F435941

General Info

Members Datasets Scaffolds Average Seq Length
405 284 810 263

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10173435|Ga0157369_101734352
Length 289
Sequence MSIQGCGFDGVFVEARRRRGKMDVSNISDKKTALITGASGGIGLELAKLFARDGYNLVLVARDEGKLDHVKTQLEKRRGISVRTMPRDLADPSAPEEIFNELEQAGVQIDVLVNNAGYAMFDPFIEMDTQRVLDMLQVNIMALTHLSRLFLPGMVQRGHGRVLNLGSTASFLPGPLMACYYASKAYVLSFSEAIANELHGTGVTVTALCPGPTETGFQKRASIENSRLIKGRRIMDAATVARAGYKTLMAGKPLVIPGLSNKLIPLMTRISPRRLVPEVVKRSQERVDR

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
131 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
132 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
137 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
157 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
172 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
173 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
174 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
175 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
176 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
177 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
178 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
179 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
180 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
181 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
182 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
183 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
184 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
185 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
186 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
187 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
188 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
189 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
270 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
271 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 2739367656 Pedobacter sp. CF523 Isolate Unclassified
277 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
278 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
279 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
280 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
281 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
282 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
283 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
284 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.28
Metatranscriptomes 0.49
Isolates 2.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.73
Nodule 0
Rhizoplane 7.16
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 3.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10173435 3300013105 Unclassified 2271
2 JGI25152J39213_1000045 3300002773 Bacteria 86127
3 JGI25151J46595_10020331 3300003187 Bacteria 2801
4 rootH2_10045220 3300003320 Bacteria 7529
5 rootL2_10027395 3300003322 Bacteria 15216
6 Ga0065714_10003691 3300005288 Bacteria 8277
7 Ga0070676_10019859 3300005328 Bacteria 3743
8 Ga0070683_100011160 3300005329 Bacteria 7750
9 Ga0070690_100008843 3300005330 Bacteria 5817
10 Ga0070670_100029074 3300005331 Bacteria 4756
11 Ga0070670_100036588 3300005331 Bacteria 4224
12 Ga0070670_100064878 3300005331 Unclassified 3133
13 Ga0070677_10001321 3300005333 Bacteria 7927
14 Ga0070666_10011647 3300005335 Bacteria 5526
15 Ga0068868_100067343 3300005338 Bacteria 2850
16 Ga0070689_100008878 3300005340 Bacteria 7103
17 Ga0070689_100045661 3300005340 Bacteria 3374
18 Ga0070689_100140735 3300005340 Bacteria 1940
19 Ga0070691_10185498 3300005341 Bacteria 1085
20 Ga0070687_100005023 3300005343 Bacteria 5330
21 Ga0070692_10046591 3300005345 Bacteria 2241
22 Ga0070668_100010855 3300005347 Bacteria 6777
23 Ga0070668_100253431 3300005347 Bacteria 1462
24 Ga0070669_100006710 3300005353 Bacteria 8286
25 Ga0070669_100014561 3300005353 Bacteria 5595
26 Ga0070675_100006443 3300005354 Bacteria 9008
27 Ga0070675_100401543 3300005354 Bacteria 1223
28 Ga0070671_100033328 3300005355 Bacteria 4258
29 Ga0070671_100314476 3300005355 Bacteria 1334
30 Ga0070674_100002206 3300005356 Bacteria 10708
31 Ga0070674_100010646 3300005356 Bacteria 5571
32 Ga0070673_100000441 3300005364 Bacteria 21924
33 Ga0070673_100013630 3300005364 Bacteria 5631
34 Ga0070673_100090095 3300005364 Unclassified 2505
35 Ga0070673_100107270 3300005364 Bacteria 2310
36 Ga0070673_100285345 3300005364 Unclassified 1449
37 Ga0070688_100004000 3300005365 Bacteria 7642
38 Ga0070667_100189751 3300005367 Bacteria 1820
39 Ga0070709_10002953 3300005434 Bacteria 9154
40 Ga0070713_100129269 3300005436 Bacteria 2225
41 Ga0070701_10059349 3300005438 Bacteria 2011
42 Ga0070711_100070603 3300005439 Bacteria 2460
43 Ga0070705_100303565 3300005440 Bacteria 1145
44 Ga0070700_100006026 3300005441 Bacteria 6451
45 Ga0070694_100002489 3300005444 Bacteria 10873
46 Ga0070694_100150514 3300005444 Bacteria 1699
47 Ga0070708_100157829 3300005445 Bacteria 2113
48 Ga0070681_10187430 3300005458 Bacteria 1989
49 Ga0070699_100003639 3300005518 Bacteria 13638
50 Ga0070699_100016516 3300005518 Bacteria 6337
51 Ga0070679_100048934 3300005530 Bacteria 4211
52 Ga0070684_100001008 3300005535 Bacteria 20081
53 Ga0070684_100381763 3300005535 Bacteria 1298
54 Ga0070697_100110019 3300005536 Bacteria 2295
55 Ga0068853_100569779 3300005539 Bacteria 1074
56 Ga0070672_100062891 3300005543 Bacteria 2931
57 Ga0070672_100065067 3300005543 Bacteria 2883
58 Ga0070686_100011227 3300005544 Bacteria 5074
59 Ga0070695_100041800 3300005545 Bacteria 2907
60 Ga0070695_100089895 3300005545 Bacteria 2048
61 Ga0070665_100345910 3300005548 Bacteria 1492
62 Ga0070665_100787905 3300005548 Bacteria 964
63 Ga0068856_100184412 3300005614 Bacteria 2100
64 Ga0068852_100035891 3300005616 Bacteria 4141
65 Ga0068859_100715175 3300005617 Bacteria 1092
66 Ga0068866_10040992 3300005718 Bacteria 2295
67 Ga0068851_10120579 3300005834 Bacteria 1409
68 Ga0068863_100006501 3300005841 Bacteria 11466
69 Ga0068863_100359998 3300005841 Unclassified 1418
70 Ga0068858_100015788 3300005842 Bacteria 7103
71 Ga0068860_100402267 3300005843 Bacteria 1355
72 Ga0081538_10000234 3300005981 Bacteria 62458
73 Ga0075432_10006535 3300006058 Bacteria 3971
74 Ga0070716_100612152 3300006173 Bacteria 821
75 Ga0075428_100700615 3300006844 Bacteria 1079
76 Ga0075434_100103458 3300006871 Bacteria 2856
77 Ga0068865_100000739 3300006881 Bacteria 18321
78 Ga0075436_100005950 3300006914 Bacteria 8379
79 Ga0097620_100715143 3300006931 Bacteria 1092
80 Ga0075435_100174204 3300007076 Bacteria 1816
81 Ga0105251_10005090 3300009011 Bacteria 8701
82 Ga0105244_10010354 3300009036 Bacteria 5659
83 Ga0105244_10041107 3300009036 Bacteria 2397
84 Ga0105240_10172281 3300009093 Archaea 2562
85 Ga0111539_10103888 3300009094 Bacteria 3334
86 Ga0105245_10009099 3300009098 Bacteria 8656
87 Ga0105245_10016903 3300009098 Bacteria 6369
88 Ga0105243_10024683 3300009148 Bacteria 4587
89 Ga0105242_10115519 3300009176 Bacteria 2294
90 Ga0105242_10222457 3300009176 Bacteria 1688
91 Ga0105248_10020078 3300009177 Bacteria 7401
92 Ga0105249_10330594 3300009553 Bacteria 1538
93 Ga0105239_10675750 3300010375 Bacteria 1180
94 Ga0105246_10000183 3300011119 Bacteria 30768
95 Ga0105246_10059912 3300011119 Bacteria 2643
96 Ga0157371_10026923 3300013102 Bacteria 4174
97 Ga0157374_10220152 3300013296 Bacteria 1862
98 Ga0157378_10892274 3300013297 Bacteria 919
99 Ga0163162_10256309 3300013306 Bacteria 1881
100 Ga0163162_10809315 3300013306 Bacteria 1054
101 Ga0157372_10628905 3300013307 Bacteria 1251
102 Ga0163163_10172135 3300014325 Bacteria 2212
103 Ga0157377_10367670 3300014745 Bacteria 970
104 Ga0157379_10203307 3300014968 Unclassified 1791
105 Ga0157379_10404061 3300014968 Bacteria 1256
106 Ga0157376_10205961 3300014969 Bacteria 1813
107 Ga0163161_10119438 3300017792 Bacteria 1979
108 Ga0209129_1000068 3300025258 Bacteria 217385
109 Ga0209025_1000045 3300025294 Bacteria 349118
110 Ga0207655_1027882 3300025728 Bacteria 2677
111 Ga0207713_1061517 3300025735 Bacteria 1428
112 Ga0207682_10001889 3300025893 Bacteria 9516
113 Ga0207688_10020793 3300025901 Bacteria 3583
114 Ga0207680_10031973 3300025903 Bacteria 2986
115 Ga0207699_10192735 3300025906 Bacteria 1376
116 Ga0207645_10000377 3300025907 Bacteria 36714
117 Ga0207645_10000819 3300025907 Bacteria 26052
118 Ga0207643_10055867 3300025908 Bacteria 2245
119 Ga0207643_10095652 3300025908 Bacteria 1736
120 Ga0207695_10124792 3300025913 Archaea 2538
121 Ga0207695_10203604 3300025913 Bacteria 1892
122 Ga0207663_10000030 3300025916 Bacteria 98882
123 Ga0207662_10000555 3300025918 Bacteria 16606
124 Ga0207662_10207010 3300025918 Bacteria 1272
125 Ga0207652_10048204 3300025921 Bacteria 3641
126 Ga0207681_10002104 3300025923 Bacteria 12753
127 Ga0207681_10005368 3300025923 Bacteria 7873
128 Ga0207650_10005183 3300025925 Bacteria 8892
129 Ga0207650_10061197 3300025925 Unclassified 2811
130 Ga0207650_10095279 3300025925 Unclassified 2282
131 Ga0207659_10013433 3300025926 Bacteria 5244
132 Ga0207659_10078008 3300025926 Bacteria 2440
133 Ga0207687_10015662 3300025927 Bacteria 4975
134 Ga0207687_10018633 3300025927 Bacteria 4586
135 Ga0207700_10179836 3300025928 Bacteria 1770
136 Ga0207644_10030229 3300025931 Bacteria 3764
137 Ga0207644_10386425 3300025931 Bacteria 1142
138 Ga0207690_10164547 3300025932 Bacteria 1656
139 Ga0207706_10029721 3300025933 Bacteria 4877
140 Ga0207686_10119865 3300025934 Bacteria 1789
141 Ga0207709_10006383 3300025935 Bacteria 6620
142 Ga0207709_10008346 3300025935 Bacteria 5734
143 Ga0207709_10169891 3300025935 Bacteria 1529
144 Ga0207670_10100474 3300025936 Bacteria 2065
145 Ga0207669_10007856 3300025937 Bacteria 4968
146 Ga0207669_10014552 3300025937 Bacteria 3946
147 Ga0207704_10002564 3300025938 Bacteria 8196
148 Ga0207691_10000237 3300025940 Bacteria 53889
149 Ga0207691_10003433 3300025940 Bacteria 15414
150 Ga0207691_10047421 3300025940 Bacteria 3942
151 Ga0207691_10266136 3300025940 Bacteria 1477
152 Ga0207711_10354853 3300025941 Bacteria 1358
153 Ga0207689_10031536 3300025942 Bacteria 4411
154 Ga0207661_10105474 3300025944 Bacteria 2375
155 Ga0207651_10001305 3300025960 Bacteria 11237
156 Ga0207651_10021586 3300025960 Bacteria 3917
157 Ga0207651_10024891 3300025960 Bacteria 3711
158 Ga0207651_10156763 3300025960 Unclassified 1780
159 Ga0207712_10203755 3300025961 Bacteria 1570
160 Ga0207668_10013474 3300025972 Bacteria 5036
161 Ga0207668_10016744 3300025972 Bacteria 4582
162 Ga0207658_10120825 3300025986 Bacteria 2088
163 Ga0207677_10075679 3300026023 Bacteria 2393
164 Ga0207677_10111207 3300026023 Bacteria 2041
165 Ga0207703_10029396 3300026035 Bacteria 4336
166 Ga0207703_10124909 3300026035 Unclassified 2214
167 Ga0207639_10116143 3300026041 Bacteria 2190
168 Ga0207708_10004009 3300026075 Bacteria 10832
169 Ga0207648_10002399 3300026089 Bacteria 20182
170 Ga0207676_10163596 3300026095 Bacteria 1931
171 Ga0207675_100253092 3300026118 Bacteria 1705
172 Ga0207683_10002627 3300026121 Bacteria 15705
173 Ga0207698_10043766 3300026142 Bacteria 3358
174 Ga0207698_10399276 3300026142 Bacteria 1313
175 Ga0207428_10036476 3300027907 Bacteria 4010
176 Ga0207428_10057313 3300027907 Bacteria 3093
177 Ga0265319_1000212 3300028563 Bacteria 43934
178 Ga0265318_10001391 3300028577 Bacteria 14367
179 Ga0265318_10004733 3300028577 Bacteria 6521
180 Ga0265338_10089258 3300028800 Bacteria 2555
181 Ga0316177_1129844 3300030731 Bacteria 4906
182 Ga0316176_1029780 3300030732 Bacteria 6393
183 Ga0265330_10000072 3300031235 Bacteria 87680
184 Ga0265332_10000194 3300031238 Bacteria 49527
185 Ga0265332_10008221 3300031238 Bacteria 4691
186 Ga0265332_10016540 3300031238 Bacteria 3255
187 Ga0265332_10055861 3300031238 Bacteria 1692
188 Ga0265328_10033877 3300031239 Bacteria 1892
189 Ga0265328_10039308 3300031239 Bacteria 1746
190 Ga0265328_10069408 3300031239 Bacteria 1295
191 Ga0265320_10000038 3300031240 Bacteria 135648
192 Ga0265320_10004956 3300031240 Bacteria 8635
193 Ga0265329_10000395 3300031242 Bacteria 22924
194 Ga0265340_10000247 3300031247 Bacteria 28096
195 Ga0265340_10158229 3300031247 Bacteria 1030
196 Ga0265339_10000574 3300031249 Bacteria 28702
197 Ga0265339_10004397 3300031249 Bacteria 9613
198 Ga0265331_10000421 3300031250 Bacteria 42955
199 Ga0265331_10000593 3300031250 Bacteria 32186
200 Ga0265316_10001992 3300031344 Bacteria 21501
201 Ga0265316_10006517 3300031344 Bacteria 11133
202 Ga0307513_10188960 3300031456 Bacteria 1914
203 Ga0307408_100054381 3300031548 Bacteria 2894
204 Ga0307408_100105290 3300031548 Bacteria 2156
205 Ga0307408_100184258 3300031548 Bacteria 1677
206 Ga0307408_100570141 3300031548 Bacteria 1001
207 Ga0265313_10001473 3300031595 Bacteria 21929
208 Ga0265313_10018222 3300031595 Bacteria 3951
209 Ga0265314_10000114 3300031711 Bacteria 124126
210 Ga0265314_10025386 3300031711 Bacteria 4470
211 Ga0265314_10064091 3300031711 Bacteria 2490
212 Ga0265342_10000268 3300031712 Bacteria 58391
213 Ga0265342_10005502 3300031712 Bacteria 9631
214 Ga0307405_10015859 3300031731 Bacteria 4092
215 Ga0307413_10029273 3300031824 Bacteria 3079
216 Ga0307413_10193310 3300031824 Bacteria 1463
217 Ga0307413_10575789 3300031824 Bacteria 917
218 Ga0307410_10188084 3300031852 Bacteria 1568
219 Ga0307410_10319228 3300031852 Bacteria 1232
220 Ga0307407_10054095 3300031903 Bacteria 2313
221 Ga0307412_10024114 3300031911 Bacteria 3752
222 Ga0307412_10038885 3300031911 Bacteria 3067
223 Ga0307412_10182268 3300031911 Bacteria 1581
224 Ga0307409_100317545 3300031995 Bacteria 1456
225 Ga0307409_100731691 3300031995 Bacteria 991
226 Ga0307409_100795732 3300031995 Bacteria 953
227 Ga0307416_100027181 3300032002 Bacteria 4232
228 Ga0307414_10261950 3300032004 Bacteria 1443
229 Ga0307411_10131864 3300032005 Bacteria 1828
230 Ga0307415_100054241 3300032126 Bacteria 2735
231 Ga0307415_100557672 3300032126 Bacteria 1012
232 Ga0316583_10032669 3300032133 Bacteria 1850
233 Ga0373950_0000066 3300034818 Bacteria 56598
234 Ga0373945_0038673 3300035116 Bacteria 1717
235 Ga0373954_0011395 3300035118 Bacteria 3940
236 Ga0373956_0288509 3300035119 Bacteria 781
237 Ga0373957_0012487 3300035120 Bacteria 2862
238 Ga0373957_0074610 3300035120 Bacteria 1332
239 Ga0373946_0022865 3300035171 Bacteria 2438
240 Ga0373955_0029383 3300035172 Bacteria 2858
241 Ga0373955_0031377 3300035172 Bacteria 2783
242 Ga0373924_0154589 3300035410 Bacteria 1004
243 Ga0373931_0126550 3300035691 Bacteria 1466
244 Ga0373927_0205264 3300035695 Bacteria 1294
245 Ga0373933_0000146 3300035724 Bacteria 46109
246 Ga0373937_0000589 3300036401 Bacteria 32271
247 Ga0373937_0001766 3300036401 Bacteria 18169
248 Ga0373937_0073730 3300036401 Bacteria 3149
249 Ga0373937_0120193 3300036401 Unclassified 2448
250 Ga0373937_0131748 3300036401 Bacteria 2335
251 Ga0373937_0235254 3300036401 Bacteria 1725
252 Ga0395899_0289151 3300037312 Bacteria 1112
253 Ga0395901_0222076 3300038443 Bacteria 1975
254 Ga0439436_0002562 3300041404 Bacteria 5464
255 Ga0439436_0003611 3300041404 Bacteria 4709
256 Ga0439438_002886 3300041405 Bacteria 7145
257 Ga0439439_0000781 3300041406 Bacteria 5763
258 Ga0439461_0000624 3300041410 Bacteria 5106
259 Ga0439466_0000282 3300041411 Bacteria 19773
260 Ga0439466_0025540 3300041411 Bacteria 2062
261 Ga0439433_0000085 3300041999 Bacteria 12705
262 Ga0439442_000456 3300042002 Bacteria 9307
263 Ga0439442_001569 3300042002 Bacteria 4488
264 Ga0439442_002812 3300042002 Bacteria 3420
265 Ga0439432_000365 3300042006 Bacteria 16619
266 Ga0439449_0002002 3300042007 Bacteria 8008
267 Ga0439449_0008660 3300042007 Bacteria 3861
268 Ga0439449_0015236 3300042007 Bacteria 2889
269 Ga0439452_003703 3300042010 Bacteria 5287
270 Ga0439457_002509 3300042014 Bacteria 5224
271 Ga0439457_003082 3300042014 Bacteria 4611
272 Ga0439462_0066054 3300042015 Bacteria 980
273 Ga0450919_000096 3300042121 Bacteria 8608
274 Ga0450920_006879 3300042122 Bacteria 2050
275 Ga0450907_002213 3300042146 Bacteria 3791
276 Ga0439446_0000248 3300042156 Bacteria 10040
277 Ga0450909_000980 3300042185 Bacteria 3910
278 Ga0450918_000342 3300042531 Bacteria 10365
279 Ga0451577_0016854 3300042876 Bacteria 6758
280 Ga0453684_0000007 3300044712 Bacteria 1301482
281 Ga0453684_0007257 3300044712 Bacteria 20522
282 Ga0451576_0602911 3300045051 Unclassified 1154
283 Ga0495629_0048476 3300046459 Bacteria 2978
284 Ga0495629_0425222 3300046459 Bacteria 901
285 Ga0495653_0002086 3300046463 Bacteria 15738
286 Ga0495580_0035725 3300046472 Bacteria 3572
287 Ga0495582_0086355 3300046473 Bacteria 1746
288 Ga0495582_0208621 3300046473 Bacteria 1116
289 Ga0495639_0001398 3300046475 Bacteria 10817
290 Ga0495664_0001832 3300046477 Bacteria 11290
291 Ga0495664_0009859 3300046477 Bacteria 5356
292 Ga0495594_0059838 3300046499 Bacteria 2107
293 Ga0495618_0088706 3300046514 Bacteria 1978
294 Ga0495620_0048268 3300046515 Bacteria 1828
295 Ga0495630_0016004 3300046517 Bacteria 5481
296 Ga0495630_0042084 3300046517 Bacteria 3412
297 Ga0495666_0072666 3300046526 Unclassified 1633
298 Ga0495642_0093988 3300046528 Bacteria 1271
299 Ga0495654_0053244 3300046530 Bacteria 1968
300 Ga0495665_0001968 3300046531 Bacteria 11100
301 Ga0495665_0136347 3300046531 Bacteria 1284
302 Ga0495586_0000724 3300046535 Bacteria 18847
303 Ga0495586_0001053 3300046535 Bacteria 15574
304 Ga0495586_0036619 3300046535 Bacteria 2634
305 Ga0495587_0003182 3300046536 Bacteria 10978
306 Ga0495645_0001343 3300046543 Bacteria 16622
307 Ga0495622_0074936 3300046557 Bacteria 1560
308 Ga0495667_0000400 3300046559 Bacteria 27725
309 Ga0495656_0013564 3300046615 Bacteria 3034
310 Ga0495668_0076842 3300046616 Bacteria 1833
311 Ga0495634_0000640 3300046642 Bacteria 34059
312 Ga0495635_0020616 3300046663 Bacteria 4591
313 Ga0495659_0002581 3300046664 Bacteria 5839
314 Ga0495588_0009479 3300046674 Bacteria 4500
315 Ga0495588_0012001 3300046674 Bacteria 4082
316 Ga0495588_0062812 3300046674 Bacteria 1925
317 Ga0495623_0011750 3300046679 Bacteria 5673
318 Ga0495613_0425484 3300046689 Unclassified 903
319 Ga0495670_0003822 3300046691 Bacteria 7394
320 Ga0495600_0010802 3300046809 Bacteria 5677
321 Ga0495581_0029201 3300047315 Bacteria 3196
322 Ga0495581_0036473 3300047315 Bacteria 2844
323 Ga0495581_0066619 3300047315 Bacteria 2082
324 Ga0495604_0036018 3300047317 Bacteria 3904
325 Ga0495636_0010466 3300047318 Bacteria 3664
326 Ga0495674_0002829 3300047319 Bacteria 16867
327 Ga0495672_0062160 3300047320 Bacteria 2149
328 Ga0495680_0190237 3300047322 Bacteria 1477
329 Ga0495675_0059573 3300047444 Bacteria 2420
330 Ga0495677_0058604 3300047445 Bacteria 1425
331 Ga0495684_0135390 3300047471 Bacteria 1849
332 Ga0495686_0020408 3300047472 Bacteria 4418
333 Ga0495593_0026888 3300047673 Bacteria 3172
334 Ga0495593_0042380 3300047673 Bacteria 2443
335 Ga0496100_0017694 3300048903 Bacteria 4213
336 Ga0496100_0125784 3300048903 Bacteria 1799
337 Ga0496101_0143551 3300048904 Bacteria 1821
338 Ga0496102_0095705 3300048905 Bacteria 2752
339 Ga0496102_0820481 3300048905 Bacteria 852
340 Ga0496103_0016657 3300048906 Bacteria 4388
341 Ga0496103_0038976 3300048906 Bacteria 2919
342 Ga0496104_0226440 3300048907 Bacteria 1782
343 Ga0496104_0390807 3300048907 Bacteria 1303
344 Ga0496106_0011562 3300048909 Bacteria 6524
345 Ga0496106_0031184 3300048909 Bacteria 3971
346 Ga0496107_0005587 3300048910 Bacteria 8615
347 Ga0496108_0584182 3300048911 Bacteria 974
348 Ga0496108_0663547 3300048911 Bacteria 906
349 Ga0496109_0265909 3300048912 Bacteria 1616
350 Ga0496110_0042465 3300048913 Bacteria 3968
351 Ga0496110_0235582 3300048913 Bacteria 1665
352 Ga0496111_0022764 3300048914 Bacteria 4390
353 Ga0496112_0043918 3300048915 Bacteria 4376
354 Ga0496113_0006777 3300048916 Bacteria 7303
355 Ga0496114_0000278 3300048917 Bacteria 37423
356 Ga0496114_0011657 3300048917 Bacteria 7032
357 Ga0496114_0060010 3300048917 Bacteria 3178
358 Ga0496114_0076376 3300048917 Bacteria 2823
359 Ga0496114_0101673 3300048917 Bacteria 2454
360 Ga0496114_0247971 3300048917 Bacteria 1567
361 Ga0496114_0527926 3300048917 Bacteria 1043
362 Ga0496115_0049047 3300048918 Bacteria 3378
363 Ga0496115_0248696 3300048918 Unclassified 1464
364 Ga0496120_0116333 3300048923 Bacteria 1389
365 Ga0496124_0040752 3300048927 Bacteria 4015
366 Ga0496125_0152768 3300048928 Bacteria 1582
367 Ga0501034_0000599 3300049571 Bacteria 56771
368 Ga0501036_0003049 3300049572 Bacteria 13349
369 Ga0501036_0003250 3300049572 Bacteria 12953
370 Ga0501043_0000895 3300049579 Bacteria 26403
371 Ga0501046_0000384 3300049580 Bacteria 44301
372 Ga0501047_0000001 3300049581 Bacteria 658799
373 Ga0501048_0000764 3300049582 Bacteria 23596
374 Ga0501067_0012728 3300049583 Bacteria 4663
375 Ga0501068_0003197 3300049584 Bacteria 8774
376 Ga0501070_0011863 3300049586 Bacteria 7357
377 Ga0501072_0000099 3300049588 Bacteria 64739
378 Ga0501073_0000377 3300049589 Bacteria 30099
379 Ga0501073_0009959 3300049589 Bacteria 6992
380 Ga0501073_0020188 3300049589 Bacteria 4805
381 Ga0501074_0012122 3300049590 Bacteria 6267
382 Ga0501080_0004445 3300049742 Bacteria 12477
383 Ga0501080_0082707 3300049742 Bacteria 2982
384 Ga0501083_0000186 3300049744 Bacteria 39909
385 nmdc:mga08y16_12745_c1 3300050511 Bacteria 8847
386 nmdc:mga0rr50_187777_c1 3300050513 Bacteria 1692
387 nmdc:mga08x19_134042_c1 3300050514 Unclassified 1669
388 Ga0495601_0191427 3300053077 Bacteria 1337
389 Ga0495619_0364495 3300053085 Bacteria 999
390 Ga0500564_066137 3300053138 Bacteria 1635
391 Ga0500573_0017291 3300053140 Bacteria 4105
392 Ga0500604_0011828 3300053151 Bacteria 2350
393 Ga0501084_0000376 3300054114 Bacteria 34244
394 Ga0587128_004496 3300059630 Bacteria 1621
395 Ga0587072_016553 3300059643 Bacteria 1263
396 Ga0501082_0001357 3300060353 Bacteria 21531
397 2739616653 2739367656 Bacteria 5152243
398 2808893909 2808606370 Bacteria 4942454
399 2844851157 2844849076 Bacteria 4091819
400 2919391992 2919391150 Bacteria 4884741
401 2945944886 2945941187 Bacteria 4682474
402 2945956757 2945956166 Bacteria 5110334
403 2946024474 2946024296 Bacteria 3508095
404 2954002061 2953998280 Bacteria 4812144
405 8054111317 8054107350 Bacteria 5022511
406 Ga0157369_10173435
407 JGI25152J39213_1000045
408 JGI25151J46595_10020331
409 rootH2_10045220
410 rootL2_10027395
411 Ga0065714_10003691
412 Ga0070676_10019859
413 Ga0070683_100011160
414 Ga0070690_100008843
415 Ga0070670_100029074
416 Ga0070670_100036588
417 Ga0070670_100064878
418 Ga0070677_10001321
419 Ga0070666_10011647
420 Ga0068868_100067343
421 Ga0070689_100008878
422 Ga0070689_100045661
423 Ga0070689_100140735
424 Ga0070691_10185498
425 Ga0070687_100005023
426 Ga0070692_10046591
427 Ga0070668_100010855
428 Ga0070668_100253431
429 Ga0070669_100006710
430 Ga0070669_100014561
431 Ga0070675_100006443
432 Ga0070675_100401543
433 Ga0070671_100033328
434 Ga0070671_100314476
435 Ga0070674_100002206
436 Ga0070674_100010646
437 Ga0070673_100000441
438 Ga0070673_100013630
439 Ga0070673_100090095
440 Ga0070673_100107270
441 Ga0070673_100285345
442 Ga0070688_100004000
443 Ga0070667_100189751
444 Ga0070709_10002953
445 Ga0070713_100129269
446 Ga0070701_10059349
447 Ga0070711_100070603
448 Ga0070705_100303565
449 Ga0070700_100006026
450 Ga0070694_100002489
451 Ga0070694_100150514
452 Ga0070708_100157829
453 Ga0070681_10187430
454 Ga0070699_100003639
455 Ga0070699_100016516
456 Ga0070679_100048934
457 Ga0070684_100001008
458 Ga0070684_100381763
459 Ga0070697_100110019
460 Ga0068853_100569779
461 Ga0070672_100062891
462 Ga0070672_100065067
463 Ga0070686_100011227
464 Ga0070695_100041800
465 Ga0070695_100089895
466 Ga0070665_100345910
467 Ga0070665_100787905
468 Ga0068856_100184412
469 Ga0068852_100035891
470 Ga0068859_100715175
471 Ga0068866_10040992
472 Ga0068851_10120579
473 Ga0068863_100006501
474 Ga0068863_100359998
475 Ga0068858_100015788
476 Ga0068860_100402267
477 Ga0081538_10000234
478 Ga0075432_10006535
479 Ga0070716_100612152
480 Ga0075428_100700615
481 Ga0075434_100103458
482 Ga0068865_100000739
483 Ga0075436_100005950
484 Ga0097620_100715143
485 Ga0075435_100174204
486 Ga0105251_10005090
487 Ga0105244_10010354
488 Ga0105244_10041107
489 Ga0105240_10172281
490 Ga0111539_10103888
491 Ga0105245_10009099
492 Ga0105245_10016903
493 Ga0105243_10024683
494 Ga0105242_10115519
495 Ga0105242_10222457
496 Ga0105248_10020078
497 Ga0105249_10330594
498 Ga0105239_10675750
499 Ga0105246_10000183
500 Ga0105246_10059912
501 Ga0157371_10026923
502 Ga0157374_10220152
503 Ga0157378_10892274
504 Ga0163162_10256309
505 Ga0163162_10809315
506 Ga0157372_10628905
507 Ga0163163_10172135
508 Ga0157377_10367670
509 Ga0157379_10203307
510 Ga0157379_10404061
511 Ga0157376_10205961
512 Ga0163161_10119438
513 Ga0209129_1000068
514 Ga0209025_1000045
515 Ga0207655_1027882
516 Ga0207713_1061517
517 Ga0207682_10001889
518 Ga0207688_10020793
519 Ga0207680_10031973
520 Ga0207699_10192735
521 Ga0207645_10000377
522 Ga0207645_10000819
523 Ga0207643_10055867
524 Ga0207643_10095652
525 Ga0207695_10124792
526 Ga0207695_10203604
527 Ga0207663_10000030
528 Ga0207662_10000555
529 Ga0207662_10207010
530 Ga0207652_10048204
531 Ga0207681_10002104
532 Ga0207681_10005368
533 Ga0207650_10005183
534 Ga0207650_10061197
535 Ga0207650_10095279
536 Ga0207659_10013433
537 Ga0207659_10078008
538 Ga0207687_10015662
539 Ga0207687_10018633
540 Ga0207700_10179836
541 Ga0207644_10030229
542 Ga0207644_10386425
543 Ga0207690_10164547
544 Ga0207706_10029721
545 Ga0207686_10119865
546 Ga0207709_10006383
547 Ga0207709_10008346
548 Ga0207709_10169891
549 Ga0207670_10100474
550 Ga0207669_10007856
551 Ga0207669_10014552
552 Ga0207704_10002564
553 Ga0207691_10000237
554 Ga0207691_10003433
555 Ga0207691_10047421
556 Ga0207691_10266136
557 Ga0207711_10354853
558 Ga0207689_10031536
559 Ga0207661_10105474
560 Ga0207651_10001305
561 Ga0207651_10021586
562 Ga0207651_10024891
563 Ga0207651_10156763
564 Ga0207712_10203755
565 Ga0207668_10013474
566 Ga0207668_10016744
567 Ga0207658_10120825
568 Ga0207677_10075679
569 Ga0207677_10111207
570 Ga0207703_10029396
571 Ga0207703_10124909
572 Ga0207639_10116143
573 Ga0207708_10004009
574 Ga0207648_10002399
575 Ga0207676_10163596
576 Ga0207675_100253092
577 Ga0207683_10002627
578 Ga0207698_10043766
579 Ga0207698_10399276
580 Ga0207428_10036476
581 Ga0207428_10057313
582 Ga0265319_1000212
583 Ga0265318_10001391
584 Ga0265318_10004733
585 Ga0265338_10089258
586 Ga0316177_1129844
587 Ga0316176_1029780
588 Ga0265330_10000072
589 Ga0265332_10000194
590 Ga0265332_10008221
591 Ga0265332_10016540
592 Ga0265332_10055861
593 Ga0265328_10033877
594 Ga0265328_10039308
595 Ga0265328_10069408
596 Ga0265320_10000038
597 Ga0265320_10004956
598 Ga0265329_10000395
599 Ga0265340_10000247
600 Ga0265340_10158229
601 Ga0265339_10000574
602 Ga0265339_10004397
603 Ga0265331_10000421
604 Ga0265331_10000593
605 Ga0265316_10001992
606 Ga0265316_10006517
607 Ga0307513_10188960
608 Ga0307408_100054381
609 Ga0307408_100105290
610 Ga0307408_100184258
611 Ga0307408_100570141
612 Ga0265313_10001473
613 Ga0265313_10018222
614 Ga0265314_10000114
615 Ga0265314_10025386
616 Ga0265314_10064091
617 Ga0265342_10000268
618 Ga0265342_10005502
619 Ga0307405_10015859
620 Ga0307413_10029273
621 Ga0307413_10193310
622 Ga0307413_10575789
623 Ga0307410_10188084
624 Ga0307410_10319228
625 Ga0307407_10054095
626 Ga0307412_10024114
627 Ga0307412_10038885
628 Ga0307412_10182268
629 Ga0307409_100317545
630 Ga0307409_100731691
631 Ga0307409_100795732
632 Ga0307416_100027181
633 Ga0307414_10261950
634 Ga0307411_10131864
635 Ga0307415_100054241
636 Ga0307415_100557672
637 Ga0316583_10032669
638 Ga0373950_0000066
639 Ga0373945_0038673
640 Ga0373954_0011395
641 Ga0373956_0288509
642 Ga0373957_0012487
643 Ga0373957_0074610
644 Ga0373946_0022865
645 Ga0373955_0029383
646 Ga0373955_0031377
647 Ga0373924_0154589
648 Ga0373931_0126550
649 Ga0373927_0205264
650 Ga0373933_0000146
651 Ga0373937_0000589
652 Ga0373937_0001766
653 Ga0373937_0073730
654 Ga0373937_0120193
655 Ga0373937_0131748
656 Ga0373937_0235254
657 Ga0395899_0289151
658 Ga0395901_0222076
659 Ga0439436_0002562
660 Ga0439436_0003611
661 Ga0439438_002886
662 Ga0439439_0000781
663 Ga0439461_0000624
664 Ga0439466_0000282
665 Ga0439466_0025540
666 Ga0439433_0000085
667 Ga0439442_000456
668 Ga0439442_001569
669 Ga0439442_002812
670 Ga0439432_000365
671 Ga0439449_0002002
672 Ga0439449_0008660
673 Ga0439449_0015236
674 Ga0439452_003703
675 Ga0439457_002509
676 Ga0439457_003082
677 Ga0439462_0066054
678 Ga0450919_000096
679 Ga0450920_006879
680 Ga0450907_002213
681 Ga0439446_0000248
682 Ga0450909_000980
683 Ga0450918_000342
684 Ga0451577_0016854
685 Ga0453684_0000007
686 Ga0453684_0007257
687 Ga0451576_0602911
688 Ga0495629_0048476
689 Ga0495629_0425222
690 Ga0495653_0002086
691 Ga0495580_0035725
692 Ga0495582_0086355
693 Ga0495582_0208621
694 Ga0495639_0001398
695 Ga0495664_0001832
696 Ga0495664_0009859
697 Ga0495594_0059838
698 Ga0495618_0088706
699 Ga0495620_0048268
700 Ga0495630_0016004
701 Ga0495630_0042084
702 Ga0495666_0072666
703 Ga0495642_0093988
704 Ga0495654_0053244
705 Ga0495665_0001968
706 Ga0495665_0136347
707 Ga0495586_0000724
708 Ga0495586_0001053
709 Ga0495586_0036619
710 Ga0495587_0003182
711 Ga0495645_0001343
712 Ga0495622_0074936
713 Ga0495667_0000400
714 Ga0495656_0013564
715 Ga0495668_0076842
716 Ga0495634_0000640
717 Ga0495635_0020616
718 Ga0495659_0002581
719 Ga0495588_0009479
720 Ga0495588_0012001
721 Ga0495588_0062812
722 Ga0495623_0011750
723 Ga0495613_0425484
724 Ga0495670_0003822
725 Ga0495600_0010802
726 Ga0495581_0029201
727 Ga0495581_0036473
728 Ga0495581_0066619
729 Ga0495604_0036018
730 Ga0495636_0010466
731 Ga0495674_0002829
732 Ga0495672_0062160
733 Ga0495680_0190237
734 Ga0495675_0059573
735 Ga0495677_0058604
736 Ga0495684_0135390
737 Ga0495686_0020408
738 Ga0495593_0026888
739 Ga0495593_0042380
740 Ga0496100_0017694
741 Ga0496100_0125784
742 Ga0496101_0143551
743 Ga0496102_0095705
744 Ga0496102_0820481
745 Ga0496103_0016657
746 Ga0496103_0038976
747 Ga0496104_0226440
748 Ga0496104_0390807
749 Ga0496106_0011562
750 Ga0496106_0031184
751 Ga0496107_0005587
752 Ga0496108_0584182
753 Ga0496108_0663547
754 Ga0496109_0265909
755 Ga0496110_0042465
756 Ga0496110_0235582
757 Ga0496111_0022764
758 Ga0496112_0043918
759 Ga0496113_0006777
760 Ga0496114_0000278
761 Ga0496114_0011657
762 Ga0496114_0060010
763 Ga0496114_0076376
764 Ga0496114_0101673
765 Ga0496114_0247971
766 Ga0496114_0527926
767 Ga0496115_0049047
768 Ga0496115_0248696
769 Ga0496120_0116333
770 Ga0496124_0040752
771 Ga0496125_0152768
772 Ga0501034_0000599
773 Ga0501036_0003049
774 Ga0501036_0003250
775 Ga0501043_0000895
776 Ga0501046_0000384
777 Ga0501047_0000001
778 Ga0501048_0000764
779 Ga0501067_0012728
780 Ga0501068_0003197
781 Ga0501070_0011863
782 Ga0501072_0000099
783 Ga0501073_0000377
784 Ga0501073_0009959
785 Ga0501073_0020188
786 Ga0501074_0012122
787 Ga0501080_0004445
788 Ga0501080_0082707
789 Ga0501083_0000186
790 nmdc:mga08y16_12745_c1
791 nmdc:mga0rr50_187777_c1
792 nmdc:mga08x19_134042_c1
793 Ga0495601_0191427
794 Ga0495619_0364495
795 Ga0500564_066137
796 Ga0500573_0017291
797 Ga0500604_0011828
798 Ga0501084_0000376
799 Ga0587128_004496
800 Ga0587072_016553
801 Ga0501082_0001357
802 2739616653
803 2808893909
804 2844851157
805 2919391992
806 2945944886
807 2945956757
808 2946024474
809 2954002061
810 8054111317

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

31

226

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

37

244

0.91

PF08659

KR

KR domain

31

214

0.85

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

33

209

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bmv-assembly2.cif.gz_D short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph 0.9196 6 240
4bmv-assembly4.cif.gz_I short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph 0.913 8 240
7e3x-assembly1.cif.gz_B crystal structure of sdr family nad(p)-dependent oxidoreductase from exiguobacterium 0.9078 9 234
5fyd-assembly1.cif.gz_A structural and biochemical insights into 7beta-hydroxysteroid dehydrogenase stereoselectivity 0.9038 8 243
5fyd-assembly1.cif.gz_B structural and biochemical insights into 7beta-hydroxysteroid dehydrogenase stereoselectivity 0.9024 8 243
ID Description Score Start End Superfamily
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.993 9 57 3.40.50.720
af_Q10782_3_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9464 6 247 3.40.50.720
af_I6Y9I3_9_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9397 8 250 3.40.50.720
af_I6Y9I3_9_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9212 8 250 3.40.50.720
af_Q10782_3_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9206 6 247 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7W8YCX6-F1-model_v4 SDR family oxidoreductase 0.9794 1 249 GO:0016020
GO:0016491
AF-A0A7Y3LJG8-F1-model_v4 SDR family oxidoreductase 0.9696 6 249 GO:0016491
AF-A0A1Q9S5I5-F1-model_v4 Short-chain dehydrogenase 0.9682 8 250 GO:0016020
GO:0016491
AF-A0A3M5AM34-F1-model_v4 deleted 0.9657 8 94
AF-A0A6L5G984-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9577 1 249 GO:0016020
GO:0016491

Map