F435984

General Info

Members Datasets Scaffolds Average Seq Length
405 232 810 331

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100096725|Ga0307409_1000967252
Length 365
Sequence MTGARAATDGTVSDGALPGGTPAATPPDAWHRGRTPASTIGPWLPDGPLGESLADGLARVEEALTRSVGSEHPFVREAAGHLMSAGGKRFRPMLTLLAAQLGDPSGADVVRAAVVCELTHLATLYHDDVMDEAAVRRGAPSANSRWTNSVAILTGDLLFARASAILADLGPDAVRIQAKTFERLVTGQIRETVGPAPGADPVAHYLEVLADKTGSLVATSARFGASFAGVDEPLVAALTSFGEEVGVAFQLSDDLLDIVSEGGTSGKSPGTDLREGIPTLPVLFVLAGDDPAEARLRELVARPVTDDDEHAEALQLLRTSAGLARAGEVLHDYAERARSRLADVPPGEVRDALSALCAYVATRTS

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
105 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
110 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
111 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
122 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
123 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
124 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
127 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
128 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
139 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
140 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
141 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
142 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
224 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
225 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
226 2643221711 Terrabacter sp. Root85 Isolate Unclassified
227 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
228 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
229 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
230 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
231 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
232 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.54
Metatranscriptomes 0.99
Isolates 2.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 10.86
Rhizosphere 84.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100096725 3300031995 Bacteria 2437
2 JGI24735J21928_10005458 3300002067 Bacteria 4218
3 JGI25405J52794_10027966 3300003911 Bacteria 1162
4 Ga0070683_100000921 3300005329 Bacteria 21851
5 Ga0070683_100322561 3300005329 Bacteria 1470
6 Ga0070690_100158738 3300005330 Bacteria 1548
7 Ga0070682_100031717 3300005337 Bacteria 3197
8 Ga0070660_100108193 3300005339 Bacteria 2209
9 Ga0070668_100081975 3300005347 Bacteria 2529
10 Ga0070668_100188982 3300005347 Bacteria 1686
11 Ga0070675_100150973 3300005354 Bacteria 1992
12 Ga0070671_100012224 3300005355 Bacteria 6907
13 Ga0070659_100035469 3300005366 Bacteria 3884
14 Ga0070714_100000011 3300005435 Bacteria 231268
15 Ga0070714_100014967 3300005435 Bacteria 6235
16 Ga0070713_100062363 3300005436 Bacteria 3122
17 Ga0070710_10048903 3300005437 Bacteria 2363
18 Ga0070711_100021259 3300005439 Bacteria 4192
19 Ga0070700_100000046 3300005441 Bacteria 91380
20 Ga0070708_100277534 3300005445 Bacteria 1577
21 Ga0070678_100049010 3300005456 Bacteria 3046
22 Ga0070679_100203805 3300005530 Bacteria 1943
23 Ga0068853_100024349 3300005539 Bacteria 5073
24 Ga0070672_100095868 3300005543 Bacteria 2400
25 Ga0070696_100000187 3300005546 Bacteria 36190
26 Ga0070696_100056872 3300005546 Bacteria 2729
27 Ga0070693_100086094 3300005547 Bacteria 1884
28 Ga0070665_100002126 3300005548 Bacteria 22122
29 Ga0070665_100311196 3300005548 Bacteria 1579
30 Ga0068855_100079232 3300005563 Bacteria 3810
31 Ga0070664_100155716 3300005564 Bacteria 2019
32 Ga0068854_100194511 3300005578 Bacteria 1591
33 Ga0068856_100236975 3300005614 Bacteria 1840
34 Ga0070702_100013861 3300005615 Bacteria 4080
35 Ga0068852_100060171 3300005616 Bacteria 3297
36 Ga0068852_100434476 3300005616 Bacteria 1297
37 Ga0068861_100015629 3300005719 Bacteria 5353
38 Ga0068863_100003262 3300005841 Bacteria 16025
39 Ga0068858_100013407 3300005842 Bacteria 7736
40 Ga0068860_100000054 3300005843 Bacteria 206114
41 Ga0068860_100043356 3300005843 Bacteria 4292
42 Ga0081455_10001346 3300005937 Bacteria 30424
43 Ga0081455_10008291 3300005937 Bacteria 10829
44 Ga0081540_1004343 3300005983 Bacteria 10858
45 Ga0070717_10015424 3300006028 Bacteria 5904
46 Ga0070717_10074608 3300006028 Bacteria 2836
47 Ga0070716_100016161 3300006173 Bacteria 3848
48 Ga0075428_100057103 3300006844 Bacteria 4274
49 Ga0075428_100308233 3300006844 Bacteria 1702
50 Ga0075434_100039726 3300006871 Bacteria 4661
51 Ga0075429_100027736 3300006880 Bacteria 4915
52 Ga0075436_100045350 3300006914 Bacteria 3032
53 Ga0075436_100211093 3300006914 Bacteria 1376
54 Ga0097620_100016190 3300006931 Bacteria 7490
55 Ga0097620_100029296 3300006931 Bacteria 5524
56 Ga0105245_10028105 3300009098 Bacteria 4957
57 Ga0105245_10084585 3300009098 Bacteria 2907
58 Ga0105247_10031340 3300009101 Bacteria 3226
59 Ga0105247_10060385 3300009101 Bacteria 2349
60 Ga0114129_10049926 3300009147 Bacteria 5878
61 Ga0114129_10074097 3300009147 Bacteria 4742
62 Ga0105242_10114107 3300009176 Bacteria 2308
63 Ga0105248_10008574 3300009177 Bacteria 11224
64 Ga0105248_10282538 3300009177 Bacteria 1868
65 Ga0105238_10048221 3300009551 Bacteria 4294
66 Ga0105238_10196807 3300009551 Bacteria 1991
67 Ga0105249_10129818 3300009553 Bacteria 2404
68 Ga0105249_10507599 3300009553 Bacteria 1252
69 Ga0105246_10020285 3300011119 Bacteria 4261
70 Ga0157370_10097806 3300013104 Bacteria 2753
71 Ga0157369_10029802 3300013105 Bacteria 6028
72 Ga0157378_10115564 3300013297 Bacteria 2466
73 Ga0163162_10134688 3300013306 Bacteria 2581
74 Ga0157372_10064314 3300013307 Bacteria 4116
75 Ga0157375_10126754 3300013308 Bacteria 2668
76 Ga0163163_10259091 3300014325 Bacteria 1790
77 Ga0157380_10051778 3300014326 Bacteria 3249
78 Ga0157380_10070830 3300014326 Bacteria 2819
79 Ga0157379_10041775 3300014968 Bacteria 4093
80 Ga0157376_10027532 3300014969 Bacteria 4507
81 Ga0163161_10020694 3300017792 Bacteria 4620
82 Ga0163161_10225029 3300017792 Bacteria 1454
83 Ga0206354_10679750 3300020081 Bacteria 3201
84 Ga0206353_10088233 3300020082 Bacteria 1486
85 Ga0206353_11116341 3300020082 Bacteria 7029
86 Ga0224712_10010118 3300022467 Bacteria 2871
87 Ga0207692_10039997 3300025898 Bacteria 2311
88 Ga0207710_10021276 3300025900 Bacteria 2778
89 Ga0207688_10017240 3300025901 Bacteria 3924
90 Ga0207680_10013091 3300025903 Bacteria 4248
91 Ga0207647_10027311 3300025904 Bacteria 3722
92 Ga0207699_10050716 3300025906 Bacteria 2449
93 Ga0207695_10116380 3300025913 Bacteria 2647
94 Ga0207671_10091040 3300025914 Bacteria 2298
95 Ga0207693_10002666 3300025915 Bacteria 15499
96 Ga0207652_10152370 3300025921 Bacteria 2070
97 Ga0207652_10285202 3300025921 Bacteria 1490
98 Ga0207694_10069442 3300025924 Bacteria 2752
99 Ga0207687_10048124 3300025927 Bacteria 2959
100 Ga0207700_10117368 3300025928 Bacteria 2152
101 Ga0207664_10000001 3300025929 Bacteria 724213
102 Ga0207664_10009859 3300025929 Bacteria 6723
103 Ga0207664_10082271 3300025929 Bacteria 2622
104 Ga0207644_10006065 3300025931 Bacteria 7884
105 Ga0207690_10108890 3300025932 Bacteria 1992
106 Ga0207706_10048802 3300025933 Bacteria 3744
107 Ga0207709_10078055 3300025935 Bacteria 2125
108 Ga0207669_10214098 3300025937 Bacteria 1409
109 Ga0207665_10044554 3300025939 Bacteria 2969
110 Ga0207691_10088980 3300025940 Bacteria 2769
111 Ga0207711_10182268 3300025941 Bacteria 1910
112 Ga0207689_10003013 3300025942 Bacteria 15529
113 Ga0207661_10309554 3300025944 Bacteria 1418
114 Ga0207679_10127240 3300025945 Bacteria 2038
115 Ga0207712_10069579 3300025961 Bacteria 2526
116 Ga0207668_10167360 3300025972 Bacteria 1720
117 Ga0207703_10013864 3300026035 Bacteria 6282
118 Ga0207639_10003345 3300026041 Bacteria 10787
119 Ga0207678_10006768 3300026067 Bacteria 10163
120 Ga0207708_10000002 3300026075 Bacteria 411071
121 Ga0207708_10245712 3300026075 Bacteria 1441
122 Ga0207641_10003459 3300026088 Bacteria 13982
123 Ga0207641_10005344 3300026088 Bacteria 10971
124 Ga0207676_10055074 3300026095 Bacteria 3120
125 Ga0207675_100005792 3300026118 Bacteria 11811
126 Ga0207683_10015134 3300026121 Bacteria 6566
127 Ga0268266_10001523 3300028379 Bacteria 27130
128 Ga0268266_10074147 3300028379 Bacteria 2955
129 Ga0268265_10119206 3300028380 Bacteria 2171
130 Ga0268264_10000097 3300028381 Bacteria 229722
131 Ga0268264_10223581 3300028381 Bacteria 1734
132 Ga0307511_10025184 3300030521 Bacteria 5491
133 Ga0307511_10105753 3300030521 Bacteria 1820
134 Ga0316177_1059530 3300030731 Bacteria 1181
135 Ga0307513_10000002 3300031456 Bacteria 842612
136 Ga0307509_10221203 3300031507 Bacteria 1706
137 Ga0307408_100046666 3300031548 Bacteria 3099
138 Ga0307508_10115568 3300031616 Bacteria 2285
139 Ga0316576_10005909 3300031727 Bacteria 7556
140 Ga0316576_10015729 3300031727 Bacteria 5086
141 Ga0316578_10001573 3300031728 Bacteria 9406
142 Ga0316578_10003502 3300031728 Bacteria 7203
143 Ga0316578_10026249 3300031728 Bacteria 3283
144 Ga0316578_10197785 3300031728 Bacteria 1210
145 Ga0307405_10004320 3300031731 Bacteria 6696
146 Ga0307405_10058664 3300031731 Bacteria 2423
147 Ga0316577_10019993 3300031733 Bacteria 3708
148 Ga0316577_10023850 3300031733 Bacteria 3396
149 Ga0307413_10248771 3300031824 Bacteria 1317
150 Ga0307410_10000632 3300031852 Bacteria 14518
151 Ga0307410_10038712 3300031852 Bacteria 3125
152 Ga0307406_10051617 3300031901 Bacteria 2612
153 Ga0307406_10210982 3300031901 Bacteria 1436
154 Ga0307407_10019032 3300031903 Bacteria 3488
155 Ga0307407_10033593 3300031903 Bacteria 2800
156 Ga0307407_10112197 3300031903 Bacteria 1713
157 Ga0307409_100028428 3300031995 Bacteria 3983
158 Ga0307409_100058611 3300031995 Bacteria 2992
159 Ga0307409_100085285 3300031995 Bacteria 2567
160 Ga0307409_100129156 3300031995 Bacteria 2156
161 Ga0307409_100130781 3300031995 Bacteria 2144
162 Ga0307416_100023937 3300032002 Bacteria 4444
163 Ga0307416_100132127 3300032002 Bacteria 2249
164 Ga0307416_100287548 3300032002 Bacteria 1625
165 Ga0307416_100376789 3300032002 Bacteria 1447
166 Ga0307411_10113847 3300032005 Bacteria 1942
167 Ga0307415_100031549 3300032126 Bacteria 3415
168 Ga0307415_100040781 3300032126 Bacteria 3078
169 Ga0307415_100058150 3300032126 Bacteria 2661
170 Ga0307415_100063873 3300032126 Bacteria 2560
171 Ga0307415_100108136 3300032126 Bacteria 2057
172 Ga0316583_10006380 3300032133 Bacteria 4234
173 Ga0316585_10003841 3300032137 Bacteria 4155
174 Ga0316585_10024797 3300032137 Bacteria 1857
175 Ga0316585_10036340 3300032137 Bacteria 1561
176 Ga0316580_10000328 3300032139 Bacteria 10426
177 Ga0316580_10003070 3300032139 Bacteria 4705
178 Ga0307507_10000732 3300033179 Bacteria 72083
179 Ga0307510_10093319 3300033180 Bacteria 2842
180 Ga0373938_0024862 3300034957 Bacteria 1242
181 Ga0373929_0017679 3300035085 Bacteria 1410
182 Ga0373939_0007672 3300035114 Bacteria 2626
183 Ga0373960_0023571 3300035121 Bacteria 1659
184 Ga0316574_0008358 3300035398 Bacteria 5746
185 Ga0316574_0025807 3300035398 Bacteria 3529
186 Ga0316574_0034681 3300035398 Bacteria 3078
187 Ga0316574_0047199 3300035398 Bacteria 2672
188 Ga0316574_0180142 3300035398 Bacteria 1359
189 Ga0373931_0006632 3300035691 Bacteria 5421
190 Ga0316582_0001760 3300036647 Bacteria 9753
191 Ga0316582_0127678 3300036647 Bacteria 1705
192 Ga0316584_0005732 3300036712 Bacteria 8366
193 Ga0316584_0007570 3300036712 Bacteria 7441
194 Ga0316584_0034912 3300036712 Bacteria 3729
195 Ga0395900_0110223 3300037418 Bacteria 2828
196 Ga0395900_0302812 3300037418 Bacteria 1584
197 Ga0395900_0364292 3300037418 Bacteria 1416
198 Ga0395898_0111866 3300037466 Bacteria 2617
199 Ga0395898_0131874 3300037466 Bacteria 2393
200 Ga0395898_0190354 3300037466 Bacteria 1960
201 Ga0395898_0323920 3300037466 Bacteria 1470
202 Ga0395901_0018201 3300038443 Bacteria 7173
203 Ga0395901_0058350 3300038443 Bacteria 4014
204 Ga0395901_0064033 3300038443 Bacteria 3827
205 Ga0395901_0101456 3300038443 Bacteria 3020
206 Ga0395901_0226590 3300038443 Bacteria 1952
207 Ga0395901_0320736 3300038443 Bacteria 1603
208 Ga0439436_0002610 3300041404 Bacteria 5426
209 Ga0439439_0003941 3300041406 Bacteria 3308
210 Ga0439466_0008552 3300041411 Bacteria 3857
211 Ga0439433_0007347 3300041999 Bacteria 2378
212 Ga0439449_0001102 3300042007 Bacteria 10625
213 Ga0439449_0002811 3300042007 Bacteria 6764
214 Ga0439457_000388 3300042014 Bacteria 12433
215 Ga0439457_020714 3300042014 Bacteria 1458
216 Ga0466969_0003848 3300044656 Bacteria 7969
217 Ga0466969_0009967 3300044656 Bacteria 5038
218 Ga0466966_0002809 3300044684 Bacteria 11457
219 Ga0466966_0003767 3300044684 Bacteria 10000
220 Ga0466966_0087325 3300044684 Bacteria 1938
221 Ga0466966_0159260 3300044684 Bacteria 1375
222 Ga0466961_0028849 3300044693 Bacteria 3568
223 Ga0466963_0000219 3300044694 Bacteria 24511
224 Ga0466963_0029991 3300044694 Bacteria 3505
225 Ga0466963_0037122 3300044694 Bacteria 3180
226 Ga0466963_0100866 3300044694 Bacteria 1976
227 Ga0466963_0129065 3300044694 Bacteria 1745
228 Ga0466963_0230393 3300044694 Bacteria 1298
229 Ga0466971_0002291 3300044719 Bacteria 8105
230 Ga0466971_0005446 3300044719 Bacteria 5522
231 Ga0466971_0021117 3300044719 Bacteria 2896
232 Ga0466971_0079894 3300044719 Bacteria 1490
233 Ga0466971_0102837 3300044719 Bacteria 1314
234 Ga0466970_0008497 3300044765 Bacteria 5169
235 Ga0466970_0086863 3300044765 Bacteria 1696
236 Ga0466970_0117212 3300044765 Bacteria 1457
237 Ga0466957_0017702 3300044842 Bacteria 4178
238 Ga0466960_0003016 3300044901 Bacteria 6428
239 Ga0466960_0003273 3300044901 Bacteria 6208
240 Ga0466959_0005006 3300045049 Bacteria 8995
241 Ga0466958_0007606 3300045836 Bacteria 5968
242 Ga0466958_0013909 3300045836 Bacteria 4590
243 Ga0466958_0017409 3300045836 Bacteria 4153
244 Ga0466958_0023791 3300045836 Bacteria 3600
245 Ga0466958_0033492 3300045836 Bacteria 3061
246 Ga0466967_0037574 3300045976 Bacteria 4145
247 Ga0466967_0045586 3300045976 Bacteria 3810
248 Ga0466967_0083004 3300045976 Bacteria 2897
249 Ga0466967_0148541 3300045976 Bacteria 2188
250 Ga0466967_0320876 3300045976 Bacteria 1494
251 Ga0495641_0074802 3300046461 Bacteria 1519
252 Ga0495651_0004811 3300046462 Bacteria 10335
253 Ga0495664_0079286 3300046477 Bacteria 1968
254 Ga0495631_0092337 3300046518 Bacteria 1303
255 Ga0495652_0002119 3300046529 Bacteria 20914
256 Ga0495587_0211933 3300046536 Bacteria 1094
257 Ga0495634_0075060 3300046642 Bacteria 2221
258 Ga0495635_0004158 3300046663 Bacteria 10038
259 Ga0495646_0048908 3300046680 Bacteria 2568
260 Ga0495669_0001450 3300046684 Bacteria 9784
261 Ga0496100_0147469 3300048903 Bacteria 1675
262 Ga0496100_0274186 3300048903 Bacteria 1255
263 Ga0496101_0032470 3300048904 Bacteria 3675
264 Ga0496101_0046797 3300048904 Bacteria 3103
265 Ga0496101_0071540 3300048904 Bacteria 2543
266 Ga0496102_0000567 3300048905 Bacteria 39342
267 Ga0496102_0001863 3300048905 Bacteria 18172
268 Ga0496102_0005356 3300048905 Bacteria 10892
269 Ga0496102_0018243 3300048905 Bacteria 6163
270 Ga0496102_0369082 3300048905 Bacteria 1351
271 Ga0496103_0000039 3300048906 Bacteria 174284
272 Ga0496103_0082723 3300048906 Bacteria 2021
273 Ga0496103_0199859 3300048906 Bacteria 1285
274 Ga0496104_0006327 3300048907 Bacteria 10416
275 Ga0496104_0023645 3300048907 Bacteria 5650
276 Ga0496105_0027759 3300048908 Bacteria 4626
277 Ga0496105_0044487 3300048908 Bacteria 3662
278 Ga0496106_0129060 3300048909 Bacteria 1981
279 Ga0496107_0048869 3300048910 Bacteria 3048
280 Ga0496107_0062531 3300048910 Bacteria 2697
281 Ga0496107_0299874 3300048910 Bacteria 1196
282 Ga0496108_0028740 3300048911 Bacteria 4600
283 Ga0496108_0068484 3300048911 Bacteria 2994
284 Ga0496108_0097436 3300048911 Bacteria 2506
285 Ga0496108_0127138 3300048911 Bacteria 2189
286 Ga0496109_0003025 3300048912 Bacteria 14029
287 Ga0496109_0030243 3300048912 Bacteria 4854
288 Ga0496109_0051645 3300048912 Bacteria 3745
289 Ga0496110_0015300 3300048913 Bacteria 6382
290 Ga0496110_0020511 3300048913 Bacteria 5580
291 Ga0496110_0175939 3300048913 Bacteria 1942
292 Ga0496110_0204509 3300048913 Bacteria 1794
293 Ga0496111_0029613 3300048914 Bacteria 3889
294 Ga0496111_0068331 3300048914 Bacteria 2582
295 Ga0496112_0049289 3300048915 Bacteria 4128
296 Ga0496113_0018757 3300048916 Bacteria 4825
297 Ga0496113_0027754 3300048916 Bacteria 4062
298 Ga0496113_0031826 3300048916 Bacteria 3831
299 Ga0496113_0361260 3300048916 Bacteria 1165
300 Ga0496114_0011247 3300048917 Bacteria 7145
301 Ga0496114_0022306 3300048917 Bacteria 5159
302 Ga0496114_0029855 3300048917 Bacteria 4482
303 Ga0496114_0280325 3300048917 Bacteria 1469
304 Ga0496115_0079593 3300048918 Bacteria 2667
305 Ga0496118_0023981 3300048921 Bacteria 5280
306 Ga0496119_0000449 3300048922 Bacteria 56334
307 Ga0496119_0020170 3300048922 Bacteria 4871
308 Ga0496121_0129116 3300048924 Bacteria 1895
309 Ga0501031_0018519 3300049568 Bacteria 4532
310 Ga0501031_0023313 3300049568 Bacteria 4036
311 Ga0501031_0029920 3300049568 Bacteria 3552
312 Ga0501031_0091237 3300049568 Bacteria 1987
313 Ga0501032_0033356 3300049569 Bacteria 3528
314 Ga0501032_0102228 3300049569 Bacteria 1899
315 Ga0501033_0025441 3300049570 Bacteria 4460
316 Ga0501033_0080839 3300049570 Bacteria 2384
317 Ga0501036_0002071 3300049572 Bacteria 15639
318 Ga0501036_0005489 3300049572 Bacteria 10284
319 Ga0501036_0121738 3300049572 Bacteria 2203
320 Ga0501037_0278443 3300049573 Bacteria 1166
321 Ga0501038_0019760 3300049574 Bacteria 6063
322 Ga0501038_0025253 3300049574 Bacteria 5297
323 Ga0501038_0053398 3300049574 Bacteria 3479
324 Ga0501039_0005920 3300049575 Bacteria 9261
325 Ga0501039_0019816 3300049575 Bacteria 5157
326 Ga0501039_0026550 3300049575 Bacteria 4450
327 Ga0501040_0011850 3300049576 Bacteria 5703
328 Ga0501040_0195324 3300049576 Bacteria 1436
329 Ga0501041_0008355 3300049577 Bacteria 6089
330 Ga0501041_0010785 3300049577 Bacteria 5391
331 Ga0501041_0045004 3300049577 Bacteria 2682
332 Ga0501042_0012068 3300049578 Bacteria 5844
333 Ga0501042_0019320 3300049578 Bacteria 4729
334 Ga0501042_0019755 3300049578 Bacteria 4683
335 Ga0501043_0048676 3300049579 Bacteria 3332
336 Ga0501043_0272849 3300049579 Bacteria 1298
337 Ga0501046_0003312 3300049580 Bacteria 14803
338 Ga0501048_0009225 3300049582 Bacteria 7412
339 Ga0501048_0017048 3300049582 Bacteria 5353
340 Ga0501048_0025265 3300049582 Bacteria 4329
341 Ga0501068_0003547 3300049584 Bacteria 8428
342 Ga0501069_0027677 3300049585 Bacteria 3107
343 Ga0501070_0449304 3300049586 Bacteria 1039
344 Ga0501071_0018444 3300049587 Bacteria 4831
345 Ga0501072_0005287 3300049588 Bacteria 9832
346 Ga0501072_0029583 3300049588 Bacteria 4280
347 Ga0501073_0052282 3300049589 Bacteria 2861
348 Ga0501074_0037603 3300049590 Bacteria 3508
349 Ga0501074_0049782 3300049590 Bacteria 3025
350 Ga0501074_0239111 3300049590 Bacteria 1292
351 Ga0501075_0014938 3300049591 Bacteria 5569
352 Ga0501075_0030006 3300049591 Bacteria 4024
353 Ga0501075_0099922 3300049591 Bacteria 2203
354 Ga0501076_0001318 3300049592 Bacteria 16560
355 Ga0501076_0019391 3300049592 Bacteria 5199
356 Ga0501076_0149070 3300049592 Bacteria 1902
357 Ga0501076_0174229 3300049592 Bacteria 1753
358 Ga0501077_0030044 3300049593 Bacteria 3456
359 Ga0501077_0040580 3300049593 Bacteria 2965
360 Ga0501077_0045605 3300049593 Bacteria 2785
361 Ga0501079_0010892 3300049741 Bacteria 6925
362 Ga0501080_0004470 3300049742 Bacteria 12447
363 Ga0501080_0048569 3300049742 Bacteria 3950
364 Ga0501081_0021151 3300049743 Bacteria 4341
365 Ga0501081_0022120 3300049743 Bacteria 4252
366 Ga0501081_0023044 3300049743 Bacteria 4170
367 Ga0501083_0070833 3300049744 Bacteria 2318
368 Ga0501083_0096557 3300049744 Bacteria 1950
369 Ga0501035_0024869 3300049822 Bacteria 5492
370 Ga0501035_0229700 3300049822 Bacteria 1582
371 Ga0501035_0397279 3300049822 Bacteria 1147
372 Ga0501045_0001111 3300049824 Bacteria 17782
373 Ga0501045_0003207 3300049824 Bacteria 11181
374 Ga0501045_0023458 3300049824 Bacteria 4423
375 Ga0501045_0136551 3300049824 Bacteria 1823
376 nmdc:mga0n895_61444_c1 3300050512 Bacteria 3709
377 nmdc:mga0rr50_126846_c1 3300050513 Bacteria 2039
378 nmdc:mga08x19_222604_c1 3300050514 Bacteria 1297
379 Ga0495601_0011588 3300053077 Bacteria 5283
380 Ga0495601_0024769 3300053077 Bacteria 3695
381 Ga0495612_0005943 3300053078 Bacteria 5026
382 Ga0495619_0015492 3300053085 Bacteria 4823
383 Ga0500568_0001966 3300053139 Bacteria 12563
384 Ga0501084_0044853 3300054114 Bacteria 3702
385 Ga0501084_0118430 3300054114 Bacteria 2226
386 Ga0501082_0021169 3300060353 Bacteria 5609
387 Ga0501082_0026286 3300060353 Bacteria 5015
388 Ga0501082_0180588 3300060353 Bacteria 1835
389 Ga0466962_0000056 3300061719 Bacteria 46579
390 Ga0466962_0005165 3300061719 Bacteria 6281
391 Ga0466962_0007761 3300061719 Bacteria 5141
392 Ga0466962_0012763 3300061719 Bacteria 4042
393 Ga0530510_0006871 3300061734 Bacteria 7932
394 Ga0530510_0018326 3300061734 Bacteria 4964
395 Ga0530510_0045525 3300061734 Bacteria 3170
396 2623497704 2622736605 Bacteria 4992138
397 2644138167 2643221624 Bacteria 4384879
398 2644455822 2643221681 Bacteria 3707866
399 2644610313 2643221711 Bacteria 4865335
400 2808872885 2808606365 Bacteria 4301966
401 2837268964 2837268691 Bacteria 7850704
402 2868090603 2868088558 Bacteria 7609351
403 2919449198 2919446982 Bacteria 3994487
404 3001890495 3001889506 Bacteria 2975194
405 8056060080 8056054917 Bacteria 5736694
406 Ga0307409_100096725
407 JGI24735J21928_10005458
408 JGI25405J52794_10027966
409 Ga0070683_100000921
410 Ga0070683_100322561
411 Ga0070690_100158738
412 Ga0070682_100031717
413 Ga0070660_100108193
414 Ga0070668_100081975
415 Ga0070668_100188982
416 Ga0070675_100150973
417 Ga0070671_100012224
418 Ga0070659_100035469
419 Ga0070714_100000011
420 Ga0070714_100014967
421 Ga0070713_100062363
422 Ga0070710_10048903
423 Ga0070711_100021259
424 Ga0070700_100000046
425 Ga0070708_100277534
426 Ga0070678_100049010
427 Ga0070679_100203805
428 Ga0068853_100024349
429 Ga0070672_100095868
430 Ga0070696_100000187
431 Ga0070696_100056872
432 Ga0070693_100086094
433 Ga0070665_100002126
434 Ga0070665_100311196
435 Ga0068855_100079232
436 Ga0070664_100155716
437 Ga0068854_100194511
438 Ga0068856_100236975
439 Ga0070702_100013861
440 Ga0068852_100060171
441 Ga0068852_100434476
442 Ga0068861_100015629
443 Ga0068863_100003262
444 Ga0068858_100013407
445 Ga0068860_100000054
446 Ga0068860_100043356
447 Ga0081455_10001346
448 Ga0081455_10008291
449 Ga0081540_1004343
450 Ga0070717_10015424
451 Ga0070717_10074608
452 Ga0070716_100016161
453 Ga0075428_100057103
454 Ga0075428_100308233
455 Ga0075434_100039726
456 Ga0075429_100027736
457 Ga0075436_100045350
458 Ga0075436_100211093
459 Ga0097620_100016190
460 Ga0097620_100029296
461 Ga0105245_10028105
462 Ga0105245_10084585
463 Ga0105247_10031340
464 Ga0105247_10060385
465 Ga0114129_10049926
466 Ga0114129_10074097
467 Ga0105242_10114107
468 Ga0105248_10008574
469 Ga0105248_10282538
470 Ga0105238_10048221
471 Ga0105238_10196807
472 Ga0105249_10129818
473 Ga0105249_10507599
474 Ga0105246_10020285
475 Ga0157370_10097806
476 Ga0157369_10029802
477 Ga0157378_10115564
478 Ga0163162_10134688
479 Ga0157372_10064314
480 Ga0157375_10126754
481 Ga0163163_10259091
482 Ga0157380_10051778
483 Ga0157380_10070830
484 Ga0157379_10041775
485 Ga0157376_10027532
486 Ga0163161_10020694
487 Ga0163161_10225029
488 Ga0206354_10679750
489 Ga0206353_10088233
490 Ga0206353_11116341
491 Ga0224712_10010118
492 Ga0207692_10039997
493 Ga0207710_10021276
494 Ga0207688_10017240
495 Ga0207680_10013091
496 Ga0207647_10027311
497 Ga0207699_10050716
498 Ga0207695_10116380
499 Ga0207671_10091040
500 Ga0207693_10002666
501 Ga0207652_10152370
502 Ga0207652_10285202
503 Ga0207694_10069442
504 Ga0207687_10048124
505 Ga0207700_10117368
506 Ga0207664_10000001
507 Ga0207664_10009859
508 Ga0207664_10082271
509 Ga0207644_10006065
510 Ga0207690_10108890
511 Ga0207706_10048802
512 Ga0207709_10078055
513 Ga0207669_10214098
514 Ga0207665_10044554
515 Ga0207691_10088980
516 Ga0207711_10182268
517 Ga0207689_10003013
518 Ga0207661_10309554
519 Ga0207679_10127240
520 Ga0207712_10069579
521 Ga0207668_10167360
522 Ga0207703_10013864
523 Ga0207639_10003345
524 Ga0207678_10006768
525 Ga0207708_10000002
526 Ga0207708_10245712
527 Ga0207641_10003459
528 Ga0207641_10005344
529 Ga0207676_10055074
530 Ga0207675_100005792
531 Ga0207683_10015134
532 Ga0268266_10001523
533 Ga0268266_10074147
534 Ga0268265_10119206
535 Ga0268264_10000097
536 Ga0268264_10223581
537 Ga0307511_10025184
538 Ga0307511_10105753
539 Ga0316177_1059530
540 Ga0307513_10000002
541 Ga0307509_10221203
542 Ga0307408_100046666
543 Ga0307508_10115568
544 Ga0316576_10005909
545 Ga0316576_10015729
546 Ga0316578_10001573
547 Ga0316578_10003502
548 Ga0316578_10026249
549 Ga0316578_10197785
550 Ga0307405_10004320
551 Ga0307405_10058664
552 Ga0316577_10019993
553 Ga0316577_10023850
554 Ga0307413_10248771
555 Ga0307410_10000632
556 Ga0307410_10038712
557 Ga0307406_10051617
558 Ga0307406_10210982
559 Ga0307407_10019032
560 Ga0307407_10033593
561 Ga0307407_10112197
562 Ga0307409_100028428
563 Ga0307409_100058611
564 Ga0307409_100085285
565 Ga0307409_100129156
566 Ga0307409_100130781
567 Ga0307416_100023937
568 Ga0307416_100132127
569 Ga0307416_100287548
570 Ga0307416_100376789
571 Ga0307411_10113847
572 Ga0307415_100031549
573 Ga0307415_100040781
574 Ga0307415_100058150
575 Ga0307415_100063873
576 Ga0307415_100108136
577 Ga0316583_10006380
578 Ga0316585_10003841
579 Ga0316585_10024797
580 Ga0316585_10036340
581 Ga0316580_10000328
582 Ga0316580_10003070
583 Ga0307507_10000732
584 Ga0307510_10093319
585 Ga0373938_0024862
586 Ga0373929_0017679
587 Ga0373939_0007672
588 Ga0373960_0023571
589 Ga0316574_0008358
590 Ga0316574_0025807
591 Ga0316574_0034681
592 Ga0316574_0047199
593 Ga0316574_0180142
594 Ga0373931_0006632
595 Ga0316582_0001760
596 Ga0316582_0127678
597 Ga0316584_0005732
598 Ga0316584_0007570
599 Ga0316584_0034912
600 Ga0395900_0110223
601 Ga0395900_0302812
602 Ga0395900_0364292
603 Ga0395898_0111866
604 Ga0395898_0131874
605 Ga0395898_0190354
606 Ga0395898_0323920
607 Ga0395901_0018201
608 Ga0395901_0058350
609 Ga0395901_0064033
610 Ga0395901_0101456
611 Ga0395901_0226590
612 Ga0395901_0320736
613 Ga0439436_0002610
614 Ga0439439_0003941
615 Ga0439466_0008552
616 Ga0439433_0007347
617 Ga0439449_0001102
618 Ga0439449_0002811
619 Ga0439457_000388
620 Ga0439457_020714
621 Ga0466969_0003848
622 Ga0466969_0009967
623 Ga0466966_0002809
624 Ga0466966_0003767
625 Ga0466966_0087325
626 Ga0466966_0159260
627 Ga0466961_0028849
628 Ga0466963_0000219
629 Ga0466963_0029991
630 Ga0466963_0037122
631 Ga0466963_0100866
632 Ga0466963_0129065
633 Ga0466963_0230393
634 Ga0466971_0002291
635 Ga0466971_0005446
636 Ga0466971_0021117
637 Ga0466971_0079894
638 Ga0466971_0102837
639 Ga0466970_0008497
640 Ga0466970_0086863
641 Ga0466970_0117212
642 Ga0466957_0017702
643 Ga0466960_0003016
644 Ga0466960_0003273
645 Ga0466959_0005006
646 Ga0466958_0007606
647 Ga0466958_0013909
648 Ga0466958_0017409
649 Ga0466958_0023791
650 Ga0466958_0033492
651 Ga0466967_0037574
652 Ga0466967_0045586
653 Ga0466967_0083004
654 Ga0466967_0148541
655 Ga0466967_0320876
656 Ga0495641_0074802
657 Ga0495651_0004811
658 Ga0495664_0079286
659 Ga0495631_0092337
660 Ga0495652_0002119
661 Ga0495587_0211933
662 Ga0495634_0075060
663 Ga0495635_0004158
664 Ga0495646_0048908
665 Ga0495669_0001450
666 Ga0496100_0147469
667 Ga0496100_0274186
668 Ga0496101_0032470
669 Ga0496101_0046797
670 Ga0496101_0071540
671 Ga0496102_0000567
672 Ga0496102_0001863
673 Ga0496102_0005356
674 Ga0496102_0018243
675 Ga0496102_0369082
676 Ga0496103_0000039
677 Ga0496103_0082723
678 Ga0496103_0199859
679 Ga0496104_0006327
680 Ga0496104_0023645
681 Ga0496105_0027759
682 Ga0496105_0044487
683 Ga0496106_0129060
684 Ga0496107_0048869
685 Ga0496107_0062531
686 Ga0496107_0299874
687 Ga0496108_0028740
688 Ga0496108_0068484
689 Ga0496108_0097436
690 Ga0496108_0127138
691 Ga0496109_0003025
692 Ga0496109_0030243
693 Ga0496109_0051645
694 Ga0496110_0015300
695 Ga0496110_0020511
696 Ga0496110_0175939
697 Ga0496110_0204509
698 Ga0496111_0029613
699 Ga0496111_0068331
700 Ga0496112_0049289
701 Ga0496113_0018757
702 Ga0496113_0027754
703 Ga0496113_0031826
704 Ga0496113_0361260
705 Ga0496114_0011247
706 Ga0496114_0022306
707 Ga0496114_0029855
708 Ga0496114_0280325
709 Ga0496115_0079593
710 Ga0496118_0023981
711 Ga0496119_0000449
712 Ga0496119_0020170
713 Ga0496121_0129116
714 Ga0501031_0018519
715 Ga0501031_0023313
716 Ga0501031_0029920
717 Ga0501031_0091237
718 Ga0501032_0033356
719 Ga0501032_0102228
720 Ga0501033_0025441
721 Ga0501033_0080839
722 Ga0501036_0002071
723 Ga0501036_0005489
724 Ga0501036_0121738
725 Ga0501037_0278443
726 Ga0501038_0019760
727 Ga0501038_0025253
728 Ga0501038_0053398
729 Ga0501039_0005920
730 Ga0501039_0019816
731 Ga0501039_0026550
732 Ga0501040_0011850
733 Ga0501040_0195324
734 Ga0501041_0008355
735 Ga0501041_0010785
736 Ga0501041_0045004
737 Ga0501042_0012068
738 Ga0501042_0019320
739 Ga0501042_0019755
740 Ga0501043_0048676
741 Ga0501043_0272849
742 Ga0501046_0003312
743 Ga0501048_0009225
744 Ga0501048_0017048
745 Ga0501048_0025265
746 Ga0501068_0003547
747 Ga0501069_0027677
748 Ga0501070_0449304
749 Ga0501071_0018444
750 Ga0501072_0005287
751 Ga0501072_0029583
752 Ga0501073_0052282
753 Ga0501074_0037603
754 Ga0501074_0049782
755 Ga0501074_0239111
756 Ga0501075_0014938
757 Ga0501075_0030006
758 Ga0501075_0099922
759 Ga0501076_0001318
760 Ga0501076_0019391
761 Ga0501076_0149070
762 Ga0501076_0174229
763 Ga0501077_0030044
764 Ga0501077_0040580
765 Ga0501077_0045605
766 Ga0501079_0010892
767 Ga0501080_0004470
768 Ga0501080_0048569
769 Ga0501081_0021151
770 Ga0501081_0022120
771 Ga0501081_0023044
772 Ga0501083_0070833
773 Ga0501083_0096557
774 Ga0501035_0024869
775 Ga0501035_0229700
776 Ga0501035_0397279
777 Ga0501045_0001111
778 Ga0501045_0003207
779 Ga0501045_0023458
780 Ga0501045_0136551
781 nmdc:mga0n895_61444_c1
782 nmdc:mga0rr50_126846_c1
783 nmdc:mga08x19_222604_c1
784 Ga0495601_0011588
785 Ga0495601_0024769
786 Ga0495612_0005943
787 Ga0495619_0015492
788 Ga0500568_0001966
789 Ga0501084_0044853
790 Ga0501084_0118430
791 Ga0501082_0021169
792 Ga0501082_0026286
793 Ga0501082_0180588
794 Ga0466962_0000056
795 Ga0466962_0005165
796 Ga0466962_0007761
797 Ga0466962_0012763
798 Ga0530510_0006871
799 Ga0530510_0018326
800 Ga0530510_0045525
801 2623497704
802 2644138167
803 2644455822
804 2644610313
805 2808872885
806 2837268964
807 2868090603
808 2919449198
809 3001890495
810 8056060080

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00348

polyprenyl_synt

Polyprenyl synthetase

72

317

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q2q-assembly1.cif.gz_A-2 crystal structure of geranylgeranyl pyrophosphate synthase from corynebacterium glutamicum complexed with calcium and isoprenyl diphosphate 0.9261 10 332
3lmd-assembly1.cif.gz_A-2 crystal structure of geranylgeranyl pyrophosphate synthase from corynebacterium glutamicum atcc 13032 0.9177 1 333
3q2q-assembly1.cif.gz_A-2 crystal structure of geranylgeranyl pyrophosphate synthase from corynebacterium glutamicum complexed with calcium and isoprenyl diphosphate 0.9176 10 332
3lmd-assembly1.cif.gz_A-2 crystal structure of geranylgeranyl pyrophosphate synthase from corynebacterium glutamicum atcc 13032 0.9067 1 333
4fp4-assembly1.cif.gz_B crystal structure of isoprenoid synthase a3mx09 (target efi-501993) from pyrobaculum calidifontis 0.9041 14 218
ID Description Score Start End Superfamily
3q2qA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9261 10 332 1.10.600.10
3q2qA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9176 10 332 1.10.600.10
af_O05572_6_323_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.917 11 330 1.10.600.10
af_O05572_6_323_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9114 11 330 1.10.600.10
3oyrB00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.901 17 333 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A7K0V6A3-F1-model_v4 Polyprenyl synthetase family protein 0.9856 8 192 GO:0004659
GO:0008299
AF-A0A0R2SA72-F1-model_v4 Geranylgeranyl pyrophosphate synthase 0.9837 8 222 GO:0004659
GO:0008299
AF-A0A7W1JL86-F1-model_v4 Polyprenyl synthetase family protein 0.982 9 204 GO:0004659
GO:0008299
AF-A0A1H8SNR4-F1-model_v4 Heptaprenyl diphosphate synthase 0.9793 10 333 GO:0004659
GO:0008299
AF-A0A6B3G072-F1-model_v4 Polyprenyl synthetase family protein 0.9777 8 172 GO:0004659
GO:0008299

Map