0207670_10000420 | 3300025936 | Bacteria | 24017 |
| 241 | Ga0207670_10113503 | 3300025936 | Bacteria | 1957 |
| 242 | Ga0207670_10281243 | 3300025936 | Bacteria | 1297 |
| 243 | Ga0207670_10451019 | 3300025936 | Bacteria | 1037 |
| 244 | Ga0207669_10010407 | 3300025937 | Bacteria | 4477 |
| 245 | Ga0207669_10033611 | 3300025937 | Bacteria | 2896 |
| 246 | Ga0207669_10985191 | 3300025937 | Bacteria | 708 |
| 247 | Ga0207704_10002966 | 3300025938 | Bacteria | 7668 |
| 248 | Ga0207704_10005028 | 3300025938 | Bacteria | 6082 |
| 249 | Ga0207691_10000173 | 3300025940 | Bacteria | 60288 |
| 250 | Ga0207691_10000458 | 3300025940 | Bacteria | 40362 |
| 251 | Ga0207711_10007180 | 3300025941 | Bacteria | 9335 |
| 252 | Ga0207711_10009514 | 3300025941 | Bacteria | 8106 |
| 253 | Ga0207689_10000287 | 3300025942 | Bacteria | 45869 |
| 254 | Ga0207689_10004386 | 3300025942 | Bacteria | 12829 |
| 255 | Ga0207689_10415036 | 3300025942 | Bacteria | 1123 |
| 256 | Ga0207661_10826265 | 3300025944 | Bacteria | 853 |
| 257 | Ga0207679_10010799 | 3300025945 | Bacteria | 5888 |
| 258 | Ga0207667_10000057 | 3300025949 | Bacteria | 202301 |
| 259 | Ga0207667_10018498 | 3300025949 | Bacteria | 7812 |
| 260 | Ga0207667_10755411 | 3300025949 | Bacteria | 971 |
| 261 | Ga0207651_10008774 | 3300025960 | Bacteria | 5485 |
| 262 | Ga0207651_10012496 | 3300025960 | Bacteria | 4809 |
| 263 | Ga0207712_10001006 | 3300025961 | Bacteria | 20086 |
| 264 | Ga0207712_10443864 | 3300025961 | Bacteria | 1099 |
| 265 | Ga0207668_10002126 | 3300025972 | Bacteria | 11557 |
| 266 | Ga0207668_10098508 | 3300025972 | Bacteria | 2166 |
| 267 | Ga0207640_10181265 | 3300025981 | Bacteria | 1579 |
| 268 | Ga0207658_10004044 | 3300025986 | Bacteria | 10248 |
| 269 | Ga0207658_10124912 | 3300025986 | Bacteria | 2057 |
| 270 | Ga0207658_11155069 | 3300025986 | Bacteria | 708 |
| 271 | Ga0207677_10004842 | 3300026023 | Bacteria | 7264 |
| 272 | Ga0207677_10004851 | 3300026023 | Bacteria | 7259 |
| 273 | Ga0207677_10038827 | 3300026023 | Bacteria | 3124 |
| 274 | Ga0207677_11785273 | 3300026023 | Bacteria | 571 |
| 275 | Ga0207703_10017833 | 3300026035 | Bacteria | 5544 |
| 276 | Ga0207703_10045057 | 3300026035 | Bacteria | 3547 |
| 277 | Ga0207678_10155759 | 3300026067 | Bacteria | 1951 |
| 278 | Ga0207678_11599232 | 3300026067 | Bacteria | 574 |
| 279 | Ga0207708_10020333 | 3300026075 | Bacteria | 5007 |
| 280 | Ga0207702_10077083 | 3300026078 | Bacteria | 2882 |
| 281 | Ga0207702_10369131 | 3300026078 | Bacteria | 1377 |
| 282 | Ga0207702_12232322 | 3300026078 | Bacteria | 536 |
| 283 | Ga0207641_10000588 | 3300026088 | Bacteria | 39984 |
| 284 | Ga0207641_10022714 | 3300026088 | Bacteria | 5164 |
| 285 | Ga0207648_10000247 | 3300026089 | Bacteria | 58338 |
| 286 | Ga0207648_10001118 | 3300026089 | Bacteria | 30131 |
| 287 | Ga0207648_10328060 | 3300026089 | Bacteria | 1376 |
| 288 | Ga0207648_10444268 | 3300026089 | Bacteria | 1180 |
| 289 | Ga0207676_10003905 | 3300026095 | Bacteria | 10529 |
| 290 | Ga0207676_10018877 | 3300026095 | Bacteria | 5020 |
| 291 | Ga0207674_10000426 | 3300026116 | Bacteria | 54953 |
| 292 | Ga0207674_10122409 | 3300026116 | Bacteria | 2568 |
| 293 | Ga0207674_12025970 | 3300026116 | Bacteria | 540 |
| 294 | Ga0207675_100000063 | 3300026118 | Bacteria | 80198 |
| 295 | Ga0207675_100608496 | 3300026118 | Bacteria | 1096 |
| 296 | Ga0207675_102290106 | 3300026118 | Bacteria | 554 |
| 297 | Ga0207675_102712045 | 3300026118 | Bacteria | 504 |
| 298 | Ga0207683_10000053 | 3300026121 | Bacteria | 85332 |
| 299 | Ga0207683_10000076 | 3300026121 | Bacteria | 77762 |
| 300 | Ga0207698_10824612 | 3300026142 | Bacteria | 931 |
| 301 | Ga0268266_10001038 | 3300028379 | Bacteria | 34907 |
| 302 | Ga0268266_10003689 | 3300028379 | Bacteria | 15109 |
| 303 | Ga0268266_11060741 | 3300028379 | Bacteria | 784 |
| 304 | Ga0268266_11362225 | 3300028379 | Bacteria | 685 |
| 305 | Ga0268265_10002440 | 3300028380 | Bacteria | 14023 |
| 306 | Ga0268265_10593560 | 3300028380 | Bacteria | 1057 |
| 307 | Ga0268264_10000986 | 3300028381 | Bacteria | 29112 |
| 308 | Ga0268264_10002742 | 3300028381 | Bacteria | 15377 |
| 309 | Ga0307515_10355562 | 3300028794 | Bacteria | 1109 |
| 310 | Ga0265320_10162775 | 3300031240 | Bacteria | 1004 |
| 311 | Ga0307513_10529073 | 3300031456 | Bacteria | 893 |
| 312 | Ga0265313_10022826 | 3300031595 | Bacteria | 3385 |
| 313 | Ga0307508_10002651 | 3300031616 | Bacteria | 18768 |
| 314 | Ga0265342_10182823 | 3300031712 | Bacteria | 1147 |
| 315 | Ga0316576_10172450 | 3300031727 | Bacteria | 1633 |
| 316 | Ga0307516_10005282 | 3300031730 | Bacteria | 15539 |
| 317 | Ga0307412_11962410 | 3300031911 | Bacteria | 541 |
| 318 | Ga0307411_12121637 | 3300032005 | Bacteria | 526 |
| 319 | Ga0373939_0358403 | 3300035114 | Bacteria | 595 |
| 320 | Ga0373955_0479609 | 3300035172 | Bacteria | 759 |
| 321 | Ga0373955_0536817 | 3300035172 | Bacteria | 715 |
| 322 | Ga0373942_0377480 | 3300035207 | Bacteria | 505 |
| 323 | Ga0373931_0961391 | 3300035691 | Bacteria | 576 |
| 324 | Ga0373931_0967874 | 3300035691 | Bacteria | 575 |
| 325 | Ga0373933_0490185 | 3300035724 | Bacteria | 805 |
| 326 | Ga0373937_0031189 | 3300036401 | Bacteria | 4828 |
| 327 | Ga0316584_1161259 | 3300036712 | Bacteria | 510 |
| 328 | Ga0373925_0067172 | 3300037068 | Bacteria | 2704 |
| 329 | Ga0436363_0952977 | 3300039450 | Bacteria | 6588 |
| 330 | Ga0451787_009067 | 3300041441 | Bacteria | 670 |
| 331 | Ga0451789_0495495 | 3300041443 | Bacteria | 919 |
| 332 | Ga0451791_1036239 | 3300041451 | Bacteria | 1012 |
| 333 | Ga0451797_0324340 | 3300041453 | Bacteria | 564 |
| 334 | Ga0451797_0546333 | 3300041453 | Bacteria | 610 |
| 335 | Ga0451802_1526005 | 3300041460 | Bacteria | 573 |
| 336 | Ga0451807_0722221 | 3300041486 | Bacteria | 1008 |
| 337 | Ga0451807_2348342 | 3300041486 | Bacteria | 653 |
| 338 | Ga0451833_0341865 | 3300041491 | Bacteria | 787 |
| 339 | Ga0451835_0829313 | 3300041492 | Bacteria | 582 |
| 340 | Ga0451851_1378516 | 3300041507 | Bacteria | 705 |
| 341 | Ga0451843_0759686 | 3300041509 | Bacteria | 1618 |
| 342 | Ga0451843_1289718 | 3300041509 | Bacteria | 843 |
| 343 | Ga0451853_2588786 | 3300041512 | Bacteria | 650 |
| 344 | Ga0451853_3068750 | 3300041512 | Bacteria | 759 |
| 345 | Ga0439445_0122839 | 3300042004 | Bacteria | 746 |
| 346 | Ga0439445_0146541 | 3300042004 | Bacteria | 686 |
| 347 | Ga0451576_0733144 | 3300045051 | Bacteria | 1038 |
| 348 | Ga0495629_0712828 | 3300046459 | Bacteria | 666 |
| 349 | Ga0495662_0682271 | 3300046476 | Bacteria | 501 |
| 350 | Ga0495668_0460651 | 3300046616 | Bacteria | 700 |
| 351 | Ga0495635_0503472 | 3300046663 | Bacteria | 797 |
| 352 | Ga0495599_0792967 | 3300046678 | Bacteria | 541 |
| 353 | Ga0495658_0192698 | 3300046683 | Bacteria | 1268 |
| 354 | Ga0495581_0417150 | 3300047315 | Bacteria | 783 |
| 355 | Ga0495604_0384480 | 3300047317 | Bacteria | 927 |
| 356 | Ga0495672_0071330 | 3300047320 | Bacteria | 1966 |
| 357 | Ga0495676_0563480 | 3300047321 | Bacteria | 744 |
| 358 | Ga0495680_0250825 | 3300047322 | Bacteria | 1254 |
| 359 | Ga0496100_0081044 | 3300048903 | Bacteria | 2192 |
| 360 | Ga0496100_0456554 | 3300048903 | Bacteria | 980 |
| 361 | Ga0496102_0063988 | 3300048905 | Bacteria | 3368 |
| 362 | Ga0496102_1301369 | 3300048905 | Bacteria | 646 |
| 363 | Ga0496103_0283885 | 3300048906 | Bacteria | 1065 |
| 364 | Ga0496106_0069874 | 3300048909 | Bacteria | 2681 |
| 365 | Ga0496107_0124401 | 3300048910 | Bacteria | 1901 |
| 366 | Ga0496108_0020825 | 3300048911 | Bacteria | 5393 |
| 367 | Ga0496109_0009793 | 3300048912 | Bacteria | 8181 |
| 368 | Ga0496111_1068864 | 3300048914 | Bacteria | 576 |
| 369 | Ga0496112_0044852 | 3300048915 | Bacteria | 4333 |
| 370 | Ga0496114_1013117 | 3300048917 | Bacteria | 714 |
| 371 | Ga0501298_137923 | 3300049521 | Bacteria | 588 |
| 372 | Ga0501032_0732859 | 3300049569 | Bacteria | 626 |
| 373 | Ga0501047_0008756 | 3300049581 | Bacteria | 9549 |
| 374 | Ga0501067_0015098 | 3300049583 | Bacteria | 4274 |
| 375 | Ga0501068_0055003 | 3300049584 | Bacteria | 2411 |
| 376 | Ga0501068_0244056 | 3300049584 | Bacteria | 1143 |
| 377 | Ga0501069_0002685 | 3300049585 | Bacteria | 9086 |
| 378 | Ga0501069_0046458 | 3300049585 | Bacteria | 2408 |
| 379 | Ga0501069_0071457 | 3300049585 | Bacteria | 1945 |
| 380 | Ga0501070_0000027 | 3300049586 | Bacteria | 141004 |
| 381 | Ga0501070_0096684 | 3300049586 | Bacteria | 2443 |
| 382 | Ga0501073_0018237 | 3300049589 | Bacteria | 5071 |
| 383 | Ga0501073_0374892 | 3300049589 | Bacteria | 983 |
| 384 | Ga0501074_0134428 | 3300049590 | Bacteria | 1769 |
| 385 | Ga0501077_0088340 | 3300049593 | Bacteria | 1964 |
| 386 | Ga0501080_0001889 | 3300049742 | Bacteria | 18033 |
| 387 | Ga0501080_0261560 | 3300049742 | Bacteria | 1576 |
| 388 | Ga0501080_0297516 | 3300049742 | Bacteria | 1464 |
| 389 | Ga0501081_0553893 | 3300049743 | Bacteria | 859 |
| 390 | Ga0501083_0003077 | 3300049744 | Bacteria | 11594 |
| 391 | Ga0501035_0480021 | 3300049822 | Bacteria | 1025 |
| 392 | nmdc:mga06z11_721016_c1 | 3300050494 | Bacteria | 607 |
| 393 | nmdc:mga07m45_675317_c1 | 3300050496 | Bacteria | 595 |
| 394 | nmdc:mga08y16_1149451_c1 | 3300050511 | Bacteria | 749 |
| 395 | nmdc:mga08y16_1473437_c1 | 3300050511 | Bacteria | 642 |
| 396 | nmdc:mga08y16_325405_c1 | 3300050511 | Bacteria | 1582 |
| 397 | nmdc:mga0n895_469493_c1 | 3300050512 | Bacteria | 1269 |
| 398 | Ga0495619_0364069 | 3300053085 | Bacteria | 1000 |
| 399 | Ga0500555_015928 | 3300053103 | Bacteria | 2166 |
| 400 | Ga0500588_0020176 | 3300053146 | Bacteria | 1783 |
| 401 | Ga0501084_0139928 | 3300054114 | Bacteria | 2038 |
| 402 | Ga0590075_008361 | 3300059424 | Bacteria | 2471 |
| 403 | Ga0501082_0038444 | 3300060353 | Bacteria | 4129 |
| 404 | Ga0501082_1282494 | 3300060353 | Bacteria | 640 |
| 405 | Ga0530510_0054825 | 3300061734 | Bacteria | 2881 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005337 | Ga0070682_101600957 | Ga0070682_1016009571 | 119 |
| 2 | 3300014325 | Ga0163163_10290331 | Ga0163163_102903313 | 119 |
| 3 | 3300005546 | Ga0070696_100011318 | Ga0070696_1000113183 | 120 |
| 4 | 3300028794 | Ga0307515_10355562 | Ga0307515_103555622 | 120 |
| 5 | 3300031616 | Ga0307508_10002651 | Ga0307508_100026517 | 120 |
| 6 | 3300031730 | Ga0307516_10005282 | Ga0307516_1000528214 | 120 |
| 7 | 3300031911 | Ga0307412_11962410 | Ga0307412_119624101 | 120 |
| 8 | 3300005328 | Ga0070676_10014844 | Ga0070676_100148443 | 121 |
| 9 | 3300005330 | Ga0070690_100097149 | Ga0070690_1000971492 | 121 |
| 10 | 3300005331 | Ga0070670_100041614 | Ga0070670_1000416143 | 121 |
| 11 | 3300005331 | Ga0070670_101441438 | Ga0070670_1014414382 | 121 |
| 12 | 3300005334 | Ga0068869_100002869 | Ga0068869_1000028696 | 121 |
| 13 | 3300005335 | Ga0070666_10000818 | Ga0070666_100008189 | 121 |
| 14 | 3300005338 | Ga0068868_100084942 | Ga0068868_1000849423 | 121 |
| 15 | 3300005340 | Ga0070689_100108605 | Ga0070689_1001086053 | 121 |
| 16 | 3300005343 | Ga0070687_100631110 | Ga0070687_1006311102 | 121 |
| 17 | 3300005347 | Ga0070668_100003452 | Ga0070668_1000034529 | 121 |
| 18 | 3300005353 | Ga0070669_100001988 | Ga0070669_1000019886 | 121 |
| 19 | 3300005354 | Ga0070675_100002005 | Ga0070675_1000020053 | 121 |
| 20 | 3300005355 | Ga0070671_100014821 | Ga0070671_1000148215 | 121 |
| 21 | 3300005355 | Ga0070671_100340125 | Ga0070671_1003401252 | 121 |
| 22 | 3300005356 | Ga0070674_100018479 | Ga0070674_1000184793 | 121 |
| 23 | 3300005364 | Ga0070673_100006569 | Ga0070673_1000065695 | 121 |
| 24 | 3300005365 | Ga0070688_100118624 | Ga0070688_1001186242 | 121 |
| 25 | 3300005367 | Ga0070667_100000924 | Ga0070667_1000009245 | 121 |
| 26 | 3300005456 | Ga0070678_100000969 | Ga0070678_1000009693 | 121 |
| 27 | 3300005459 | Ga0068867_100000370 | Ga0068867_10000037021 | 121 |
| 28 | 3300005466 | Ga0070685_10196082 | Ga0070685_101960822 | 121 |
| 29 | 3300005543 | Ga0070672_100002488 | Ga0070672_1000024887 | 121 |
| 30 | 3300005548 | Ga0070665_100001475 | Ga0070665_1000014755 | 121 |
| 31 | 3300005617 | Ga0068859_100000699 | Ga0068859_10000069912 | 121 |
| 32 | 3300005618 | Ga0068864_100008802 | Ga0068864_1000088025 | 121 |
| 33 | 3300005718 | Ga0068866_10457664 | Ga0068866_104576642 | 121 |
| 34 | 3300005719 | Ga0068861_100101238 | Ga0068861_1001012382 | 121 |
| 35 | 3300005840 | Ga0068870_10140435 | Ga0068870_101404352 | 121 |
| 36 | 3300005841 | Ga0068863_100013566 | Ga0068863_1000135665 | 121 |
| 37 | 3300005842 | Ga0068858_100005884 | Ga0068858_1000058847 | 121 |
| 38 | 3300005843 | Ga0068860_100001362 | Ga0068860_10000136227 | 121 |
| 39 | 3300006237 | Ga0097621_100002576 | Ga0097621_1000025767 | 121 |
| 40 | 3300006358 | Ga0068871_100001652 | Ga0068871_1000016523 | 121 |
| 41 | 3300006881 | Ga0068865_100001859 | Ga0068865_1000018595 | 121 |
| 42 | 3300006931 | Ga0097620_100000699 | Ga0097620_10000069927 | 121 |
| 43 | 3300009098 | Ga0105245_10756032 | Ga0105245_107560322 | 121 |
| 44 | 3300009148 | Ga0105243_10076410 | Ga0105243_100764102 | 121 |
| 45 | 3300009177 | Ga0105248_10012105 | Ga0105248_100121059 | 121 |
| 46 | 3300009553 | Ga0105249_11811159 | Ga0105249_118111591 | 121 |
| 47 | 3300013296 | Ga0157374_10006404 | Ga0157374_100064048 | 121 |
| 48 | 3300013306 | Ga0163162_10014111 | Ga0163162_100141113 | 121 |
| 49 | 3300013308 | Ga0157375_10015212 | Ga0157375_100152123 | 121 |
| 50 | 3300014968 | Ga0157379_10006476 | Ga0157379_1000647611 | 121 |
| 51 | 3300014969 | Ga0157376_10041240 | Ga0157376_100412405 | 121 |
| 52 | 3300017792 | Ga0163161_10015440 | Ga0163161_100154403 | 121 |
| 53 | 3300025893 | Ga0207682_10162114 | Ga0207682_101621142 | 121 |
| 54 | 3300025903 | Ga0207680_10040136 | Ga0207680_100401363 | 121 |
| 55 | 3300025907 | Ga0207645_10001888 | Ga0207645_100018887 | 121 |
| 56 | 3300025918 | Ga0207662_10976684 | Ga0207662_109766842 | 121 |
| 57 | 3300025923 | Ga0207681_10012683 | Ga0207681_100126836 | 121 |
| 58 | 3300025925 | Ga0207650_10008881 | Ga0207650_100088815 | 121 |
| 59 | 3300025925 | Ga0207650_10143617 | Ga0207650_101436172 | 121 |
| 60 | 3300025926 | Ga0207659_10000389 | Ga0207659_100003893 | 121 |
| 61 | 3300025927 | Ga0207687_10894268 | Ga0207687_108942682 | 121 |
| 62 | 3300025931 | Ga0207644_10120792 | Ga0207644_101207922 | 121 |
| 63 | 3300025936 | Ga0207670_10113503 | Ga0207670_101135032 | 121 |
| 64 | 3300025937 | Ga0207669_10010407 | Ga0207669_100104073 | 121 |
| 65 | 3300025938 | Ga0207704_10005028 | Ga0207704_100050285 | 121 |
| 66 | 3300025940 | Ga0207691_10000458 | Ga0207691_100004586 | 121 |
| 67 | 3300025941 | Ga0207711_10009514 | Ga0207711_100095147 | 121 |
| 68 | 3300025942 | Ga0207689_10004386 | Ga0207689_100043868 | 121 |
| 69 | 3300025960 | Ga0207651_10012496 | Ga0207651_100124964 | 121 |
| 70 | 3300025961 | Ga0207712_10443864 | Ga0207712_104438641 | 121 |
| 71 | 3300025972 | Ga0207668_10002126 | Ga0207668_100021263 | 121 |
| 72 | 3300025986 | Ga0207658_10004044 | Ga0207658_100040449 | 121 |
| 73 | 3300026023 | Ga0207677_10038827 | Ga0207677_100388273 | 121 |
| 74 | 3300026035 | Ga0207703_10017833 | Ga0207703_100178332 | 121 |
| 75 | 3300026088 | Ga0207641_10000588 | Ga0207641_100005886 | 121 |
| 76 | 3300026089 | Ga0207648_10001118 | Ga0207648_1000111822 | 121 |
| 77 | 3300026095 | Ga0207676_10003905 | Ga0207676_100039059 | 121 |
| 78 | 3300026121 | Ga0207683_10000076 | Ga0207683_1000007611 | 121 |
| 79 | 3300028379 | Ga0268266_10003689 | Ga0268266_100036893 | 121 |
| 80 | 3300028381 | Ga0268264_10002742 | Ga0268264_100027423 | 121 |
| 81 | 3300035691 | Ga0373931_0967874 | Ga0373931_0967874_67_432 | 121 |
| 82 | 3300041492 | Ga0451835_0829313 | Ga0451835_0829313_196_561 | 121 |
| 83 | 3300046459 | Ga0495629_0712828 | Ga0495629_0712828_285_650 | 121 |
| 84 | 3300046683 | Ga0495658_0192698 | Ga0495658_0192698_31_396 | 121 |
| 85 | 3300047317 | Ga0495604_0384480 | Ga0495604_0384480_39_404 | 121 |
| 86 | 3300048903 | Ga0496100_0081044 | Ga0496100_0081044_873_1238 | 121 |
| 87 | 3300048905 | Ga0496102_1301369 | Ga0496102_1301369_125_490 | 121 |
| 88 | 3300048910 | Ga0496107_0124401 | Ga0496107_0124401_319_684 | 121 |
| 89 | 3300048911 | Ga0496108_0020825 | Ga0496108_0020825_1630_1995 | 121 |
| 90 | 3300035114 | Ga0373939_0358403 | Ga0373939_0358403_14_382 | 122 |
| 91 | 3300009098 | Ga0105245_10191287 | Ga0105245_101912872 | 126 |
| 92 | 3300025927 | Ga0207687_10141119 | Ga0207687_101411192 | 126 |
| 93 | 3300005548 | Ga0070665_100839514 | Ga0070665_1008395142 | 127 |
| 94 | 3300005618 | Ga0068864_101894110 | Ga0068864_1018941101 | 127 |
| 95 | 3300013104 | Ga0157370_10812154 | Ga0157370_108121541 | 127 |
| 96 | 3300026118 | Ga0207675_102290106 | Ga0207675_1022901061 | 127 |
| 97 | 3300028379 | Ga0268266_11060741 | Ga0268266_110607412 | 127 |
| 98 | 3300032005 | Ga0307411_12121637 | Ga0307411_121216371 | 127 |
| 99 | 3300041486 | Ga0451807_2348342 | Ga0451807_2348342_138_521 | 127 |
| 100 | 3300050494 | nmdc:mga06z11_721016_c1 | nmdc:mga06z11_721016_c1_22_405 | 127 |
| 101 | 3300053103 | Ga0500555_015928 | Ga0500555_015928_436_819 | 127 |
| 102 | 2162886012 | MBSR1b_contig_1166386 | MBSR1b_0086.00002170 | 128 |
| 103 | 2162886012 | MBSR1b_contig_2865194 | MBSR1b_0785.00004430 | 128 |
| 104 | 3300001991 | JGI24743J22301_10023691 | JGI24743J22301_100236913 | 128 |
| 105 | 3300002073 | JGI24745J21846_1007364 | JGI24745J21846_10073642 | 128 |
| 106 | 3300002076 | JGI24749J21850_1004601 | JGI24749J21850_10046013 | 128 |
| 107 | 3300002077 | JGI24744J21845_10016069 | JGI24744J21845_100160692 | 128 |
| 108 | 3300005327 | Ga0070658_10001909 | Ga0070658_1000190920 | 128 |
| 109 | 3300005327 | Ga0070658_10014530 | Ga0070658_100145303 | 128 |
| 110 | 3300005328 | Ga0070676_10006254 | Ga0070676_100062545 | 128 |
| 111 | 3300005329 | Ga0070683_100015855 | Ga0070683_10001585511 | 128 |
| 112 | 3300005329 | Ga0070683_100684951 | Ga0070683_1006849511 | 128 |
| 113 | 3300005329 | Ga0070683_101726336 | Ga0070683_1017263362 | 128 |
| 114 | 3300005330 | Ga0070690_100002004 | Ga0070690_10000200414 | 128 |
| 115 | 3300005331 | Ga0070670_100295793 | Ga0070670_1002957932 | 128 |
| 116 | 3300005333 | Ga0070677_10000065 | Ga0070677_1000006511 | 128 |
| 117 | 3300005334 | Ga0068869_100046853 | Ga0068869_1000468534 | 128 |
| 118 | 3300005335 | Ga0070666_10024904 | Ga0070666_100249045 | 128 |
| 119 | 3300005336 | Ga0070680_100209795 | Ga0070680_1002097952 | 128 |
| 120 | 3300005337 | Ga0070682_100004623 | Ga0070682_1000046232 | 128 |
| 121 | 3300005337 | Ga0070682_100179090 | Ga0070682_1001790901 | 128 |
| 122 | 3300005337 | Ga0070682_100739512 | Ga0070682_1007395121 | 128 |
| 123 | 3300005338 | Ga0068868_100010629 | Ga0068868_1000106292 | 128 |
| 124 | 3300005338 | Ga0068868_100110768 | Ga0068868_1001107682 | 128 |
| 125 | 3300005338 | Ga0068868_101138663 | Ga0068868_1011386631 | 128 |
| 126 | 3300005338 | Ga0068868_101638510 | Ga0068868_1016385102 | 128 |
| 127 | 3300005339 | Ga0070660_100001727 | Ga0070660_1000017272 | 128 |
| 128 | 3300005339 | Ga0070660_100363073 | Ga0070660_1003630733 | 128 |
| 129 | 3300005340 | Ga0070689_100227406 | Ga0070689_1002274062 | 128 |
| 130 | 3300005343 | Ga0070687_100009554 | Ga0070687_1000095544 | 128 |
| 131 | 3300005343 | Ga0070687_100122973 | Ga0070687_1001229732 | 128 |
| 132 | 3300005344 | Ga0070661_100012516 | Ga0070661_1000125166 | 128 |
| 133 | 3300005345 | Ga0070692_10032577 | Ga0070692_100325774 | 128 |
| 134 | 3300005353 | Ga0070669_100062384 | Ga0070669_1000623842 | 128 |
| 135 | 3300005354 | Ga0070675_100111796 | Ga0070675_1001117962 | 128 |
| 136 | 3300005355 | Ga0070671_100010855 | Ga0070671_1000108556 | 128 |
| 137 | 3300005355 | Ga0070671_101126022 | Ga0070671_1011260222 | 128 |
| 138 | 3300005356 | Ga0070674_100009991 | Ga0070674_1000099914 | 128 |
| 139 | 3300005364 | Ga0070673_100013092 | Ga0070673_1000130926 | 128 |
| 140 | 3300005365 | Ga0070688_100000751 | Ga0070688_1000007512 | 128 |
| 141 | 3300005366 | Ga0070659_100009060 | Ga0070659_1000090602 | 128 |
| 142 | 3300005366 | Ga0070659_100063270 | Ga0070659_1000632703 | 128 |
| 143 | 3300005367 | Ga0070667_100233260 | Ga0070667_1002332602 | 128 |
| 144 | 3300005406 | Ga0070703_10086193 | Ga0070703_100861932 | 128 |
| 145 | 3300005438 | Ga0070701_10009212 | Ga0070701_100092128 | 128 |
| 146 | 3300005438 | Ga0070701_11251266 | Ga0070701_112512661 | 128 |
| 147 | 3300005440 | Ga0070705_100001864 | Ga0070705_1000018649 | 128 |
| 148 | 3300005440 | Ga0070705_101054007 | Ga0070705_1010540072 | 128 |
| 149 | 3300005441 | Ga0070700_100340541 | Ga0070700_1003405412 | 128 |
| 150 | 3300005441 | Ga0070700_100409777 | Ga0070700_1004097771 | 128 |
| 151 | 3300005455 | Ga0070663_100001408 | Ga0070663_1000014083 | 128 |
| 152 | 3300005456 | Ga0070678_100063015 | Ga0070678_1000630152 | 128 |
| 153 | 3300005456 | Ga0070678_100231739 | Ga0070678_1002317392 | 128 |
| 154 | 3300005457 | Ga0070662_100006588 | Ga0070662_1000065886 | 128 |
| 155 | 3300005458 | Ga0070681_10148487 | Ga0070681_101484872 | 128 |
| 156 | 3300005459 | Ga0068867_100001116 | Ga0068867_1000011163 | 128 |
| 157 | 3300005459 | Ga0068867_100723192 | Ga0068867_1007231922 | 128 |
| 158 | 3300005466 | Ga0070685_10000339 | Ga0070685_1000033925 | 128 |
| 159 | 3300005468 | Ga0070707_100597442 | Ga0070707_1005974422 | 128 |
| 160 | 3300005530 | Ga0070679_100326194 | Ga0070679_1003261943 | 128 |
| 161 | 3300005535 | Ga0070684_100001468 | Ga0070684_1000014686 | 128 |
| 162 | 3300005535 | Ga0070684_100029696 | Ga0070684_1000296968 | 128 |
| 163 | 3300005535 | Ga0070684_100763829 | Ga0070684_1007638292 | 128 |
| 164 | 3300005539 | Ga0068853_100005141 | Ga0068853_1000051418 | 128 |
| 165 | 3300005543 | Ga0070672_100032730 | Ga0070672_1000327304 | 128 |
| 166 | 3300005543 | Ga0070672_101240434 | Ga0070672_1012404342 | 128 |
| 167 | 3300005544 | Ga0070686_100000321 | Ga0070686_10000032118 | 128 |
| 168 | 3300005547 | Ga0070693_100000957 | Ga0070693_10000095716 | 128 |
| 169 | 3300005548 | Ga0070665_100382218 | Ga0070665_1003822183 | 128 |
| 170 | 3300005548 | Ga0070665_101884714 | Ga0070665_1018847142 | 128 |
| 171 | 3300005549 | Ga0070704_101053083 | Ga0070704_1010530831 | 128 |
| 172 | 3300005563 | Ga0068855_100000068 | Ga0068855_10000006872 | 128 |
| 173 | 3300005563 | Ga0068855_100004620 | Ga0068855_10000462023 | 128 |
| 174 | 3300005563 | Ga0068855_100215803 | Ga0068855_1002158032 | 128 |
| 175 | 3300005563 | Ga0068855_101278516 | Ga0068855_1012785162 | 128 |
| 176 | 3300005564 | Ga0070664_100011858 | Ga0070664_1000118584 | 128 |
| 177 | 3300005577 | Ga0068857_100021570 | Ga0068857_1000215706 | 128 |
| 178 | 3300005577 | Ga0068857_101748525 | Ga0068857_1017485252 | 128 |
| 179 | 3300005578 | Ga0068854_100000649 | Ga0068854_10000064920 | 128 |
| 180 | 3300005578 | Ga0068854_100896738 | Ga0068854_1008967381 | 128 |
| 181 | 3300005614 | Ga0068856_100052358 | Ga0068856_1000523586 | 128 |
| 182 | 3300005614 | Ga0068856_100814988 | Ga0068856_1008149882 | 128 |
| 183 | 3300005615 | Ga0070702_100101130 | Ga0070702_1001011303 | 128 |
| 184 | 3300005615 | Ga0070702_100128340 | Ga0070702_1001283403 | 128 |
| 185 | 3300005616 | Ga0068852_100004965 | Ga0068852_1000049658 | 128 |
| 186 | 3300005617 | Ga0068859_100108592 | Ga0068859_1001085923 | 128 |
| 187 | 3300005618 | Ga0068864_100076767 | Ga0068864_1000767674 | 128 |
| 188 | 3300005718 | Ga0068866_10000626 | Ga0068866_1000062619 | 128 |
| 189 | 3300005719 | Ga0068861_100001208 | Ga0068861_10000120820 | 128 |
| 190 | 3300005719 | Ga0068861_100551854 | Ga0068861_1005518542 | 128 |
| 191 | 3300005834 | Ga0068851_10017938 | Ga0068851_100179382 | 128 |
| 192 | 3300005840 | Ga0068870_10000035 | Ga0068870_100000356 | 128 |
| 193 | 3300005841 | Ga0068863_100003321 | Ga0068863_1000033214 | 128 |
| 194 | 3300005841 | Ga0068863_100995013 | Ga0068863_1009950132 | 128 |
| 195 | 3300005842 | Ga0068858_100049809 | Ga0068858_1000498096 | 128 |
| 196 | 3300005843 | Ga0068860_100141521 | Ga0068860_1001415212 | 128 |
| 197 | 3300005844 | Ga0068862_100020865 | Ga0068862_1000208658 | 128 |
| 198 | 3300005844 | Ga0068862_100838254 | Ga0068862_1008382542 | 128 |
| 199 | 3300005844 | Ga0068862_102136166 | Ga0068862_1021361661 | 128 |
| 200 | 3300005937 | Ga0081455_10024922 | Ga0081455_100249221 | 128 |
| 201 | 3300006163 | Ga0070715_10942103 | Ga0070715_109421031 | 128 |
| 202 | 3300006195 | Ga0075366_10109938 | Ga0075366_101099382 | 128 |
| 203 | 3300006237 | Ga0097621_100006302 | Ga0097621_1000063026 | 128 |
| 204 | 3300006237 | Ga0097621_100089657 | Ga0097621_1000896573 | 128 |
| 205 | 3300006353 | Ga0075370_10235008 | Ga0075370_102350082 | 128 |
| 206 | 3300006358 | Ga0068871_100007381 | Ga0068871_1000073814 | 128 |
| 207 | 3300006871 | Ga0075434_101256011 | Ga0075434_1012560112 | 128 |
| 208 | 3300006881 | Ga0068865_100025611 | Ga0068865_1000256112 | 128 |
| 209 | 3300006881 | Ga0068865_100068846 | Ga0068865_1000688463 | 128 |
| 210 | 3300006931 | Ga0097620_100108587 | Ga0097620_1001085873 | 128 |
| 211 | 3300009093 | Ga0105240_10001794 | Ga0105240_1000179418 | 128 |
| 212 | 3300009094 | Ga0111539_10382358 | Ga0111539_103823581 | 128 |
| 213 | 3300009094 | Ga0111539_11551158 | Ga0111539_115511581 | 128 |
| 214 | 3300009098 | Ga0105245_10006833 | Ga0105245_100068335 | 128 |
| 215 | 3300009101 | Ga0105247_10000863 | Ga0105247_1000086323 | 128 |
| 216 | 3300009148 | Ga0105243_10014879 | Ga0105243_100148794 | 128 |
| 217 | 3300009174 | Ga0105241_10000244 | Ga0105241_1000024429 | 128 |
| 218 | 3300009176 | Ga0105242_10003018 | Ga0105242_1000301818 | 128 |
| 219 | 3300009176 | Ga0105242_11369384 | Ga0105242_113693842 | 128 |
| 220 | 3300009177 | Ga0105248_10150092 | Ga0105248_101500924 | 128 |
| 221 | 3300009545 | Ga0105237_10000050 | Ga0105237_10000050125 | 128 |
| 222 | 3300009545 | Ga0105237_10001821 | Ga0105237_100018216 | 128 |
| 223 | 3300009551 | Ga0105238_10000705 | Ga0105238_100007056 | 128 |
| 224 | 3300009551 | Ga0105238_10009993 | Ga0105238_100099937 | 128 |
| 225 | 3300009553 | Ga0105249_10000549 | Ga0105249_100005495 | 128 |
| 226 | 3300010375 | Ga0105239_10020787 | Ga0105239_100207875 | 128 |
| 227 | 3300010375 | Ga0105239_10034279 | Ga0105239_100342795 | 128 |
| 228 | 3300010375 | Ga0105239_11618797 | Ga0105239_116187971 | 128 |
| 229 | 3300011119 | Ga0105246_10004199 | Ga0105246_1000419912 | 128 |
| 230 | 3300013100 | Ga0157373_10008204 | Ga0157373_100082049 | 128 |
| 231 | 3300013102 | Ga0157371_10002774 | Ga0157371_1000277421 | 128 |
| 232 | 3300013104 | Ga0157370_10303705 | Ga0157370_103037054 | 128 |
| 233 | 3300013105 | Ga0157369_10001108 | Ga0157369_1000110820 | 128 |
| 234 | 3300013296 | Ga0157374_10001654 | Ga0157374_1000165420 | 128 |
| 235 | 3300013297 | Ga0157378_10001798 | Ga0157378_100017989 | 128 |
| 236 | 3300013306 | Ga0163162_10002320 | Ga0163162_1000232020 | 128 |
| 237 | 3300013307 | Ga0157372_10016419 | Ga0157372_100164195 | 128 |
| 238 | 3300013308 | Ga0157375_10045089 | Ga0157375_100450896 | 128 |
| 239 | 3300014325 | Ga0163163_10335341 | Ga0163163_103353411 | 128 |
| 240 | 3300014325 | Ga0163163_10886889 | Ga0163163_108868891 | 128 |
| 241 | 3300014326 | Ga0157380_10044322 | Ga0157380_100443224 | 128 |
| 242 | 3300014745 | Ga0157377_10018494 | Ga0157377_100184946 | 128 |
| 243 | 3300014968 | Ga0157379_10001549 | Ga0157379_1000154921 | 128 |
| 244 | 3300014969 | Ga0157376_10002532 | Ga0157376_100025325 | 128 |
| 245 | 3300014969 | Ga0157376_12738309 | Ga0157376_127383091 | 128 |
| 246 | 3300025315 | Ga0207697_10000520 | Ga0207697_1000052015 | 128 |
| 247 | 3300025321 | Ga0207656_10000802 | Ga0207656_1000080211 | 128 |
| 248 | 3300025885 | Ga0207653_10155433 | Ga0207653_101554332 | 128 |
| 249 | 3300025893 | Ga0207682_10008703 | Ga0207682_100087036 | 128 |
| 250 | 3300025899 | Ga0207642_10014340 | Ga0207642_100143404 | 128 |
| 251 | 3300025901 | Ga0207688_10000098 | Ga0207688_1000009814 | 128 |
| 252 | 3300025903 | Ga0207680_10016444 | Ga0207680_100164446 | 128 |
| 253 | 3300025904 | Ga0207647_10011704 | Ga0207647_100117047 | 128 |
| 254 | 3300025907 | Ga0207645_10000055 | Ga0207645_1000005540 | 128 |
| 255 | 3300025908 | Ga0207643_10000054 | Ga0207643_1000005444 | 128 |
| 256 | 3300025909 | Ga0207705_10002159 | Ga0207705_100021599 | 128 |
| 257 | 3300025909 | Ga0207705_10161762 | Ga0207705_101617622 | 128 |
| 258 | 3300025911 | Ga0207654_10083008 | Ga0207654_100830083 | 128 |
| 259 | 3300025913 | Ga0207695_10236746 | Ga0207695_102367462 | 128 |
| 260 | 3300025914 | Ga0207671_10031518 | Ga0207671_100315186 | 128 |
| 261 | 3300025918 | Ga0207662_10000418 | Ga0207662_1000041821 | 128 |
| 262 | 3300025919 | Ga0207657_10000070 | Ga0207657_1000007063 | 128 |
| 263 | 3300025919 | Ga0207657_10457847 | Ga0207657_104578471 | 128 |
| 264 | 3300025920 | Ga0207649_10005707 | Ga0207649_100057079 | 128 |
| 265 | 3300025921 | Ga0207652_10001423 | Ga0207652_1000142318 | 128 |
| 266 | 3300025924 | Ga0207694_10006446 | Ga0207694_100064463 | 128 |
| 267 | 3300025925 | Ga0207650_10013666 | Ga0207650_100136666 | 128 |
| 268 | 3300025926 | Ga0207659_10000136 | Ga0207659_100001366 | 128 |
| 269 | 3300025927 | Ga0207687_10066209 | Ga0207687_100662093 | 128 |
| 270 | 3300025931 | Ga0207644_10011800 | Ga0207644_100118006 | 128 |
| 271 | 3300025931 | Ga0207644_10792526 | Ga0207644_107925262 | 128 |
| 272 | 3300025932 | Ga0207690_10043956 | Ga0207690_100439563 | 128 |
| 273 | 3300025932 | Ga0207690_10047307 | Ga0207690_100473074 | 128 |
| 274 | 3300025933 | Ga0207706_10000094 | Ga0207706_1000009462 | 128 |
| 275 | 3300025934 | Ga0207686_10067871 | Ga0207686_100678713 | 128 |
| 276 | 3300025934 | Ga0207686_10705521 | Ga0207686_107055212 | 128 |
| 277 | 3300025935 | Ga0207709_10062906 | Ga0207709_100629064 | 128 |
| 278 | 3300025936 | Ga0207670_10000420 | Ga0207670_1000042027 | 128 |
| 279 | 3300025936 | Ga0207670_10281243 | Ga0207670_102812433 | 128 |
| 280 | 3300025936 | Ga0207670_10451019 | Ga0207670_104510193 | 128 |
| 281 | 3300025937 | Ga0207669_10033611 | Ga0207669_100336113 | 128 |
| 282 | 3300025937 | Ga0207669_10985191 | Ga0207669_109851912 | 128 |
| 283 | 3300025938 | Ga0207704_10002966 | Ga0207704_100029666 | 128 |
| 284 | 3300025940 | Ga0207691_10000173 | Ga0207691_1000017362 | 128 |
| 285 | 3300025941 | Ga0207711_10007180 | Ga0207711_100071809 | 128 |
| 286 | 3300025942 | Ga0207689_10000287 | Ga0207689_1000028711 | 128 |
| 287 | 3300025942 | Ga0207689_10415036 | Ga0207689_104150362 | 128 |
| 288 | 3300025944 | Ga0207661_10826265 | Ga0207661_108262652 | 128 |
| 289 | 3300025945 | Ga0207679_10010799 | Ga0207679_100107996 | 128 |
| 290 | 3300025949 | Ga0207667_10000057 | Ga0207667_1000005774 | 128 |
| 291 | 3300025949 | Ga0207667_10018498 | Ga0207667_100184986 | 128 |
| 292 | 3300025949 | Ga0207667_10755411 | Ga0207667_107554112 | 128 |
| 293 | 3300025960 | Ga0207651_10008774 | Ga0207651_100087746 | 128 |
| 294 | 3300025961 | Ga0207712_10001006 | Ga0207712_1000100620 | 128 |
| 295 | 3300025972 | Ga0207668_10098508 | Ga0207668_100985084 | 128 |
| 296 | 3300025981 | Ga0207640_10181265 | Ga0207640_101812652 | 128 |
| 297 | 3300025986 | Ga0207658_10124912 | Ga0207658_101249123 | 128 |
| 298 | 3300025986 | Ga0207658_11155069 | Ga0207658_111550692 | 128 |
| 299 | 3300026023 | Ga0207677_10004842 | Ga0207677_100048425 | 128 |
| 300 | 3300026023 | Ga0207677_10004851 | Ga0207677_1000485110 | 128 |
| 301 | 3300026023 | Ga0207677_11785273 | Ga0207677_117852731 | 128 |
| 302 | 3300026035 | Ga0207703_10045057 | Ga0207703_100450574 | 128 |
| 303 | 3300026067 | Ga0207678_10155759 | Ga0207678_101557593 | 128 |
| 304 | 3300026067 | Ga0207678_11599232 | Ga0207678_115992321 | 128 |
| 305 | 3300026075 | Ga0207708_10020333 | Ga0207708_100203339 | 128 |
| 306 | 3300026078 | Ga0207702_10077083 | Ga0207702_100770834 | 128 |
| 307 | 3300026078 | Ga0207702_10369131 | Ga0207702_103691312 | 128 |
| 308 | 3300026078 | Ga0207702_12232322 | Ga0207702_122323221 | 128 |
| 309 | 3300026088 | Ga0207641_10022714 | Ga0207641_100227146 | 128 |
| 310 | 3300026089 | Ga0207648_10000247 | Ga0207648_1000024752 | 128 |
| 311 | 3300026089 | Ga0207648_10328060 | Ga0207648_103280602 | 128 |
| 312 | 3300026089 | Ga0207648_10444268 | Ga0207648_104442682 | 128 |
| 313 | 3300026095 | Ga0207676_10018877 | Ga0207676_100188775 | 128 |
| 314 | 3300026116 | Ga0207674_10000426 | Ga0207674_1000042647 | 128 |
| 315 | 3300026116 | Ga0207674_10122409 | Ga0207674_101224093 | 128 |
| 316 | 3300026116 | Ga0207674_12025970 | Ga0207674_120259701 | 128 |
| 317 | 3300026118 | Ga0207675_100000063 | Ga0207675_10000006362 | 128 |
| 318 | 3300026118 | Ga0207675_100608496 | Ga0207675_1006084962 | 128 |
| 319 | 3300026118 | Ga0207675_102712045 | Ga0207675_1027120451 | 128 |
| 320 | 3300026121 | Ga0207683_10000053 | Ga0207683_1000005347 | 128 |
| 321 | 3300026142 | Ga0207698_10824612 | Ga0207698_108246122 | 128 |
| 322 | 3300028379 | Ga0268266_10001038 | Ga0268266_100010386 | 128 |
| 323 | 3300028379 | Ga0268266_11362225 | Ga0268266_113622251 | 128 |
| 324 | 3300028380 | Ga0268265_10002440 | Ga0268265_1000244011 | 128 |
| 325 | 3300028380 | Ga0268265_10593560 | Ga0268265_105935602 | 128 |
| 326 | 3300028381 | Ga0268264_10000986 | Ga0268264_1000098634 | 128 |
| 327 | 3300031240 | Ga0265320_10162775 | Ga0265320_101627752 | 128 |
| 328 | 3300031456 | Ga0307513_10529073 | Ga0307513_105290731 | 128 |
| 329 | 3300031595 | Ga0265313_10022826 | Ga0265313_100228264 | 128 |
| 330 | 3300031712 | Ga0265342_10182823 | Ga0265342_101828232 | 128 |
| 331 | 3300031727 | Ga0316576_10172450 | Ga0316576_101724502 | 128 |
| 332 | 3300035172 | Ga0373955_0479609 | Ga0373955_0479609_222_608 | 128 |
| 333 | 3300035172 | Ga0373955_0536817 | Ga0373955_0536817_36_422 | 128 |
| 334 | 3300035207 | Ga0373942_0377480 | Ga0373942_0377480_25_411 | 128 |
| 335 | 3300035691 | Ga0373931_0961391 | Ga0373931_0961391_158_544 | 128 |
| 336 | 3300035724 | Ga0373933_0490185 | Ga0373933_0490185_228_623 | 128 |
| 337 | 3300036401 | Ga0373937_0031189 | Ga0373937_0031189_2157_2543 | 128 |
| 338 | 3300036712 | Ga0316584_1161259 | Ga0316584_1161259_71_457 | 128 |
| 339 | 3300037068 | Ga0373925_0067172 | Ga0373925_0067172_623_1012 | 128 |
| 340 | 3300039450 | Ga0436363_0952977 | Ga0436363_0952977_65_451 | 128 |
| 341 | 3300041441 | Ga0451787_009067 | Ga0451787_009067_83_475 | 128 |
| 342 | 3300041443 | Ga0451789_0495495 | Ga0451789_0495495_315_704 | 128 |
| 343 | 3300041451 | Ga0451791_1036239 | Ga0451791_1036239_304_699 | 128 |
| 344 | 3300041453 | Ga0451797_0324340 | Ga0451797_0324340_18_407 | 128 |
| 345 | 3300041453 | Ga0451797_0546333 | Ga0451797_0546333_67_453 | 128 |
| 346 | 3300041460 | Ga0451802_1526005 | Ga0451802_1526005_126_518 | 128 |
| 347 | 3300041486 | Ga0451807_0722221 | Ga0451807_0722221_269_661 | 128 |
| 348 | 3300041491 | Ga0451833_0341865 | Ga0451833_0341865_266_655 | 128 |
| 349 | 3300041507 | Ga0451851_1378516 | Ga0451851_1378516_286_675 | 128 |
| 350 | 3300041509 | Ga0451843_0759686 | Ga0451843_0759686_1041_1430 | 128 |
| 351 | 3300041509 | Ga0451843_1289718 | Ga0451843_1289718_333_722 | 128 |
| 352 | 3300041512 | Ga0451853_2588786 | Ga0451853_2588786_211_603 | 128 |
| 353 | 3300041512 | Ga0451853_3068750 | Ga0451853_3068750_300_689 | 128 |
| 354 | 3300042004 | Ga0439445_0122839 | Ga0439445_0122839_304_690 | 128 |
| 355 | 3300042004 | Ga0439445_0146541 | Ga0439445_0146541_24_413 | 128 |
| 356 | 3300045051 | Ga0451576_0733144 | Ga0451576_0733144_370_756 | 128 |
| 357 | 3300046476 | Ga0495662_0682271 | Ga0495662_0682271_39_425 | 128 |
| 358 | 3300046616 | Ga0495668_0460651 | Ga0495668_0460651_279_668 | 128 |
| 359 | 3300046663 | Ga0495635_0503472 | Ga0495635_0503472_215_601 | 128 |
| 360 | 3300046678 | Ga0495599_0792967 | Ga0495599_0792967_117_503 | 128 |
| 361 | 3300047315 | Ga0495581_0417150 | Ga0495581_0417150_88_474 | 128 |
| 362 | 3300047320 | Ga0495672_0071330 | Ga0495672_0071330_1464_1856 | 128 |
| 363 | 3300047321 | Ga0495676_0563480 | Ga0495676_0563480_282_668 | 128 |
| 364 | 3300047322 | Ga0495680_0250825 | Ga0495680_0250825_177_563 | 128 |
| 365 | 3300048903 | Ga0496100_0456554 | Ga0496100_0456554_315_701 | 128 |
| 366 | 3300048905 | Ga0496102_0063988 | Ga0496102_0063988_342_728 | 128 |
| 367 | 3300048906 | Ga0496103_0283885 | Ga0496103_0283885_577_963 | 128 |
| 368 | 3300048909 | Ga0496106_0069874 | Ga0496106_0069874_773_1159 | 128 |
| 369 | 3300048912 | Ga0496109_0009793 | Ga0496109_0009793_4108_4494 | 128 |
| 370 | 3300048914 | Ga0496111_1068864 | Ga0496111_1068864_117_503 | 128 |
| 371 | 3300048915 | Ga0496112_0044852 | Ga0496112_0044852_2886_3278 | 128 |
| 372 | 3300048917 | Ga0496114_1013117 | Ga0496114_1013117_303_689 | 128 |
| 373 | 3300049521 | Ga0501298_137923 | Ga0501298_137923_52_438 | 128 |
| 374 | 3300049569 | Ga0501032_0732859 | Ga0501032_0732859_170_556 | 128 |
| 375 | 3300049581 | Ga0501047_0008756 | Ga0501047_0008756_3559_3945 | 128 |
| 376 | 3300049583 | Ga0501067_0015098 | Ga0501067_0015098_3815_4201 | 128 |
| 377 | 3300049584 | Ga0501068_0055003 | Ga0501068_0055003_735_1121 | 128 |
| 378 | 3300049584 | Ga0501068_0244056 | Ga0501068_0244056_163_549 | 128 |
| 379 | 3300049585 | Ga0501069_0002685 | Ga0501069_0002685_5188_5574 | 128 |
| 380 | 3300049585 | Ga0501069_0046458 | Ga0501069_0046458_914_1300 | 128 |
| 381 | 3300049585 | Ga0501069_0071457 | Ga0501069_0071457_1063_1449 | 128 |
| 382 | 3300049586 | Ga0501070_0000027 | Ga0501070_0000027_57797_58183 | 128 |
| 383 | 3300049586 | Ga0501070_0096684 | Ga0501070_0096684_515_901 | 128 |
| 384 | 3300049589 | Ga0501073_0018237 | Ga0501073_0018237_1569_1955 | 128 |
| 385 | 3300049589 | Ga0501073_0374892 | Ga0501073_0374892_329_715 | 128 |
| 386 | 3300049590 | Ga0501074_0134428 | Ga0501074_0134428_159_545 | 128 |
| 387 | 3300049593 | Ga0501077_0088340 | Ga0501077_0088340_225_617 | 128 |
| 388 | 3300049742 | Ga0501080_0001889 | Ga0501080_0001889_3772_4158 | 128 |
| 389 | 3300049742 | Ga0501080_0261560 | Ga0501080_0261560_738_1124 | 128 |
| 390 | 3300049742 | Ga0501080_0297516 | Ga0501080_0297516_848_1234 | 128 |
| 391 | 3300049743 | Ga0501081_0553893 | Ga0501081_0553893_381_770 | 128 |
| 392 | 3300049744 | Ga0501083_0003077 | Ga0501083_0003077_2119_2505 | 128 |
| 393 | 3300049822 | Ga0501035_0480021 | Ga0501035_0480021_115_501 | 128 |
| 394 | 3300050496 | nmdc:mga07m45_675317_c1 | nmdc:mga07m45_675317_c1_54_440 | 128 |
| 395 | 3300050511 | nmdc:mga08y16_1149451_c1 | nmdc:mga08y16_1149451_c1_57_449 | 128 |
| 396 | 3300050511 | nmdc:mga08y16_1473437_c1 | nmdc:mga08y16_1473437_c1_61_447 | 128 |
| 397 | 3300050511 | nmdc:mga08y16_325405_c1 | nmdc:mga08y16_325405_c1_880_1266 | 128 |
| 398 | 3300050512 | nmdc:mga0n895_469493_c1 | nmdc:mga0n895_469493_c1_266_652 | 128 |
| 399 | 3300053085 | Ga0495619_0364069 | Ga0495619_0364069_522_908 | 128 |
| 400 | 3300053146 | Ga0500588_0020176 | Ga0500588_0020176_671_1060 | 128 |
| 401 | 3300054114 | Ga0501084_0139928 | Ga0501084_0139928_1324_1713 | 128 |
| 402 | 3300059424 | Ga0590075_008361 | Ga0590075_008361_460_852 | 128 |
| 403 | 3300060353 | Ga0501082_0038444 | Ga0501082_0038444_136_522 | 128 |
| 404 | 3300060353 | Ga0501082_1282494 | Ga0501082_1282494_70_459 | 128 |
| 405 | 3300061734 | Ga0530510_0054825 | Ga0530510_0054825_615_1001 | 128 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4z04-assembly1.cif.gz_A-2 | crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione | 0.9275 | 1 | 128 |
| 4z04-assembly1.cif.gz_A-2 | crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione | 0.9131 | 1 | 128 |
| 4pav-assembly4.cif.gz_D | structure of hypothetical protein sa1046 from s. aureus. | 0.802 | 6 | 124 |
| 4qb5-assembly1.cif.gz_A | crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 | 0.767 | 4 | 126 |
| 2p7q-assembly4.cif.gz_C-2 | crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid | 0.7573 | 4 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4z04A00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9275 | 1 | 128 | 3.10.180.10 |
| 4z04A00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9131 | 1 | 128 | 3.10.180.10 |
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8657 | 67 | 125 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8441 | 66 | 126 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8192 | 66 | 126 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V1CTG9-F1-model_v4 | VOC domain-containing protein | 1.001 | 68 | 125 |
|
| AF-A0A2H0UCP5-F1-model_v4 | Glyoxalase | 1 | 66 | 125 |
|
| AF-M5CMF1-F1-model_v4 | deleted | 0.9994 | 67 | 128 |
|
| AF-A0A3S1HQ61-F1-model_v4 | VOC family protein | 0.9986 | 66 | 128 |
|
| AF-A0A4R3YNT8-F1-model_v4 | Glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein | 0.9974 | 76 | 128 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar