F435939

General Info

Members Datasets Scaffolds Average Seq Length
405 239 405 127

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10812154|Ga0157370_108121541
Length 127
Sequence MIDHTGLQVSNPSKSRSFYTHALAPLGYKVITEVPTEFTGGSIVLGYGVPPKADFWIQEEKPTHRTHIAFRAESRKQVDDFFKAAIAAGGKDNGKPGIRPHYHENYYAAFVLDPDGHNIEAVFHGKM

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
168 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
182 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
183 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
184 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
185 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
188 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
189 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
190 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
235 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.48
Nodule 0
Rhizoplane 4.94
Rhizosphere 90.62
Stem 0
Stem Tuber 0
Unclassified 2.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_1166386 2162886012 Bacteria 1772
2 MBSR1b_contig_2865194 2162886012 Bacteria 2997
3 JGI24743J22301_10023691 3300001991 Bacteria 1182
4 JGI24745J21846_1007364 3300002073 Bacteria 1231
5 JGI24749J21850_1004601 3300002076 Bacteria 1930
6 JGI24744J21845_10016069 3300002077 Bacteria 1491
7 Ga0070658_10001909 3300005327 Bacteria 17592
8 Ga0070658_10014530 3300005327 Bacteria 6319
9 Ga0070676_10006254 3300005328 Bacteria 6360
10 Ga0070676_10014844 3300005328 Bacteria 4287
11 Ga0070683_100015855 3300005329 Bacteria 6628
12 Ga0070683_100684951 3300005329 Bacteria 982
13 Ga0070683_101726336 3300005329 Bacteria 602
14 Ga0070690_100002004 3300005330 Bacteria 10847
15 Ga0070690_100097149 3300005330 Bacteria 1948
16 Ga0070670_100041614 3300005331 Bacteria 3948
17 Ga0070670_100295793 3300005331 Bacteria 1415
18 Ga0070670_101441438 3300005331 Bacteria 632
19 Ga0070677_10000065 3300005333 Bacteria 33290
20 Ga0068869_100002869 3300005334 Bacteria 10461
21 Ga0068869_100046853 3300005334 Bacteria 3119
22 Ga0070666_10000818 3300005335 Bacteria 18868
23 Ga0070666_10024904 3300005335 Bacteria 3900
24 Ga0070680_100209795 3300005336 Bacteria 1643
25 Ga0070682_100004623 3300005337 Bacteria 7649
26 Ga0070682_100179090 3300005337 Bacteria 1479
27 Ga0070682_100739512 3300005337 Unclassified 793
28 Ga0070682_101600957 3300005337 Bacteria 563
29 Ga0068868_100010629 3300005338 Bacteria 6670
30 Ga0068868_100084942 3300005338 Bacteria 2542
31 Ga0068868_100110768 3300005338 Bacteria 2230
32 Ga0068868_101138663 3300005338 Bacteria 719
33 Ga0068868_101638510 3300005338 Bacteria 605
34 Ga0070660_100001727 3300005339 Bacteria 14984
35 Ga0070660_100363073 3300005339 Bacteria 1194
36 Ga0070689_100108605 3300005340 Bacteria 2204
37 Ga0070689_100227406 3300005340 Bacteria 1532
38 Ga0070687_100009554 3300005343 Bacteria 4162
39 Ga0070687_100122973 3300005343 Bacteria 1487
40 Ga0070687_100631110 3300005343 Bacteria 740
41 Ga0070661_100012516 3300005344 Bacteria 5936
42 Ga0070692_10032577 3300005345 Bacteria 2621
43 Ga0070668_100003452 3300005347 Bacteria 11671
44 Ga0070669_100001988 3300005353 Bacteria 14788
45 Ga0070669_100062384 3300005353 Bacteria 2740
46 Ga0070675_100002005 3300005354 Bacteria 15104
47 Ga0070675_100111796 3300005354 Bacteria 2312
48 Ga0070671_100010855 3300005355 Bacteria 7309
49 Ga0070671_100014821 3300005355 Bacteria 6298
50 Ga0070671_100340125 3300005355 Bacteria 1280
51 Ga0070671_101126022 3300005355 Bacteria 690
52 Ga0070674_100009991 3300005356 Bacteria 5715
53 Ga0070674_100018479 3300005356 Bacteria 4409
54 Ga0070673_100006569 3300005364 Bacteria 7568
55 Ga0070673_100013092 3300005364 Bacteria 5725
56 Ga0070688_100000751 3300005365 Bacteria 15988
57 Ga0070688_100118624 3300005365 Bacteria 1769
58 Ga0070659_100009060 3300005366 Bacteria 7303
59 Ga0070659_100063270 3300005366 Bacteria 2927
60 Ga0070667_100000924 3300005367 Bacteria 27115
61 Ga0070667_100233260 3300005367 Bacteria 1641
62 Ga0070703_10086193 3300005406 Bacteria 1080
63 Ga0070701_10009212 3300005438 Bacteria 4317
64 Ga0070701_11251266 3300005438 Bacteria 528
65 Ga0070705_100001864 3300005440 Bacteria 10866
66 Ga0070705_101054007 3300005440 Bacteria 663
67 Ga0070700_100340541 3300005441 Bacteria 1108
68 Ga0070700_100409777 3300005441 Bacteria 1021
69 Ga0070663_100001408 3300005455 Bacteria 13144
70 Ga0070678_100000969 3300005456 Bacteria 14804
71 Ga0070678_100063015 3300005456 Bacteria 2741
72 Ga0070678_100231739 3300005456 Bacteria 1540
73 Ga0070662_100006588 3300005457 Bacteria 7494
74 Ga0070681_10148487 3300005458 Bacteria 2272
75 Ga0068867_100000370 3300005459 Bacteria 29942
76 Ga0068867_100001116 3300005459 Bacteria 18372
77 Ga0068867_100723192 3300005459 Bacteria 881
78 Ga0070685_10000339 3300005466 Bacteria 28730
79 Ga0070685_10196082 3300005466 Bacteria 1310
80 Ga0070707_100597442 3300005468 Bacteria 1066
81 Ga0070679_100326194 3300005530 Bacteria 1484
82 Ga0070684_100001468 3300005535 Bacteria 17003
83 Ga0070684_100029696 3300005535 Bacteria 4636
84 Ga0070684_100763829 3300005535 Bacteria 903
85 Ga0068853_100005141 3300005539 Bacteria 10231
86 Ga0070672_100002488 3300005543 Bacteria 11722
87 Ga0070672_100032730 3300005543 Bacteria 3928
88 Ga0070672_101240434 3300005543 Unclassified 665
89 Ga0070686_100000321 3300005544 Bacteria 31535
90 Ga0070696_100011318 3300005546 Bacteria 5974
91 Ga0070693_100000957 3300005547 Bacteria 12805
92 Ga0070665_100001475 3300005548 Bacteria 27559
93 Ga0070665_100382218 3300005548 Bacteria 1415
94 Ga0070665_100839514 3300005548 Bacteria 932
95 Ga0070665_101884714 3300005548 Bacteria 604
96 Ga0070704_101053083 3300005549 Bacteria 737
97 Ga0068855_100000068 3300005563 Bacteria 124575
98 Ga0068855_100004620 3300005563 Bacteria 16802
99 Ga0068855_100215803 3300005563 Bacteria 2154
100 Ga0068855_101278516 3300005563 Bacteria 760
101 Ga0070664_100011858 3300005564 Bacteria 7074
102 Ga0068857_100021570 3300005577 Bacteria 5667
103 Ga0068857_101748525 3300005577 Bacteria 608
104 Ga0068854_100000649 3300005578 Bacteria 20632
105 Ga0068854_100896738 3300005578 Bacteria 779
106 Ga0068856_100052358 3300005614 Bacteria 4025
107 Ga0068856_100814988 3300005614 Bacteria 953
108 Ga0070702_100101130 3300005615 Bacteria 1768
109 Ga0070702_100128340 3300005615 Bacteria 1598
110 Ga0068852_100004965 3300005616 Bacteria 9455
111 Ga0068859_100000699 3300005617 Bacteria 33623
112 Ga0068859_100108592 3300005617 Bacteria 2836
113 Ga0068864_100008802 3300005618 Bacteria 8322
114 Ga0068864_100076767 3300005618 Bacteria 2920
115 Ga0068864_101894110 3300005618 Bacteria 602
116 Ga0068866_10000626 3300005718 Bacteria 16065
117 Ga0068866_10457664 3300005718 Bacteria 836
118 Ga0068861_100001208 3300005719 Bacteria 16084
119 Ga0068861_100101238 3300005719 Bacteria 2291
120 Ga0068861_100551854 3300005719 Bacteria 1050
121 Ga0068851_10017938 3300005834 Bacteria 3407
122 Ga0068870_10000035 3300005840 Bacteria 43532
123 Ga0068870_10140435 3300005840 Bacteria 1413
124 Ga0068863_100003321 3300005841 Bacteria 15886
125 Ga0068863_100013566 3300005841 Bacteria 7861
126 Ga0068863_100995013 3300005841 Bacteria 841
127 Ga0068858_100005884 3300005842 Bacteria 11971
128 Ga0068858_100049809 3300005842 Bacteria 3878
129 Ga0068860_100001362 3300005843 Bacteria 26563
130 Ga0068860_100141521 3300005843 Bacteria 2312
131 Ga0068862_100020865 3300005844 Bacteria 5472
132 Ga0068862_100838254 3300005844 Bacteria 900
133 Ga0068862_102136166 3300005844 Bacteria 571
134 Ga0081455_10024922 3300005937 Bacteria 5529
135 Ga0070715_10942103 3300006163 Bacteria 534
136 Ga0075366_10109938 3300006195 Bacteria 1658
137 Ga0097621_100002576 3300006237 Bacteria 12422
138 Ga0097621_100006302 3300006237 Bacteria 8415
139 Ga0097621_100089657 3300006237 Bacteria 2572
140 Ga0075370_10235008 3300006353 Bacteria 1085
141 Ga0068871_100001652 3300006358 Bacteria 14998
142 Ga0068871_100007381 3300006358 Bacteria 7847
143 Ga0075434_101256011 3300006871 Bacteria 752
144 Ga0068865_100001859 3300006881 Bacteria 12395
145 Ga0068865_100025611 3300006881 Bacteria 3882
146 Ga0068865_100068846 3300006881 Bacteria 2503
147 Ga0097620_100000699 3300006931 Bacteria 33623
148 Ga0097620_100108587 3300006931 Bacteria 2836
149 Ga0105240_10001794 3300009093 Bacteria 36131
150 Ga0111539_10382358 3300009094 Bacteria 1639
151 Ga0111539_11551158 3300009094 Bacteria 768
152 Ga0105245_10006833 3300009098 Bacteria 10009
153 Ga0105245_10191287 3300009098 Bacteria 1960
154 Ga0105245_10756032 3300009098 Bacteria 1008
155 Ga0105247_10000863 3300009101 Bacteria 22935
156 Ga0105243_10014879 3300009148 Bacteria 5888
157 Ga0105243_10076410 3300009148 Bacteria 2721
158 Ga0105241_10000244 3300009174 Bacteria 41239
159 Ga0105242_10003018 3300009176 Bacteria 13157
160 Ga0105242_11369384 3300009176 Bacteria 734
161 Ga0105248_10012105 3300009177 Bacteria 9517
162 Ga0105248_10150092 3300009177 Bacteria 2629
163 Ga0105237_10000050 3300009545 Bacteria 160580
164 Ga0105237_10001821 3300009545 Bacteria 27502
165 Ga0105238_10000705 3300009551 Bacteria 34903
166 Ga0105238_10009993 3300009551 Bacteria 9516
167 Ga0105249_10000549 3300009553 Bacteria 34738
168 Ga0105249_11811159 3300009553 Bacteria 683
169 Ga0105239_10020787 3300010375 Bacteria 7243
170 Ga0105239_10034279 3300010375 Bacteria 5574
171 Ga0105239_11618797 3300010375 Bacteria 749
172 Ga0105246_10004199 3300011119 Bacteria 8754
173 Ga0157373_10008204 3300013100 Bacteria 7767
174 Ga0157371_10002774 3300013102 Bacteria 16440
175 Ga0157370_10303705 3300013104 Bacteria 1473
176 Ga0157370_10812154 3300013104 Unclassified 851
177 Ga0157369_10001108 3300013105 Bacteria 33690
178 Ga0157374_10001654 3300013296 Bacteria 18651
179 Ga0157374_10006404 3300013296 Bacteria 9994
180 Ga0157378_10001798 3300013297 Bacteria 19261
181 Ga0163162_10002320 3300013306 Bacteria 17852
182 Ga0163162_10014111 3300013306 Bacteria 7808
183 Ga0157372_10016419 3300013307 Bacteria 7943
184 Ga0157375_10015212 3300013308 Bacteria 6885
185 Ga0157375_10045089 3300013308 Bacteria 4290
186 Ga0163163_10290331 3300014325 Bacteria 1687
187 Ga0163163_10335341 3300014325 Bacteria 1567
188 Ga0163163_10886889 3300014325 Bacteria 955
189 Ga0157380_10044322 3300014326 Bacteria 3486
190 Ga0157377_10018494 3300014745 Bacteria 3622
191 Ga0157379_10001549 3300014968 Bacteria 18909
192 Ga0157379_10006476 3300014968 Bacteria 10093
193 Ga0157376_10002532 3300014969 Bacteria 12387
194 Ga0157376_10041240 3300014969 Bacteria 3778
195 Ga0157376_12738309 3300014969 Bacteria 533
196 Ga0163161_10015440 3300017792 Bacteria 5324
197 Ga0207697_10000520 3300025315 Bacteria 21713
198 Ga0207656_10000802 3300025321 Bacteria 10265
199 Ga0207653_10155433 3300025885 Bacteria 844
200 Ga0207682_10008703 3300025893 Bacteria 4014
201 Ga0207682_10162114 3300025893 Bacteria 1014
202 Ga0207642_10014340 3300025899 Bacteria 2922
203 Ga0207688_10000098 3300025901 Bacteria 34240
204 Ga0207680_10016444 3300025903 Bacteria 3884
205 Ga0207680_10040136 3300025903 Bacteria 2721
206 Ga0207647_10011704 3300025904 Bacteria 6141
207 Ga0207645_10000055 3300025907 Bacteria 83041
208 Ga0207645_10001888 3300025907 Bacteria 16919
209 Ga0207643_10000054 3300025908 Bacteria 74219
210 Ga0207705_10002159 3300025909 Bacteria 15239
211 Ga0207705_10161762 3300025909 Bacteria 1682
212 Ga0207654_10083008 3300025911 Bacteria 1934
213 Ga0207695_10236746 3300025913 Bacteria 1728
214 Ga0207671_10031518 3300025914 Bacteria 3950
215 Ga0207662_10000418 3300025918 Bacteria 18784
216 Ga0207662_10976684 3300025918 Bacteria 601
217 Ga0207657_10000070 3300025919 Bacteria 94634
218 Ga0207657_10457847 3300025919 Bacteria 1001
219 Ga0207649_10005707 3300025920 Bacteria 6739
220 Ga0207652_10001423 3300025921 Bacteria 21202
221 Ga0207681_10012683 3300025923 Bacteria 5204
222 Ga0207694_10006446 3300025924 Bacteria 8942
223 Ga0207650_10008881 3300025925 Bacteria 6866
224 Ga0207650_10013666 3300025925 Bacteria 5627
225 Ga0207650_10143617 3300025925 Bacteria 1878
226 Ga0207659_10000136 3300025926 Bacteria 43133
227 Ga0207659_10000389 3300025926 Bacteria 26469
228 Ga0207687_10066209 3300025927 Bacteria 2568
229 Ga0207687_10141119 3300025927 Bacteria 1828
230 Ga0207687_10894268 3300025927 Bacteria 760
231 Ga0207644_10011800 3300025931 Bacteria 5786
232 Ga0207644_10120792 3300025931 Bacteria 1994
233 Ga0207644_10792526 3300025931 Bacteria 792
234 Ga0207690_10043956 3300025932 Bacteria 2943
235 Ga0207690_10047307 3300025932 Bacteria 2853
236 Ga0207706_10000094 3300025933 Bacteria 92942
237 Ga0207686_10067871 3300025934 Bacteria 2283
238 Ga0207686_10705521 3300025934 Bacteria 802
239 Ga0207709_10062906 3300025935 Bacteria 2325
240 Ga0207670_10000420 3300025936 Bacteria 24017
241 Ga0207670_10113503 3300025936 Bacteria 1957
242 Ga0207670_10281243 3300025936 Bacteria 1297
243 Ga0207670_10451019 3300025936 Bacteria 1037
244 Ga0207669_10010407 3300025937 Bacteria 4477
245 Ga0207669_10033611 3300025937 Bacteria 2896
246 Ga0207669_10985191 3300025937 Bacteria 708
247 Ga0207704_10002966 3300025938 Bacteria 7668
248 Ga0207704_10005028 3300025938 Bacteria 6082
249 Ga0207691_10000173 3300025940 Bacteria 60288
250 Ga0207691_10000458 3300025940 Bacteria 40362
251 Ga0207711_10007180 3300025941 Bacteria 9335
252 Ga0207711_10009514 3300025941 Bacteria 8106
253 Ga0207689_10000287 3300025942 Bacteria 45869
254 Ga0207689_10004386 3300025942 Bacteria 12829
255 Ga0207689_10415036 3300025942 Bacteria 1123
256 Ga0207661_10826265 3300025944 Bacteria 853
257 Ga0207679_10010799 3300025945 Bacteria 5888
258 Ga0207667_10000057 3300025949 Bacteria 202301
259 Ga0207667_10018498 3300025949 Bacteria 7812
260 Ga0207667_10755411 3300025949 Bacteria 971
261 Ga0207651_10008774 3300025960 Bacteria 5485
262 Ga0207651_10012496 3300025960 Bacteria 4809
263 Ga0207712_10001006 3300025961 Bacteria 20086
264 Ga0207712_10443864 3300025961 Bacteria 1099
265 Ga0207668_10002126 3300025972 Bacteria 11557
266 Ga0207668_10098508 3300025972 Bacteria 2166
267 Ga0207640_10181265 3300025981 Bacteria 1579
268 Ga0207658_10004044 3300025986 Bacteria 10248
269 Ga0207658_10124912 3300025986 Bacteria 2057
270 Ga0207658_11155069 3300025986 Bacteria 708
271 Ga0207677_10004842 3300026023 Bacteria 7264
272 Ga0207677_10004851 3300026023 Bacteria 7259
273 Ga0207677_10038827 3300026023 Bacteria 3124
274 Ga0207677_11785273 3300026023 Bacteria 571
275 Ga0207703_10017833 3300026035 Bacteria 5544
276 Ga0207703_10045057 3300026035 Bacteria 3547
277 Ga0207678_10155759 3300026067 Bacteria 1951
278 Ga0207678_11599232 3300026067 Bacteria 574
279 Ga0207708_10020333 3300026075 Bacteria 5007
280 Ga0207702_10077083 3300026078 Bacteria 2882
281 Ga0207702_10369131 3300026078 Bacteria 1377
282 Ga0207702_12232322 3300026078 Bacteria 536
283 Ga0207641_10000588 3300026088 Bacteria 39984
284 Ga0207641_10022714 3300026088 Bacteria 5164
285 Ga0207648_10000247 3300026089 Bacteria 58338
286 Ga0207648_10001118 3300026089 Bacteria 30131
287 Ga0207648_10328060 3300026089 Bacteria 1376
288 Ga0207648_10444268 3300026089 Bacteria 1180
289 Ga0207676_10003905 3300026095 Bacteria 10529
290 Ga0207676_10018877 3300026095 Bacteria 5020
291 Ga0207674_10000426 3300026116 Bacteria 54953
292 Ga0207674_10122409 3300026116 Bacteria 2568
293 Ga0207674_12025970 3300026116 Bacteria 540
294 Ga0207675_100000063 3300026118 Bacteria 80198
295 Ga0207675_100608496 3300026118 Bacteria 1096
296 Ga0207675_102290106 3300026118 Bacteria 554
297 Ga0207675_102712045 3300026118 Bacteria 504
298 Ga0207683_10000053 3300026121 Bacteria 85332
299 Ga0207683_10000076 3300026121 Bacteria 77762
300 Ga0207698_10824612 3300026142 Bacteria 931
301 Ga0268266_10001038 3300028379 Bacteria 34907
302 Ga0268266_10003689 3300028379 Bacteria 15109
303 Ga0268266_11060741 3300028379 Bacteria 784
304 Ga0268266_11362225 3300028379 Bacteria 685
305 Ga0268265_10002440 3300028380 Bacteria 14023
306 Ga0268265_10593560 3300028380 Bacteria 1057
307 Ga0268264_10000986 3300028381 Bacteria 29112
308 Ga0268264_10002742 3300028381 Bacteria 15377
309 Ga0307515_10355562 3300028794 Bacteria 1109
310 Ga0265320_10162775 3300031240 Bacteria 1004
311 Ga0307513_10529073 3300031456 Bacteria 893
312 Ga0265313_10022826 3300031595 Bacteria 3385
313 Ga0307508_10002651 3300031616 Bacteria 18768
314 Ga0265342_10182823 3300031712 Bacteria 1147
315 Ga0316576_10172450 3300031727 Bacteria 1633
316 Ga0307516_10005282 3300031730 Bacteria 15539
317 Ga0307412_11962410 3300031911 Bacteria 541
318 Ga0307411_12121637 3300032005 Bacteria 526
319 Ga0373939_0358403 3300035114 Bacteria 595
320 Ga0373955_0479609 3300035172 Bacteria 759
321 Ga0373955_0536817 3300035172 Bacteria 715
322 Ga0373942_0377480 3300035207 Bacteria 505
323 Ga0373931_0961391 3300035691 Bacteria 576
324 Ga0373931_0967874 3300035691 Bacteria 575
325 Ga0373933_0490185 3300035724 Bacteria 805
326 Ga0373937_0031189 3300036401 Bacteria 4828
327 Ga0316584_1161259 3300036712 Bacteria 510
328 Ga0373925_0067172 3300037068 Bacteria 2704
329 Ga0436363_0952977 3300039450 Bacteria 6588
330 Ga0451787_009067 3300041441 Bacteria 670
331 Ga0451789_0495495 3300041443 Bacteria 919
332 Ga0451791_1036239 3300041451 Bacteria 1012
333 Ga0451797_0324340 3300041453 Bacteria 564
334 Ga0451797_0546333 3300041453 Bacteria 610
335 Ga0451802_1526005 3300041460 Bacteria 573
336 Ga0451807_0722221 3300041486 Bacteria 1008
337 Ga0451807_2348342 3300041486 Bacteria 653
338 Ga0451833_0341865 3300041491 Bacteria 787
339 Ga0451835_0829313 3300041492 Bacteria 582
340 Ga0451851_1378516 3300041507 Bacteria 705
341 Ga0451843_0759686 3300041509 Bacteria 1618
342 Ga0451843_1289718 3300041509 Bacteria 843
343 Ga0451853_2588786 3300041512 Bacteria 650
344 Ga0451853_3068750 3300041512 Bacteria 759
345 Ga0439445_0122839 3300042004 Bacteria 746
346 Ga0439445_0146541 3300042004 Bacteria 686
347 Ga0451576_0733144 3300045051 Bacteria 1038
348 Ga0495629_0712828 3300046459 Bacteria 666
349 Ga0495662_0682271 3300046476 Bacteria 501
350 Ga0495668_0460651 3300046616 Bacteria 700
351 Ga0495635_0503472 3300046663 Bacteria 797
352 Ga0495599_0792967 3300046678 Bacteria 541
353 Ga0495658_0192698 3300046683 Bacteria 1268
354 Ga0495581_0417150 3300047315 Bacteria 783
355 Ga0495604_0384480 3300047317 Bacteria 927
356 Ga0495672_0071330 3300047320 Bacteria 1966
357 Ga0495676_0563480 3300047321 Bacteria 744
358 Ga0495680_0250825 3300047322 Bacteria 1254
359 Ga0496100_0081044 3300048903 Bacteria 2192
360 Ga0496100_0456554 3300048903 Bacteria 980
361 Ga0496102_0063988 3300048905 Bacteria 3368
362 Ga0496102_1301369 3300048905 Bacteria 646
363 Ga0496103_0283885 3300048906 Bacteria 1065
364 Ga0496106_0069874 3300048909 Bacteria 2681
365 Ga0496107_0124401 3300048910 Bacteria 1901
366 Ga0496108_0020825 3300048911 Bacteria 5393
367 Ga0496109_0009793 3300048912 Bacteria 8181
368 Ga0496111_1068864 3300048914 Bacteria 576
369 Ga0496112_0044852 3300048915 Bacteria 4333
370 Ga0496114_1013117 3300048917 Bacteria 714
371 Ga0501298_137923 3300049521 Bacteria 588
372 Ga0501032_0732859 3300049569 Bacteria 626
373 Ga0501047_0008756 3300049581 Bacteria 9549
374 Ga0501067_0015098 3300049583 Bacteria 4274
375 Ga0501068_0055003 3300049584 Bacteria 2411
376 Ga0501068_0244056 3300049584 Bacteria 1143
377 Ga0501069_0002685 3300049585 Bacteria 9086
378 Ga0501069_0046458 3300049585 Bacteria 2408
379 Ga0501069_0071457 3300049585 Bacteria 1945
380 Ga0501070_0000027 3300049586 Bacteria 141004
381 Ga0501070_0096684 3300049586 Bacteria 2443
382 Ga0501073_0018237 3300049589 Bacteria 5071
383 Ga0501073_0374892 3300049589 Bacteria 983
384 Ga0501074_0134428 3300049590 Bacteria 1769
385 Ga0501077_0088340 3300049593 Bacteria 1964
386 Ga0501080_0001889 3300049742 Bacteria 18033
387 Ga0501080_0261560 3300049742 Bacteria 1576
388 Ga0501080_0297516 3300049742 Bacteria 1464
389 Ga0501081_0553893 3300049743 Bacteria 859
390 Ga0501083_0003077 3300049744 Bacteria 11594
391 Ga0501035_0480021 3300049822 Bacteria 1025
392 nmdc:mga06z11_721016_c1 3300050494 Bacteria 607
393 nmdc:mga07m45_675317_c1 3300050496 Bacteria 595
394 nmdc:mga08y16_1149451_c1 3300050511 Bacteria 749
395 nmdc:mga08y16_1473437_c1 3300050511 Bacteria 642
396 nmdc:mga08y16_325405_c1 3300050511 Bacteria 1582
397 nmdc:mga0n895_469493_c1 3300050512 Bacteria 1269
398 Ga0495619_0364069 3300053085 Bacteria 1000
399 Ga0500555_015928 3300053103 Bacteria 2166
400 Ga0500588_0020176 3300053146 Bacteria 1783
401 Ga0501084_0139928 3300054114 Bacteria 2038
402 Ga0590075_008361 3300059424 Bacteria 2471
403 Ga0501082_0038444 3300060353 Bacteria 4129
404 Ga0501082_1282494 3300060353 Bacteria 640
405 Ga0530510_0054825 3300061734 Bacteria 2881

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005337 Ga0070682_101600957 Ga0070682_1016009571 119
2 3300014325 Ga0163163_10290331 Ga0163163_102903313 119
3 3300005546 Ga0070696_100011318 Ga0070696_1000113183 120
4 3300028794 Ga0307515_10355562 Ga0307515_103555622 120
5 3300031616 Ga0307508_10002651 Ga0307508_100026517 120
6 3300031730 Ga0307516_10005282 Ga0307516_1000528214 120
7 3300031911 Ga0307412_11962410 Ga0307412_119624101 120
8 3300005328 Ga0070676_10014844 Ga0070676_100148443 121
9 3300005330 Ga0070690_100097149 Ga0070690_1000971492 121
10 3300005331 Ga0070670_100041614 Ga0070670_1000416143 121
11 3300005331 Ga0070670_101441438 Ga0070670_1014414382 121
12 3300005334 Ga0068869_100002869 Ga0068869_1000028696 121
13 3300005335 Ga0070666_10000818 Ga0070666_100008189 121
14 3300005338 Ga0068868_100084942 Ga0068868_1000849423 121
15 3300005340 Ga0070689_100108605 Ga0070689_1001086053 121
16 3300005343 Ga0070687_100631110 Ga0070687_1006311102 121
17 3300005347 Ga0070668_100003452 Ga0070668_1000034529 121
18 3300005353 Ga0070669_100001988 Ga0070669_1000019886 121
19 3300005354 Ga0070675_100002005 Ga0070675_1000020053 121
20 3300005355 Ga0070671_100014821 Ga0070671_1000148215 121
21 3300005355 Ga0070671_100340125 Ga0070671_1003401252 121
22 3300005356 Ga0070674_100018479 Ga0070674_1000184793 121
23 3300005364 Ga0070673_100006569 Ga0070673_1000065695 121
24 3300005365 Ga0070688_100118624 Ga0070688_1001186242 121
25 3300005367 Ga0070667_100000924 Ga0070667_1000009245 121
26 3300005456 Ga0070678_100000969 Ga0070678_1000009693 121
27 3300005459 Ga0068867_100000370 Ga0068867_10000037021 121
28 3300005466 Ga0070685_10196082 Ga0070685_101960822 121
29 3300005543 Ga0070672_100002488 Ga0070672_1000024887 121
30 3300005548 Ga0070665_100001475 Ga0070665_1000014755 121
31 3300005617 Ga0068859_100000699 Ga0068859_10000069912 121
32 3300005618 Ga0068864_100008802 Ga0068864_1000088025 121
33 3300005718 Ga0068866_10457664 Ga0068866_104576642 121
34 3300005719 Ga0068861_100101238 Ga0068861_1001012382 121
35 3300005840 Ga0068870_10140435 Ga0068870_101404352 121
36 3300005841 Ga0068863_100013566 Ga0068863_1000135665 121
37 3300005842 Ga0068858_100005884 Ga0068858_1000058847 121
38 3300005843 Ga0068860_100001362 Ga0068860_10000136227 121
39 3300006237 Ga0097621_100002576 Ga0097621_1000025767 121
40 3300006358 Ga0068871_100001652 Ga0068871_1000016523 121
41 3300006881 Ga0068865_100001859 Ga0068865_1000018595 121
42 3300006931 Ga0097620_100000699 Ga0097620_10000069927 121
43 3300009098 Ga0105245_10756032 Ga0105245_107560322 121
44 3300009148 Ga0105243_10076410 Ga0105243_100764102 121
45 3300009177 Ga0105248_10012105 Ga0105248_100121059 121
46 3300009553 Ga0105249_11811159 Ga0105249_118111591 121
47 3300013296 Ga0157374_10006404 Ga0157374_100064048 121
48 3300013306 Ga0163162_10014111 Ga0163162_100141113 121
49 3300013308 Ga0157375_10015212 Ga0157375_100152123 121
50 3300014968 Ga0157379_10006476 Ga0157379_1000647611 121
51 3300014969 Ga0157376_10041240 Ga0157376_100412405 121
52 3300017792 Ga0163161_10015440 Ga0163161_100154403 121
53 3300025893 Ga0207682_10162114 Ga0207682_101621142 121
54 3300025903 Ga0207680_10040136 Ga0207680_100401363 121
55 3300025907 Ga0207645_10001888 Ga0207645_100018887 121
56 3300025918 Ga0207662_10976684 Ga0207662_109766842 121
57 3300025923 Ga0207681_10012683 Ga0207681_100126836 121
58 3300025925 Ga0207650_10008881 Ga0207650_100088815 121
59 3300025925 Ga0207650_10143617 Ga0207650_101436172 121
60 3300025926 Ga0207659_10000389 Ga0207659_100003893 121
61 3300025927 Ga0207687_10894268 Ga0207687_108942682 121
62 3300025931 Ga0207644_10120792 Ga0207644_101207922 121
63 3300025936 Ga0207670_10113503 Ga0207670_101135032 121
64 3300025937 Ga0207669_10010407 Ga0207669_100104073 121
65 3300025938 Ga0207704_10005028 Ga0207704_100050285 121
66 3300025940 Ga0207691_10000458 Ga0207691_100004586 121
67 3300025941 Ga0207711_10009514 Ga0207711_100095147 121
68 3300025942 Ga0207689_10004386 Ga0207689_100043868 121
69 3300025960 Ga0207651_10012496 Ga0207651_100124964 121
70 3300025961 Ga0207712_10443864 Ga0207712_104438641 121
71 3300025972 Ga0207668_10002126 Ga0207668_100021263 121
72 3300025986 Ga0207658_10004044 Ga0207658_100040449 121
73 3300026023 Ga0207677_10038827 Ga0207677_100388273 121
74 3300026035 Ga0207703_10017833 Ga0207703_100178332 121
75 3300026088 Ga0207641_10000588 Ga0207641_100005886 121
76 3300026089 Ga0207648_10001118 Ga0207648_1000111822 121
77 3300026095 Ga0207676_10003905 Ga0207676_100039059 121
78 3300026121 Ga0207683_10000076 Ga0207683_1000007611 121
79 3300028379 Ga0268266_10003689 Ga0268266_100036893 121
80 3300028381 Ga0268264_10002742 Ga0268264_100027423 121
81 3300035691 Ga0373931_0967874 Ga0373931_0967874_67_432 121
82 3300041492 Ga0451835_0829313 Ga0451835_0829313_196_561 121
83 3300046459 Ga0495629_0712828 Ga0495629_0712828_285_650 121
84 3300046683 Ga0495658_0192698 Ga0495658_0192698_31_396 121
85 3300047317 Ga0495604_0384480 Ga0495604_0384480_39_404 121
86 3300048903 Ga0496100_0081044 Ga0496100_0081044_873_1238 121
87 3300048905 Ga0496102_1301369 Ga0496102_1301369_125_490 121
88 3300048910 Ga0496107_0124401 Ga0496107_0124401_319_684 121
89 3300048911 Ga0496108_0020825 Ga0496108_0020825_1630_1995 121
90 3300035114 Ga0373939_0358403 Ga0373939_0358403_14_382 122
91 3300009098 Ga0105245_10191287 Ga0105245_101912872 126
92 3300025927 Ga0207687_10141119 Ga0207687_101411192 126
93 3300005548 Ga0070665_100839514 Ga0070665_1008395142 127
94 3300005618 Ga0068864_101894110 Ga0068864_1018941101 127
95 3300013104 Ga0157370_10812154 Ga0157370_108121541 127
96 3300026118 Ga0207675_102290106 Ga0207675_1022901061 127
97 3300028379 Ga0268266_11060741 Ga0268266_110607412 127
98 3300032005 Ga0307411_12121637 Ga0307411_121216371 127
99 3300041486 Ga0451807_2348342 Ga0451807_2348342_138_521 127
100 3300050494 nmdc:mga06z11_721016_c1 nmdc:mga06z11_721016_c1_22_405 127
101 3300053103 Ga0500555_015928 Ga0500555_015928_436_819 127
102 2162886012 MBSR1b_contig_1166386 MBSR1b_0086.00002170 128
103 2162886012 MBSR1b_contig_2865194 MBSR1b_0785.00004430 128
104 3300001991 JGI24743J22301_10023691 JGI24743J22301_100236913 128
105 3300002073 JGI24745J21846_1007364 JGI24745J21846_10073642 128
106 3300002076 JGI24749J21850_1004601 JGI24749J21850_10046013 128
107 3300002077 JGI24744J21845_10016069 JGI24744J21845_100160692 128
108 3300005327 Ga0070658_10001909 Ga0070658_1000190920 128
109 3300005327 Ga0070658_10014530 Ga0070658_100145303 128
110 3300005328 Ga0070676_10006254 Ga0070676_100062545 128
111 3300005329 Ga0070683_100015855 Ga0070683_10001585511 128
112 3300005329 Ga0070683_100684951 Ga0070683_1006849511 128
113 3300005329 Ga0070683_101726336 Ga0070683_1017263362 128
114 3300005330 Ga0070690_100002004 Ga0070690_10000200414 128
115 3300005331 Ga0070670_100295793 Ga0070670_1002957932 128
116 3300005333 Ga0070677_10000065 Ga0070677_1000006511 128
117 3300005334 Ga0068869_100046853 Ga0068869_1000468534 128
118 3300005335 Ga0070666_10024904 Ga0070666_100249045 128
119 3300005336 Ga0070680_100209795 Ga0070680_1002097952 128
120 3300005337 Ga0070682_100004623 Ga0070682_1000046232 128
121 3300005337 Ga0070682_100179090 Ga0070682_1001790901 128
122 3300005337 Ga0070682_100739512 Ga0070682_1007395121 128
123 3300005338 Ga0068868_100010629 Ga0068868_1000106292 128
124 3300005338 Ga0068868_100110768 Ga0068868_1001107682 128
125 3300005338 Ga0068868_101138663 Ga0068868_1011386631 128
126 3300005338 Ga0068868_101638510 Ga0068868_1016385102 128
127 3300005339 Ga0070660_100001727 Ga0070660_1000017272 128
128 3300005339 Ga0070660_100363073 Ga0070660_1003630733 128
129 3300005340 Ga0070689_100227406 Ga0070689_1002274062 128
130 3300005343 Ga0070687_100009554 Ga0070687_1000095544 128
131 3300005343 Ga0070687_100122973 Ga0070687_1001229732 128
132 3300005344 Ga0070661_100012516 Ga0070661_1000125166 128
133 3300005345 Ga0070692_10032577 Ga0070692_100325774 128
134 3300005353 Ga0070669_100062384 Ga0070669_1000623842 128
135 3300005354 Ga0070675_100111796 Ga0070675_1001117962 128
136 3300005355 Ga0070671_100010855 Ga0070671_1000108556 128
137 3300005355 Ga0070671_101126022 Ga0070671_1011260222 128
138 3300005356 Ga0070674_100009991 Ga0070674_1000099914 128
139 3300005364 Ga0070673_100013092 Ga0070673_1000130926 128
140 3300005365 Ga0070688_100000751 Ga0070688_1000007512 128
141 3300005366 Ga0070659_100009060 Ga0070659_1000090602 128
142 3300005366 Ga0070659_100063270 Ga0070659_1000632703 128
143 3300005367 Ga0070667_100233260 Ga0070667_1002332602 128
144 3300005406 Ga0070703_10086193 Ga0070703_100861932 128
145 3300005438 Ga0070701_10009212 Ga0070701_100092128 128
146 3300005438 Ga0070701_11251266 Ga0070701_112512661 128
147 3300005440 Ga0070705_100001864 Ga0070705_1000018649 128
148 3300005440 Ga0070705_101054007 Ga0070705_1010540072 128
149 3300005441 Ga0070700_100340541 Ga0070700_1003405412 128
150 3300005441 Ga0070700_100409777 Ga0070700_1004097771 128
151 3300005455 Ga0070663_100001408 Ga0070663_1000014083 128
152 3300005456 Ga0070678_100063015 Ga0070678_1000630152 128
153 3300005456 Ga0070678_100231739 Ga0070678_1002317392 128
154 3300005457 Ga0070662_100006588 Ga0070662_1000065886 128
155 3300005458 Ga0070681_10148487 Ga0070681_101484872 128
156 3300005459 Ga0068867_100001116 Ga0068867_1000011163 128
157 3300005459 Ga0068867_100723192 Ga0068867_1007231922 128
158 3300005466 Ga0070685_10000339 Ga0070685_1000033925 128
159 3300005468 Ga0070707_100597442 Ga0070707_1005974422 128
160 3300005530 Ga0070679_100326194 Ga0070679_1003261943 128
161 3300005535 Ga0070684_100001468 Ga0070684_1000014686 128
162 3300005535 Ga0070684_100029696 Ga0070684_1000296968 128
163 3300005535 Ga0070684_100763829 Ga0070684_1007638292 128
164 3300005539 Ga0068853_100005141 Ga0068853_1000051418 128
165 3300005543 Ga0070672_100032730 Ga0070672_1000327304 128
166 3300005543 Ga0070672_101240434 Ga0070672_1012404342 128
167 3300005544 Ga0070686_100000321 Ga0070686_10000032118 128
168 3300005547 Ga0070693_100000957 Ga0070693_10000095716 128
169 3300005548 Ga0070665_100382218 Ga0070665_1003822183 128
170 3300005548 Ga0070665_101884714 Ga0070665_1018847142 128
171 3300005549 Ga0070704_101053083 Ga0070704_1010530831 128
172 3300005563 Ga0068855_100000068 Ga0068855_10000006872 128
173 3300005563 Ga0068855_100004620 Ga0068855_10000462023 128
174 3300005563 Ga0068855_100215803 Ga0068855_1002158032 128
175 3300005563 Ga0068855_101278516 Ga0068855_1012785162 128
176 3300005564 Ga0070664_100011858 Ga0070664_1000118584 128
177 3300005577 Ga0068857_100021570 Ga0068857_1000215706 128
178 3300005577 Ga0068857_101748525 Ga0068857_1017485252 128
179 3300005578 Ga0068854_100000649 Ga0068854_10000064920 128
180 3300005578 Ga0068854_100896738 Ga0068854_1008967381 128
181 3300005614 Ga0068856_100052358 Ga0068856_1000523586 128
182 3300005614 Ga0068856_100814988 Ga0068856_1008149882 128
183 3300005615 Ga0070702_100101130 Ga0070702_1001011303 128
184 3300005615 Ga0070702_100128340 Ga0070702_1001283403 128
185 3300005616 Ga0068852_100004965 Ga0068852_1000049658 128
186 3300005617 Ga0068859_100108592 Ga0068859_1001085923 128
187 3300005618 Ga0068864_100076767 Ga0068864_1000767674 128
188 3300005718 Ga0068866_10000626 Ga0068866_1000062619 128
189 3300005719 Ga0068861_100001208 Ga0068861_10000120820 128
190 3300005719 Ga0068861_100551854 Ga0068861_1005518542 128
191 3300005834 Ga0068851_10017938 Ga0068851_100179382 128
192 3300005840 Ga0068870_10000035 Ga0068870_100000356 128
193 3300005841 Ga0068863_100003321 Ga0068863_1000033214 128
194 3300005841 Ga0068863_100995013 Ga0068863_1009950132 128
195 3300005842 Ga0068858_100049809 Ga0068858_1000498096 128
196 3300005843 Ga0068860_100141521 Ga0068860_1001415212 128
197 3300005844 Ga0068862_100020865 Ga0068862_1000208658 128
198 3300005844 Ga0068862_100838254 Ga0068862_1008382542 128
199 3300005844 Ga0068862_102136166 Ga0068862_1021361661 128
200 3300005937 Ga0081455_10024922 Ga0081455_100249221 128
201 3300006163 Ga0070715_10942103 Ga0070715_109421031 128
202 3300006195 Ga0075366_10109938 Ga0075366_101099382 128
203 3300006237 Ga0097621_100006302 Ga0097621_1000063026 128
204 3300006237 Ga0097621_100089657 Ga0097621_1000896573 128
205 3300006353 Ga0075370_10235008 Ga0075370_102350082 128
206 3300006358 Ga0068871_100007381 Ga0068871_1000073814 128
207 3300006871 Ga0075434_101256011 Ga0075434_1012560112 128
208 3300006881 Ga0068865_100025611 Ga0068865_1000256112 128
209 3300006881 Ga0068865_100068846 Ga0068865_1000688463 128
210 3300006931 Ga0097620_100108587 Ga0097620_1001085873 128
211 3300009093 Ga0105240_10001794 Ga0105240_1000179418 128
212 3300009094 Ga0111539_10382358 Ga0111539_103823581 128
213 3300009094 Ga0111539_11551158 Ga0111539_115511581 128
214 3300009098 Ga0105245_10006833 Ga0105245_100068335 128
215 3300009101 Ga0105247_10000863 Ga0105247_1000086323 128
216 3300009148 Ga0105243_10014879 Ga0105243_100148794 128
217 3300009174 Ga0105241_10000244 Ga0105241_1000024429 128
218 3300009176 Ga0105242_10003018 Ga0105242_1000301818 128
219 3300009176 Ga0105242_11369384 Ga0105242_113693842 128
220 3300009177 Ga0105248_10150092 Ga0105248_101500924 128
221 3300009545 Ga0105237_10000050 Ga0105237_10000050125 128
222 3300009545 Ga0105237_10001821 Ga0105237_100018216 128
223 3300009551 Ga0105238_10000705 Ga0105238_100007056 128
224 3300009551 Ga0105238_10009993 Ga0105238_100099937 128
225 3300009553 Ga0105249_10000549 Ga0105249_100005495 128
226 3300010375 Ga0105239_10020787 Ga0105239_100207875 128
227 3300010375 Ga0105239_10034279 Ga0105239_100342795 128
228 3300010375 Ga0105239_11618797 Ga0105239_116187971 128
229 3300011119 Ga0105246_10004199 Ga0105246_1000419912 128
230 3300013100 Ga0157373_10008204 Ga0157373_100082049 128
231 3300013102 Ga0157371_10002774 Ga0157371_1000277421 128
232 3300013104 Ga0157370_10303705 Ga0157370_103037054 128
233 3300013105 Ga0157369_10001108 Ga0157369_1000110820 128
234 3300013296 Ga0157374_10001654 Ga0157374_1000165420 128
235 3300013297 Ga0157378_10001798 Ga0157378_100017989 128
236 3300013306 Ga0163162_10002320 Ga0163162_1000232020 128
237 3300013307 Ga0157372_10016419 Ga0157372_100164195 128
238 3300013308 Ga0157375_10045089 Ga0157375_100450896 128
239 3300014325 Ga0163163_10335341 Ga0163163_103353411 128
240 3300014325 Ga0163163_10886889 Ga0163163_108868891 128
241 3300014326 Ga0157380_10044322 Ga0157380_100443224 128
242 3300014745 Ga0157377_10018494 Ga0157377_100184946 128
243 3300014968 Ga0157379_10001549 Ga0157379_1000154921 128
244 3300014969 Ga0157376_10002532 Ga0157376_100025325 128
245 3300014969 Ga0157376_12738309 Ga0157376_127383091 128
246 3300025315 Ga0207697_10000520 Ga0207697_1000052015 128
247 3300025321 Ga0207656_10000802 Ga0207656_1000080211 128
248 3300025885 Ga0207653_10155433 Ga0207653_101554332 128
249 3300025893 Ga0207682_10008703 Ga0207682_100087036 128
250 3300025899 Ga0207642_10014340 Ga0207642_100143404 128
251 3300025901 Ga0207688_10000098 Ga0207688_1000009814 128
252 3300025903 Ga0207680_10016444 Ga0207680_100164446 128
253 3300025904 Ga0207647_10011704 Ga0207647_100117047 128
254 3300025907 Ga0207645_10000055 Ga0207645_1000005540 128
255 3300025908 Ga0207643_10000054 Ga0207643_1000005444 128
256 3300025909 Ga0207705_10002159 Ga0207705_100021599 128
257 3300025909 Ga0207705_10161762 Ga0207705_101617622 128
258 3300025911 Ga0207654_10083008 Ga0207654_100830083 128
259 3300025913 Ga0207695_10236746 Ga0207695_102367462 128
260 3300025914 Ga0207671_10031518 Ga0207671_100315186 128
261 3300025918 Ga0207662_10000418 Ga0207662_1000041821 128
262 3300025919 Ga0207657_10000070 Ga0207657_1000007063 128
263 3300025919 Ga0207657_10457847 Ga0207657_104578471 128
264 3300025920 Ga0207649_10005707 Ga0207649_100057079 128
265 3300025921 Ga0207652_10001423 Ga0207652_1000142318 128
266 3300025924 Ga0207694_10006446 Ga0207694_100064463 128
267 3300025925 Ga0207650_10013666 Ga0207650_100136666 128
268 3300025926 Ga0207659_10000136 Ga0207659_100001366 128
269 3300025927 Ga0207687_10066209 Ga0207687_100662093 128
270 3300025931 Ga0207644_10011800 Ga0207644_100118006 128
271 3300025931 Ga0207644_10792526 Ga0207644_107925262 128
272 3300025932 Ga0207690_10043956 Ga0207690_100439563 128
273 3300025932 Ga0207690_10047307 Ga0207690_100473074 128
274 3300025933 Ga0207706_10000094 Ga0207706_1000009462 128
275 3300025934 Ga0207686_10067871 Ga0207686_100678713 128
276 3300025934 Ga0207686_10705521 Ga0207686_107055212 128
277 3300025935 Ga0207709_10062906 Ga0207709_100629064 128
278 3300025936 Ga0207670_10000420 Ga0207670_1000042027 128
279 3300025936 Ga0207670_10281243 Ga0207670_102812433 128
280 3300025936 Ga0207670_10451019 Ga0207670_104510193 128
281 3300025937 Ga0207669_10033611 Ga0207669_100336113 128
282 3300025937 Ga0207669_10985191 Ga0207669_109851912 128
283 3300025938 Ga0207704_10002966 Ga0207704_100029666 128
284 3300025940 Ga0207691_10000173 Ga0207691_1000017362 128
285 3300025941 Ga0207711_10007180 Ga0207711_100071809 128
286 3300025942 Ga0207689_10000287 Ga0207689_1000028711 128
287 3300025942 Ga0207689_10415036 Ga0207689_104150362 128
288 3300025944 Ga0207661_10826265 Ga0207661_108262652 128
289 3300025945 Ga0207679_10010799 Ga0207679_100107996 128
290 3300025949 Ga0207667_10000057 Ga0207667_1000005774 128
291 3300025949 Ga0207667_10018498 Ga0207667_100184986 128
292 3300025949 Ga0207667_10755411 Ga0207667_107554112 128
293 3300025960 Ga0207651_10008774 Ga0207651_100087746 128
294 3300025961 Ga0207712_10001006 Ga0207712_1000100620 128
295 3300025972 Ga0207668_10098508 Ga0207668_100985084 128
296 3300025981 Ga0207640_10181265 Ga0207640_101812652 128
297 3300025986 Ga0207658_10124912 Ga0207658_101249123 128
298 3300025986 Ga0207658_11155069 Ga0207658_111550692 128
299 3300026023 Ga0207677_10004842 Ga0207677_100048425 128
300 3300026023 Ga0207677_10004851 Ga0207677_1000485110 128
301 3300026023 Ga0207677_11785273 Ga0207677_117852731 128
302 3300026035 Ga0207703_10045057 Ga0207703_100450574 128
303 3300026067 Ga0207678_10155759 Ga0207678_101557593 128
304 3300026067 Ga0207678_11599232 Ga0207678_115992321 128
305 3300026075 Ga0207708_10020333 Ga0207708_100203339 128
306 3300026078 Ga0207702_10077083 Ga0207702_100770834 128
307 3300026078 Ga0207702_10369131 Ga0207702_103691312 128
308 3300026078 Ga0207702_12232322 Ga0207702_122323221 128
309 3300026088 Ga0207641_10022714 Ga0207641_100227146 128
310 3300026089 Ga0207648_10000247 Ga0207648_1000024752 128
311 3300026089 Ga0207648_10328060 Ga0207648_103280602 128
312 3300026089 Ga0207648_10444268 Ga0207648_104442682 128
313 3300026095 Ga0207676_10018877 Ga0207676_100188775 128
314 3300026116 Ga0207674_10000426 Ga0207674_1000042647 128
315 3300026116 Ga0207674_10122409 Ga0207674_101224093 128
316 3300026116 Ga0207674_12025970 Ga0207674_120259701 128
317 3300026118 Ga0207675_100000063 Ga0207675_10000006362 128
318 3300026118 Ga0207675_100608496 Ga0207675_1006084962 128
319 3300026118 Ga0207675_102712045 Ga0207675_1027120451 128
320 3300026121 Ga0207683_10000053 Ga0207683_1000005347 128
321 3300026142 Ga0207698_10824612 Ga0207698_108246122 128
322 3300028379 Ga0268266_10001038 Ga0268266_100010386 128
323 3300028379 Ga0268266_11362225 Ga0268266_113622251 128
324 3300028380 Ga0268265_10002440 Ga0268265_1000244011 128
325 3300028380 Ga0268265_10593560 Ga0268265_105935602 128
326 3300028381 Ga0268264_10000986 Ga0268264_1000098634 128
327 3300031240 Ga0265320_10162775 Ga0265320_101627752 128
328 3300031456 Ga0307513_10529073 Ga0307513_105290731 128
329 3300031595 Ga0265313_10022826 Ga0265313_100228264 128
330 3300031712 Ga0265342_10182823 Ga0265342_101828232 128
331 3300031727 Ga0316576_10172450 Ga0316576_101724502 128
332 3300035172 Ga0373955_0479609 Ga0373955_0479609_222_608 128
333 3300035172 Ga0373955_0536817 Ga0373955_0536817_36_422 128
334 3300035207 Ga0373942_0377480 Ga0373942_0377480_25_411 128
335 3300035691 Ga0373931_0961391 Ga0373931_0961391_158_544 128
336 3300035724 Ga0373933_0490185 Ga0373933_0490185_228_623 128
337 3300036401 Ga0373937_0031189 Ga0373937_0031189_2157_2543 128
338 3300036712 Ga0316584_1161259 Ga0316584_1161259_71_457 128
339 3300037068 Ga0373925_0067172 Ga0373925_0067172_623_1012 128
340 3300039450 Ga0436363_0952977 Ga0436363_0952977_65_451 128
341 3300041441 Ga0451787_009067 Ga0451787_009067_83_475 128
342 3300041443 Ga0451789_0495495 Ga0451789_0495495_315_704 128
343 3300041451 Ga0451791_1036239 Ga0451791_1036239_304_699 128
344 3300041453 Ga0451797_0324340 Ga0451797_0324340_18_407 128
345 3300041453 Ga0451797_0546333 Ga0451797_0546333_67_453 128
346 3300041460 Ga0451802_1526005 Ga0451802_1526005_126_518 128
347 3300041486 Ga0451807_0722221 Ga0451807_0722221_269_661 128
348 3300041491 Ga0451833_0341865 Ga0451833_0341865_266_655 128
349 3300041507 Ga0451851_1378516 Ga0451851_1378516_286_675 128
350 3300041509 Ga0451843_0759686 Ga0451843_0759686_1041_1430 128
351 3300041509 Ga0451843_1289718 Ga0451843_1289718_333_722 128
352 3300041512 Ga0451853_2588786 Ga0451853_2588786_211_603 128
353 3300041512 Ga0451853_3068750 Ga0451853_3068750_300_689 128
354 3300042004 Ga0439445_0122839 Ga0439445_0122839_304_690 128
355 3300042004 Ga0439445_0146541 Ga0439445_0146541_24_413 128
356 3300045051 Ga0451576_0733144 Ga0451576_0733144_370_756 128
357 3300046476 Ga0495662_0682271 Ga0495662_0682271_39_425 128
358 3300046616 Ga0495668_0460651 Ga0495668_0460651_279_668 128
359 3300046663 Ga0495635_0503472 Ga0495635_0503472_215_601 128
360 3300046678 Ga0495599_0792967 Ga0495599_0792967_117_503 128
361 3300047315 Ga0495581_0417150 Ga0495581_0417150_88_474 128
362 3300047320 Ga0495672_0071330 Ga0495672_0071330_1464_1856 128
363 3300047321 Ga0495676_0563480 Ga0495676_0563480_282_668 128
364 3300047322 Ga0495680_0250825 Ga0495680_0250825_177_563 128
365 3300048903 Ga0496100_0456554 Ga0496100_0456554_315_701 128
366 3300048905 Ga0496102_0063988 Ga0496102_0063988_342_728 128
367 3300048906 Ga0496103_0283885 Ga0496103_0283885_577_963 128
368 3300048909 Ga0496106_0069874 Ga0496106_0069874_773_1159 128
369 3300048912 Ga0496109_0009793 Ga0496109_0009793_4108_4494 128
370 3300048914 Ga0496111_1068864 Ga0496111_1068864_117_503 128
371 3300048915 Ga0496112_0044852 Ga0496112_0044852_2886_3278 128
372 3300048917 Ga0496114_1013117 Ga0496114_1013117_303_689 128
373 3300049521 Ga0501298_137923 Ga0501298_137923_52_438 128
374 3300049569 Ga0501032_0732859 Ga0501032_0732859_170_556 128
375 3300049581 Ga0501047_0008756 Ga0501047_0008756_3559_3945 128
376 3300049583 Ga0501067_0015098 Ga0501067_0015098_3815_4201 128
377 3300049584 Ga0501068_0055003 Ga0501068_0055003_735_1121 128
378 3300049584 Ga0501068_0244056 Ga0501068_0244056_163_549 128
379 3300049585 Ga0501069_0002685 Ga0501069_0002685_5188_5574 128
380 3300049585 Ga0501069_0046458 Ga0501069_0046458_914_1300 128
381 3300049585 Ga0501069_0071457 Ga0501069_0071457_1063_1449 128
382 3300049586 Ga0501070_0000027 Ga0501070_0000027_57797_58183 128
383 3300049586 Ga0501070_0096684 Ga0501070_0096684_515_901 128
384 3300049589 Ga0501073_0018237 Ga0501073_0018237_1569_1955 128
385 3300049589 Ga0501073_0374892 Ga0501073_0374892_329_715 128
386 3300049590 Ga0501074_0134428 Ga0501074_0134428_159_545 128
387 3300049593 Ga0501077_0088340 Ga0501077_0088340_225_617 128
388 3300049742 Ga0501080_0001889 Ga0501080_0001889_3772_4158 128
389 3300049742 Ga0501080_0261560 Ga0501080_0261560_738_1124 128
390 3300049742 Ga0501080_0297516 Ga0501080_0297516_848_1234 128
391 3300049743 Ga0501081_0553893 Ga0501081_0553893_381_770 128
392 3300049744 Ga0501083_0003077 Ga0501083_0003077_2119_2505 128
393 3300049822 Ga0501035_0480021 Ga0501035_0480021_115_501 128
394 3300050496 nmdc:mga07m45_675317_c1 nmdc:mga07m45_675317_c1_54_440 128
395 3300050511 nmdc:mga08y16_1149451_c1 nmdc:mga08y16_1149451_c1_57_449 128
396 3300050511 nmdc:mga08y16_1473437_c1 nmdc:mga08y16_1473437_c1_61_447 128
397 3300050511 nmdc:mga08y16_325405_c1 nmdc:mga08y16_325405_c1_880_1266 128
398 3300050512 nmdc:mga0n895_469493_c1 nmdc:mga0n895_469493_c1_266_652 128
399 3300053085 Ga0495619_0364069 Ga0495619_0364069_522_908 128
400 3300053146 Ga0500588_0020176 Ga0500588_0020176_671_1060 128
401 3300054114 Ga0501084_0139928 Ga0501084_0139928_1324_1713 128
402 3300059424 Ga0590075_008361 Ga0590075_008361_460_852 128
403 3300060353 Ga0501082_0038444 Ga0501082_0038444_136_522 128
404 3300060353 Ga0501082_1282494 Ga0501082_1282494_70_459 128
405 3300061734 Ga0530510_0054825 Ga0530510_0054825_615_1001 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

1

121

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.9275 1 128
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.9131 1 128
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.802 6 124
4qb5-assembly1.cif.gz_A crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.767 4 126
2p7q-assembly4.cif.gz_C-2 crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid 0.7573 4 122
ID Description Score Start End Superfamily
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9275 1 128 3.10.180.10
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9131 1 128 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8657 67 125 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8441 66 126 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8192 66 126 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A2V1CTG9-F1-model_v4 VOC domain-containing protein 1.001 68 125
AF-A0A2H0UCP5-F1-model_v4 Glyoxalase 1 66 125
AF-M5CMF1-F1-model_v4 deleted 0.9994 67 128
AF-A0A3S1HQ61-F1-model_v4 VOC family protein 0.9986 66 128
AF-A0A4R3YNT8-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein 0.9974 76 128

Feature Viewer

pLDDT pTM Quality
94.62 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map