F435987

General Info

Members Datasets Scaffolds Average Seq Length
405 239 810 137

Family's Representative Sequence

Representative Sequence 3300033179|Ga0307507_10002432|Ga0307507_100024329
Length 160
Sequence MWDLAYRGLLRTLYNDGFKLYIMQLTIPSISNLPQAARSIIEHAGNNRIFLFYGDMGAGKTTLIKELCKALGTTDNITSPTFSIVNEYHTAKDKIYHFDFYRLKDQTEALDMGYEEYFYAGAWCFIEWPEKIPDLLPEHYSNITIKVLDDGTRQVSVENI

Samples

Sample ID Description Type Environment
1 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
34 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
35 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
97 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
98 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
104 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
105 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
106 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
121 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
122 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
130 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
131 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
132 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
133 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
134 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
135 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
157 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
166 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
172 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
178 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
179 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
180 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
181 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
185 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
186 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
187 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
188 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
189 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
190 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
191 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
192 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
193 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
194 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
195 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
196 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
197 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
198 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
199 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
200 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
201 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
202 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
203 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
204 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
205 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
206 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
207 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
208 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
209 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
210 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
211 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
212 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
213 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
214 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
215 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
216 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
217 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
218 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
219 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
220 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
221 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
222 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
223 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
224 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
225 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
226 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
227 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
228 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
229 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
230 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
231 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
232 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
233 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
234 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
235 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
236 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
237 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
238 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
239 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.63
Metatranscriptomes 0.25
Isolates 10.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.9
Nodule 1.98
Rhizoplane 0.99
Rhizosphere 76.79
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307507_10002432 3300033179 Bacteria 39062
2 JGI25162J39368_1000008 3300002737 Bacteria 397212
3 JGI25162J39368_1000097 3300002737 Bacteria 96520
4 JGI25162J39368_1001750 3300002737 Bacteria 10388
5 JGI25157J39369_1003537 3300002741 Bacteria 3147
6 JGI25164J39214_1001588 3300002772 Bacteria 4830
7 JGI25165J46597_1001806 3300003214 Bacteria 9076
8 rootH1_10066801 3300003316 Bacteria 4330
9 rootH2_10051724 3300003320 Bacteria 2188
10 rootH2_10129592 3300003320 Bacteria 2066
11 rootH1_10009825 3300003323 Bacteria 13487
12 rootH1_10137211 3300003323 Bacteria 6106
13 rootH1_10319162 3300003323 Bacteria 3312
14 Ga0006562J51391_1016914 3300003578 Bacteria 3395
15 Ga0065714_10006399 3300005288 Bacteria 3489
16 Ga0065714_10006458 3300005288 Bacteria 3496
17 Ga0065714_10304051 3300005288 Unclassified 690
18 Ga0065715_10374557 3300005293 Bacteria 883
19 Ga0065715_10863652 3300005293 Bacteria 533
20 Ga0070658_10000675 3300005327 Bacteria 29517
21 Ga0070658_10046496 3300005327 Bacteria 3512
22 Ga0068869_100322915 3300005334 Bacteria 1252
23 Ga0068868_100194034 3300005338 Bacteria 1690
24 Ga0070660_100055224 3300005339 Bacteria 3069
25 Ga0070660_100074243 3300005339 Bacteria 2661
26 Ga0070671_100031981 3300005355 Bacteria 4350
27 Ga0070674_100124537 3300005356 Bacteria 1912
28 Ga0070673_100078444 3300005364 Bacteria 2672
29 Ga0070678_100006070 3300005456 Bacteria 7048
30 Ga0070662_100002625 3300005457 Bacteria 11085
31 Ga0068867_100001804 3300005459 Bacteria 14902
32 Ga0070679_100927721 3300005530 Bacteria 814
33 Ga0068853_100196358 3300005539 Bacteria 1835
34 Ga0070665_100000017 3300005548 Bacteria 448013
35 Ga0070665_100624734 3300005548 Bacteria 1090
36 Ga0068855_100000021 3300005563 Bacteria 195708
37 Ga0068855_100001368 3300005563 Bacteria 30198
38 Ga0068855_100074101 3300005563 Bacteria 3954
39 Ga0068855_100220633 3300005563 Bacteria 2126
40 Ga0068855_100297046 3300005563 Bacteria 1789
41 Ga0068854_100263277 3300005578 Bacteria 1381
42 Ga0068852_100086651 3300005616 Bacteria 2792
43 Ga0068866_10106676 3300005718 Bacteria 1555
44 Ga0068866_10107297 3300005718 Bacteria 1551
45 Ga0068858_100552477 3300005842 Bacteria 1115
46 Ga0075366_10002552 3300006195 Bacteria 9361
47 Ga0068871_100003252 3300006358 Bacteria 11143
48 Ga0068871_101703170 3300006358 Unclassified 598
49 Ga0068865_100000070 3300006881 Bacteria 53670
50 Ga0099824_1005112 3300006942 Bacteria 18608
51 Ga0079104_1000005 3300006946 Bacteria 407099
52 Ga0079104_1066479 3300006946 Bacteria 765
53 Ga0099826_10037121 3300006948 Bacteria 3436
54 Ga0105244_10000004 3300009036 Bacteria 492478
55 Ga0105240_10002855 3300009093 Bacteria 27308
56 Ga0105240_10008396 3300009093 Bacteria 14776
57 Ga0105240_10042273 3300009093 Bacteria 5808
58 Ga0105240_10180434 3300009093 Bacteria 2492
59 Ga0105240_10369851 3300009093 Bacteria 1621
60 Ga0105240_10482774 3300009093 Bacteria 1381
61 Ga0105240_10888352 3300009093 Bacteria 959
62 Ga0105240_11234390 3300009093 Bacteria 790
63 Ga0105240_11836550 3300009093 Bacteria 631
64 Ga0111539_10464031 3300009094 Bacteria 1475
65 Ga0105241_10024488 3300009174 Bacteria 4482
66 Ga0105241_10066559 3300009174 Bacteria 2786
67 Ga0105241_10174680 3300009174 Bacteria 1777
68 Ga0105241_10747921 3300009174 Bacteria 896
69 Ga0105237_10001977 3300009545 Bacteria 26075
70 Ga0105237_10008458 3300009545 Bacteria 11136
71 Ga0105237_10058718 3300009545 Bacteria 3850
72 Ga0105237_10074118 3300009545 Bacteria 3395
73 Ga0105237_10205321 3300009545 Bacteria 1971
74 Ga0105237_10285138 3300009545 Bacteria 1654
75 Ga0105237_11189644 3300009545 Bacteria 769
76 Ga0105237_11195521 3300009545 Bacteria 767
77 Ga0105238_10064791 3300009551 Bacteria 3654
78 Ga0105249_10523851 3300009553 Bacteria 1233
79 Ga0105239_10006488 3300010375 Bacteria 13566
80 Ga0105239_10008634 3300010375 Bacteria 11549
81 Ga0105239_10046548 3300010375 Bacteria 4753
82 Ga0105239_10067803 3300010375 Bacteria 3920
83 Ga0105239_10389981 3300010375 Bacteria 1575
84 Ga0105239_11022545 3300010375 Bacteria 950
85 Ga0105246_10047403 3300011119 Bacteria 2934
86 Ga0105246_10118452 3300011119 Bacteria 1958
87 Ga0157373_10000002 3300013100 Bacteria 750094
88 Ga0157373_10000906 3300013100 Bacteria 22984
89 Ga0157373_10016236 3300013100 Bacteria 5433
90 Ga0157371_10001157 3300013102 Bacteria 28382
91 Ga0157371_10033359 3300013102 Bacteria 3699
92 Ga0157371_10228872 3300013102 Bacteria 1336
93 Ga0157370_10000061 3300013104 Bacteria 115933
94 Ga0157370_10032262 3300013104 Bacteria 5115
95 Ga0157370_10033744 3300013104 Bacteria 4988
96 Ga0157370_10037604 3300013104 Bacteria 4691
97 Ga0157370_10165325 3300013104 Bacteria 2058
98 Ga0157370_11012249 3300013104 Bacteria 752
99 Ga0157369_10000345 3300013105 Bacteria 61586
100 Ga0157369_10578184 3300013105 Bacteria 1160
101 Ga0157374_10002863 3300013296 Bacteria 14485
102 Ga0157374_10003120 3300013296 Bacteria 13919
103 Ga0157374_10008123 3300013296 Bacteria 8969
104 Ga0157374_10245678 3300013296 Bacteria 1761
105 Ga0157374_10607397 3300013296 Bacteria 1104
106 Ga0157374_12510162 3300013296 Bacteria 543
107 Ga0157378_10009763 3300013297 Bacteria 8366
108 Ga0157378_10014208 3300013297 Bacteria 6968
109 Ga0157378_12271010 3300013297 Bacteria 594
110 Ga0163162_10000026 3300013306 Bacteria 178701
111 Ga0163162_10008696 3300013306 Bacteria 9881
112 Ga0163162_11423914 3300013306 Bacteria 789
113 Ga0157372_10001857 3300013307 Bacteria 22903
114 Ga0157372_10002641 3300013307 Bacteria 19411
115 Ga0157372_10056349 3300013307 Bacteria 4391
116 Ga0157372_10240882 3300013307 Bacteria 2099
117 Ga0157375_10034707 3300013308 Bacteria 4808
118 Ga0157375_10044158 3300013308 Bacteria 4327
119 Ga0157375_10064534 3300013308 Bacteria 3646
120 Ga0182008_10802789 3300014497 Bacteria 546
121 Ga0157377_10321061 3300014745 Bacteria 1029
122 Ga0157377_10643888 3300014745 Bacteria 762
123 Ga0157379_12123963 3300014968 Bacteria 557
124 Ga0157376_10306754 3300014969 Bacteria 1504
125 Ga0157376_11439268 3300014969 Bacteria 721
126 Ga0182006_1011077 3300015261 Bacteria 3982
127 Ga0182006_1040406 3300015261 Bacteria 1836
128 Ga0182006_1095267 3300015261 Bacteria 1064
129 Ga0182007_10097771 3300015262 Bacteria 970
130 Ga0163161_10000012 3300017792 Bacteria 264639
131 Ga0163161_10046491 3300017792 Bacteria 3132
132 Ga0213872_10046148 3300021361 Bacteria 1983
133 Ga0209563_104415 3300025230 Bacteria 2693
134 Ga0207427_100083 3300025231 Bacteria 142745
135 Ga0209437_100021 3300025233 Bacteria 646400
136 Ga0209437_100030 3300025233 Bacteria 532466
137 Ga0209026_1000309 3300025250 Bacteria 53002
138 Ga0209026_1006044 3300025250 Bacteria 3077
139 Ga0209026_1019374 3300025250 Unclassified 1067
140 Ga0209129_1013484 3300025258 Bacteria 1798
141 Ga0209233_1000035 3300025261 Bacteria 568478
142 Ga0209455_1000911 3300025272 Bacteria 15402
143 Ga0207655_1000008 3300025728 Bacteria 734289
144 Ga0207642_10044150 3300025899 Bacteria 1971
145 Ga0207642_10077320 3300025899 Bacteria 1605
146 Ga0207647_10019818 3300025904 Bacteria 4517
147 Ga0207645_10002024 3300025907 Bacteria 16278
148 Ga0207705_10000035 3300025909 Bacteria 201649
149 Ga0207705_10196626 3300025909 Bacteria 1527
150 Ga0207654_10006104 3300025911 Bacteria 6056
151 Ga0207654_10121145 3300025911 Bacteria 1643
152 Ga0207654_10276768 3300025911 Bacteria 1134
153 Ga0207654_10410145 3300025911 Bacteria 944
154 Ga0207695_10002500 3300025913 Bacteria 27026
155 Ga0207695_10006085 3300025913 Bacteria 15745
156 Ga0207695_10061938 3300025913 Bacteria 3865
157 Ga0207695_10280019 3300025913 Bacteria 1562
158 Ga0207671_10004973 3300025914 Bacteria 12455
159 Ga0207671_10012109 3300025914 Bacteria 6965
160 Ga0207671_10035390 3300025914 Bacteria 3706
161 Ga0207671_10106473 3300025914 Bacteria 2129
162 Ga0207671_10247372 3300025914 Bacteria 1401
163 Ga0207671_10645925 3300025914 Bacteria 843
164 Ga0207657_10066004 3300025919 Bacteria 3082
165 Ga0207657_10098610 3300025919 Bacteria 2428
166 Ga0207657_10615632 3300025919 Bacteria 847
167 Ga0207652_10787157 3300025921 Bacteria 845
168 Ga0207694_10037432 3300025924 Bacteria 3727
169 Ga0207644_10032556 3300025931 Bacteria 3638
170 Ga0207690_10564898 3300025932 Bacteria 926
171 Ga0207706_10007385 3300025933 Bacteria 10160
172 Ga0207706_10120235 3300025933 Bacteria 2309
173 Ga0207669_10179689 3300025937 Bacteria 1515
174 Ga0207704_10008834 3300025938 Bacteria 4837
175 Ga0207689_10988841 3300025942 Bacteria 710
176 Ga0207661_10634830 3300025944 Unclassified 981
177 Ga0207667_10000014 3300025949 Bacteria 421261
178 Ga0207667_10004397 3300025949 Bacteria 17264
179 Ga0207667_10061379 3300025949 Bacteria 3932
180 Ga0207667_10116905 3300025949 Bacteria 2748
181 Ga0207667_10646475 3300025949 Bacteria 1063
182 Ga0207667_10677546 3300025949 Bacteria 1035
183 Ga0207651_10193964 3300025960 Bacteria 1622
184 Ga0207640_10191509 3300025981 Bacteria 1542
185 Ga0207677_10019700 3300026023 Bacteria 4080
186 Ga0207639_10011413 3300026041 Bacteria 6171
187 Ga0207639_10175504 3300026041 Bacteria 1819
188 Ga0207639_10390119 3300026041 Bacteria 1252
189 Ga0207702_10018346 3300026078 Bacteria 5788
190 Ga0207702_10143033 3300026078 Bacteria 2167
191 Ga0207648_10004191 3300026089 Bacteria 14900
192 Ga0207683_10008462 3300026121 Bacteria 8806
193 Ga0207698_10467715 3300026142 Bacteria 1220
194 Ga0207698_11205952 3300026142 Bacteria 771
195 Ga0209281_1000094 3300027111 Bacteria 238155
196 Ga0209281_1042301 3300027111 Bacteria 760
197 Ga0209489_111537 3300027361 Bacteria 8906
198 Ga0209282_1110587 3300027666 Bacteria 1395
199 Ga0268266_10000037 3300028379 Bacteria 342368
200 Ga0268266_10622869 3300028379 Bacteria 1037
201 Ga0265323_10000861 3300028653 Bacteria 16133
202 Ga0307517_10001130 3300028786 Bacteria 45094
203 Ga0307515_10000077 3300028794 Bacteria 228162
204 Ga0307515_10001268 3300028794 Bacteria 57400
205 Ga0316177_1191401 3300030731 Bacteria 3187
206 Ga0316176_1132212 3300030732 Bacteria 4964
207 Ga0316183_1121655 3300030742 Bacteria 30139
208 Ga0316181_1251786 3300030744 Bacteria 2564
209 Ga0316181_1251850 3300030744 Bacteria 897
210 Ga0265327_10203236 3300031251 Bacteria 896
211 Ga0265316_10000445 3300031344 Bacteria 47073
212 Ga0307513_10661981 3300031456 Bacteria 751
213 Ga0307509_10036898 3300031507 Bacteria 5347
214 Ga0307509_10580194 3300031507 Bacteria 796
215 Ga0307408_100004934 3300031548 Bacteria 8978
216 Ga0307413_10000721 3300031824 Bacteria 11357
217 Ga0307413_10158670 3300031824 Bacteria 1586
218 Ga0307410_10000794 3300031852 Bacteria 13343
219 Ga0307406_10000035 3300031901 Bacteria 82953
220 Ga0307407_10001839 3300031903 Bacteria 7976
221 Ga0307412_10085146 3300031911 Bacteria 2196
222 Ga0307412_10952705 3300031911 Bacteria 755
223 Ga0307416_100011766 3300032002 Bacteria 5859
224 Ga0307414_10003842 3300032004 Bacteria 8080
225 Ga0307414_10007351 3300032004 Bacteria 6190
226 Ga0307414_10010475 3300032004 Bacteria 5383
227 Ga0307414_10039458 3300032004 Bacteria 3180
228 Ga0307414_10094201 3300032004 Bacteria 2234
229 Ga0307414_10355868 3300032004 Bacteria 1258
230 Ga0307414_10899442 3300032004 Bacteria 811
231 Ga0307414_10929347 3300032004 Bacteria 798
232 Ga0307411_10000001 3300032005 Bacteria 931810
233 Ga0307411_10471737 3300032005 Bacteria 1055
234 Ga0307510_10003117 3300033180 Bacteria 19187
235 Ga0307510_10008468 3300033180 Bacteria 12258
236 Ga0316574_0112984 3300035398 Bacteria 1741
237 Ga0316582_0221195 3300036647 Bacteria 1295
238 Ga0395899_0000793 3300037312 Bacteria 30923
239 Ga0395899_0432419 3300037312 Bacteria 865
240 Ga0395900_0001235 3300037418 Bacteria 31424
241 Ga0395900_0015395 3300037418 Bacteria 7795
242 Ga0395900_0832611 3300037418 Bacteria 849
243 Ga0395898_0002540 3300037466 Bacteria 21394
244 Ga0395898_0082490 3300037466 Bacteria 3099
245 Ga0395905_0000001 3300037471 Bacteria 2037079
246 Ga0395905_0001253 3300037471 Bacteria 31445
247 Ga0395905_0003224 3300037471 Bacteria 17546
248 Ga0395901_0000941 3300038443 Bacteria 31690
249 Ga0395901_0003465 3300038443 Bacteria 15886
250 Ga0436361_0693619 3300039447 Bacteria 8355
251 Ga0439447_021983 3300041407 Bacteria 1675
252 Ga0439466_0000900 3300041411 Bacteria 11313
253 Ga0451793_1641723 3300041452 Bacteria 593
254 Ga0451795_0104742 3300041456 Bacteria 1112
255 Ga0451795_1526939 3300041456 Bacteria 1042
256 Ga0451841_0590126 3300041498 Bacteria 557
257 Ga0451855_0585470 3300041511 Unclassified 848
258 Ga0451855_1682377 3300041511 Bacteria 671
259 Ga0439434_0192226 3300042435 Bacteria 686
260 Ga0466959_0129264 3300045049 Bacteria 1791
261 Ga0495590_0249564 3300046457 Bacteria 660
262 Ga0495629_0045785 3300046459 Bacteria 3069
263 Ga0495651_0513977 3300046462 Bacteria 765
264 Ga0495650_0000268 3300046471 Bacteria 99891
265 Ga0495650_0022329 3300046471 Bacteria 3038
266 Ga0495650_0084385 3300046471 Bacteria 1219
267 Ga0495605_0070906 3300046474 Bacteria 1647
268 Ga0495585_0000034 3300046492 Bacteria 143120
269 Ga0495585_0000092 3300046492 Bacteria 94819
270 Ga0495585_0065385 3300046492 Bacteria 1993
271 Ga0495583_0336281 3300046506 Bacteria 597
272 Ga0495606_0000009 3300046507 Bacteria 306313
273 Ga0495606_0017622 3300046507 Bacteria 5391
274 Ga0495606_0018340 3300046507 Bacteria 5252
275 Ga0495606_0018377 3300046507 Bacteria 5244
276 Ga0495606_0049051 3300046507 Bacteria 2772
277 Ga0495606_0164891 3300046507 Bacteria 1290
278 Ga0495606_0168909 3300046507 Bacteria 1270
279 Ga0495606_0405832 3300046507 Bacteria 708
280 Ga0495610_0003590 3300046512 Bacteria 11989
281 Ga0495610_0055033 3300046512 Bacteria 1920
282 Ga0495610_0168595 3300046512 Bacteria 920
283 Ga0495616_0000907 3300046513 Bacteria 21368
284 Ga0495618_0933301 3300046514 Bacteria 500
285 Ga0495631_0002726 3300046518 Bacteria 9795
286 Ga0495631_0079037 3300046518 Bacteria 1420
287 Ga0495631_0223107 3300046518 Bacteria 804
288 Ga0495632_0048095 3300046519 Bacteria 2113
289 Ga0495644_0006660 3300046523 Bacteria 4474
290 Ga0495648_0026374 3300046524 Bacteria 3913
291 Ga0495663_0029348 3300046525 Bacteria 1624
292 Ga0495652_0033146 3300046529 Bacteria 4513
293 Ga0495652_0316638 3300046529 Bacteria 1129
294 Ga0495654_0034393 3300046530 Bacteria 2557
295 Ga0495609_0003700 3300046538 Bacteria 8645
296 Ga0495622_0303254 3300046557 Bacteria 696
297 Ga0495633_0000004 3300046558 Bacteria 370781
298 Ga0495633_0002693 3300046558 Bacteria 12330
299 Ga0495668_0000058 3300046616 Bacteria 195501
300 Ga0495668_0014321 3300046616 Bacteria 4654
301 Ga0495668_0062609 3300046616 Bacteria 2050
302 Ga0495668_0312969 3300046616 Bacteria 861
303 Ga0495625_0000007 3300046660 Bacteria 565749
304 Ga0495625_0001150 3300046660 Bacteria 34053
305 Ga0495625_0003596 3300046660 Bacteria 15243
306 Ga0495625_0003990 3300046660 Bacteria 14143
307 Ga0495625_0025592 3300046660 Bacteria 4474
308 Ga0495625_0062263 3300046660 Bacteria 2638
309 Ga0495625_0101229 3300046660 Bacteria 1979
310 Ga0495625_0104406 3300046660 Bacteria 1943
311 Ga0495625_0200383 3300046660 Bacteria 1318
312 Ga0495625_0219855 3300046660 Bacteria 1245
313 Ga0495625_0808808 3300046660 Unclassified 544
314 Ga0495661_0014872 3300046665 Bacteria 5204
315 Ga0495661_0095328 3300046665 Bacteria 1685
316 Ga0495661_0173750 3300046665 Bacteria 1147
317 Ga0495588_0336877 3300046674 Bacteria 793
318 Ga0495658_0007035 3300046683 Bacteria 5551
319 Ga0495669_0388293 3300046684 Bacteria 676
320 Ga0495649_0000007 3300046694 Bacteria 518037
321 Ga0495683_0039499 3300047323 Bacteria 2385
322 Ga0495687_001260 3300047443 Bacteria 23990
323 Ga0495687_001497 3300047443 Bacteria 21340
324 Ga0495677_0022571 3300047445 Bacteria 2283
325 Ga0495677_0117690 3300047445 Bacteria 1012
326 Ga0495673_0013418 3300047469 Bacteria 4304
327 Ga0495686_0000965 3300047472 Bacteria 35434
328 Ga0495686_0111552 3300047472 Bacteria 1639
329 Ga0495686_0374474 3300047472 Bacteria 769
330 Ga0495602_0832509 3300048088 Bacteria 618
331 Ga0495614_0009240 3300048089 Bacteria 4365
332 Ga0496116_0000032 3300048919 Bacteria 419997
333 Ga0496121_0087421 3300048924 Bacteria 2447
334 Ga0496124_0025658 3300048927 Bacteria 5332
335 Ga0496124_0081715 3300048927 Bacteria 2655
336 Ga0496124_0085437 3300048927 Bacteria 2586
337 Ga0496125_0000059 3300048928 Bacteria 264149
338 Ga0496126_0034667 3300048929 Bacteria 4738
339 Ga0495678_008815 3300049459 Bacteria 5047
340 Ga0501238_000033 3300049671 Bacteria 24733
341 Ga0501249_000033 3300049679 Bacteria 73096
342 Ga0501249_015455 3300049679 Bacteria 1632
343 Ga0501249_019339 3300049679 Bacteria 1478
344 Ga0501266_000011 3300049763 Bacteria 197280
345 Ga0501280_000268 3300049776 Bacteria 13184
346 nmdc:mga0k408_1836_c1 3300050493 Bacteria 11401
347 nmdc:mga07m45_396675_c1 3300050496 Bacteria 801
348 Ga0500578_0190116 3300053086 Bacteria 1261
349 Ga0500644_0089100 3300053088 Bacteria 1151
350 Ga0500646_0000865 3300053090 Bacteria 8354
351 Ga0500641_0000017 3300053096 Bacteria 132678
352 Ga0500641_0000197 3300053096 Bacteria 22609
353 Ga0500594_0019976 3300053118 Bacteria 1666
354 Ga0500608_080987 3300053122 Bacteria 1532
355 Ga0500614_045512 3300053123 Bacteria 1133
356 Ga0500618_000006 3300053125 Bacteria 239188
357 Ga0500618_026620 3300053125 Bacteria 1380
358 Ga0500658_0000003 3300053134 Bacteria 512506
359 Ga0500559_0008593 3300053136 Bacteria 4468
360 Ga0500561_0043542 3300053137 Bacteria 1196
361 Ga0500568_0095945 3300053139 Bacteria 1115
362 Ga0500622_0000173 3300053156 Bacteria 69414
363 Ga0500624_000187 3300053157 Bacteria 24423
364 Ga0500587_019872 3300053739 Bacteria 873
365 2513235916 2513020052 Bacteria 5120511
366 2520879379 2519899754 Bacteria 5336938
367 2599480752 2599185184 Bacteria 6430550
368 2644013092 2643221600 Bacteria 5530138
369 2644372409 2643221667 Bacteria 5627472
370 2644642578 2643221716 Bacteria 4986332
371 2644684881 2643221725 Bacteria 5087956
372 2738732429 2738541279 Bacteria 6149495
373 2738764994 2738541285 Bacteria 6150075
374 2739214009 2738543007 Bacteria 6149845
375 2740001292 2739367857 Bacteria 5433684
376 2740006108 2739367858 Bacteria 5432813
377 2802653803 2802428842 Bacteria 4926114
378 2817416245 2816332280 Bacteria 5109718
379 2842904853 2842903701 Bacteria 6986368
380 2852626391 2852623160 Bacteria 4376875
381 2857614923 2857613821 Bacteria 4917088
382 2857618629 2857618242 Bacteria 5635925
383 2881363082 2881359912 Bacteria 4935907
384 2884934843 2884933994 Bacteria 4535041
385 2890740307 2890737413 Bacteria 4269751
386 2896347110 2896344016 Bacteria 3811746
387 2898716021 2898713307 Bacteria 4110805
388 2903896921 2903895155 Bacteria 5258610
389 2904422763 2904419702 Bacteria 5166287
390 2904557040 2904555929 Bacteria 5218588
391 2919195340 2919191525 Bacteria 5765973
392 2919439941 2919437846 Bacteria 6199444
393 2919687696 2919683626 Bacteria 5534354
394 2928081645 2928078545 Bacteria 6534839
395 2928150327 2928147474 Bacteria 6512076
396 2929153532 2929150217 Bacteria 5462483
397 2932085150 2932082852 Bacteria 6563563
398 2958461085 2958458903 Bacteria 5301041
399 2977270199 2977268062 Bacteria 5243061
400 3003236481 3003233435 Bacteria 4458031
401 8054310111 8054307821 Bacteria 5212224
402 8055421904 8055419101 Bacteria 5289643
403 8055590130 8055588893 Bacteria 3619545
404 8055593459 8055592153 Bacteria 5961247
405 8056442930 8056440228 Bacteria 4946504
406 Ga0307507_10002432
407 JGI25162J39368_1000008
408 JGI25162J39368_1000097
409 JGI25162J39368_1001750
410 JGI25157J39369_1003537
411 JGI25164J39214_1001588
412 JGI25165J46597_1001806
413 rootH1_10066801
414 rootH2_10051724
415 rootH2_10129592
416 rootH1_10009825
417 rootH1_10137211
418 rootH1_10319162
419 Ga0006562J51391_1016914
420 Ga0065714_10006399
421 Ga0065714_10006458
422 Ga0065714_10304051
423 Ga0065715_10374557
424 Ga0065715_10863652
425 Ga0070658_10000675
426 Ga0070658_10046496
427 Ga0068869_100322915
428 Ga0068868_100194034
429 Ga0070660_100055224
430 Ga0070660_100074243
431 Ga0070671_100031981
432 Ga0070674_100124537
433 Ga0070673_100078444
434 Ga0070678_100006070
435 Ga0070662_100002625
436 Ga0068867_100001804
437 Ga0070679_100927721
438 Ga0068853_100196358
439 Ga0070665_100000017
440 Ga0070665_100624734
441 Ga0068855_100000021
442 Ga0068855_100001368
443 Ga0068855_100074101
444 Ga0068855_100220633
445 Ga0068855_100297046
446 Ga0068854_100263277
447 Ga0068852_100086651
448 Ga0068866_10106676
449 Ga0068866_10107297
450 Ga0068858_100552477
451 Ga0075366_10002552
452 Ga0068871_100003252
453 Ga0068871_101703170
454 Ga0068865_100000070
455 Ga0099824_1005112
456 Ga0079104_1000005
457 Ga0079104_1066479
458 Ga0099826_10037121
459 Ga0105244_10000004
460 Ga0105240_10002855
461 Ga0105240_10008396
462 Ga0105240_10042273
463 Ga0105240_10180434
464 Ga0105240_10369851
465 Ga0105240_10482774
466 Ga0105240_10888352
467 Ga0105240_11234390
468 Ga0105240_11836550
469 Ga0111539_10464031
470 Ga0105241_10024488
471 Ga0105241_10066559
472 Ga0105241_10174680
473 Ga0105241_10747921
474 Ga0105237_10001977
475 Ga0105237_10008458
476 Ga0105237_10058718
477 Ga0105237_10074118
478 Ga0105237_10205321
479 Ga0105237_10285138
480 Ga0105237_11189644
481 Ga0105237_11195521
482 Ga0105238_10064791
483 Ga0105249_10523851
484 Ga0105239_10006488
485 Ga0105239_10008634
486 Ga0105239_10046548
487 Ga0105239_10067803
488 Ga0105239_10389981
489 Ga0105239_11022545
490 Ga0105246_10047403
491 Ga0105246_10118452
492 Ga0157373_10000002
493 Ga0157373_10000906
494 Ga0157373_10016236
495 Ga0157371_10001157
496 Ga0157371_10033359
497 Ga0157371_10228872
498 Ga0157370_10000061
499 Ga0157370_10032262
500 Ga0157370_10033744
501 Ga0157370_10037604
502 Ga0157370_10165325
503 Ga0157370_11012249
504 Ga0157369_10000345
505 Ga0157369_10578184
506 Ga0157374_10002863
507 Ga0157374_10003120
508 Ga0157374_10008123
509 Ga0157374_10245678
510 Ga0157374_10607397
511 Ga0157374_12510162
512 Ga0157378_10009763
513 Ga0157378_10014208
514 Ga0157378_12271010
515 Ga0163162_10000026
516 Ga0163162_10008696
517 Ga0163162_11423914
518 Ga0157372_10001857
519 Ga0157372_10002641
520 Ga0157372_10056349
521 Ga0157372_10240882
522 Ga0157375_10034707
523 Ga0157375_10044158
524 Ga0157375_10064534
525 Ga0182008_10802789
526 Ga0157377_10321061
527 Ga0157377_10643888
528 Ga0157379_12123963
529 Ga0157376_10306754
530 Ga0157376_11439268
531 Ga0182006_1011077
532 Ga0182006_1040406
533 Ga0182006_1095267
534 Ga0182007_10097771
535 Ga0163161_10000012
536 Ga0163161_10046491
537 Ga0213872_10046148
538 Ga0209563_104415
539 Ga0207427_100083
540 Ga0209437_100021
541 Ga0209437_100030
542 Ga0209026_1000309
543 Ga0209026_1006044
544 Ga0209026_1019374
545 Ga0209129_1013484
546 Ga0209233_1000035
547 Ga0209455_1000911
548 Ga0207655_1000008
549 Ga0207642_10044150
550 Ga0207642_10077320
551 Ga0207647_10019818
552 Ga0207645_10002024
553 Ga0207705_10000035
554 Ga0207705_10196626
555 Ga0207654_10006104
556 Ga0207654_10121145
557 Ga0207654_10276768
558 Ga0207654_10410145
559 Ga0207695_10002500
560 Ga0207695_10006085
561 Ga0207695_10061938
562 Ga0207695_10280019
563 Ga0207671_10004973
564 Ga0207671_10012109
565 Ga0207671_10035390
566 Ga0207671_10106473
567 Ga0207671_10247372
568 Ga0207671_10645925
569 Ga0207657_10066004
570 Ga0207657_10098610
571 Ga0207657_10615632
572 Ga0207652_10787157
573 Ga0207694_10037432
574 Ga0207644_10032556
575 Ga0207690_10564898
576 Ga0207706_10007385
577 Ga0207706_10120235
578 Ga0207669_10179689
579 Ga0207704_10008834
580 Ga0207689_10988841
581 Ga0207661_10634830
582 Ga0207667_10000014
583 Ga0207667_10004397
584 Ga0207667_10061379
585 Ga0207667_10116905
586 Ga0207667_10646475
587 Ga0207667_10677546
588 Ga0207651_10193964
589 Ga0207640_10191509
590 Ga0207677_10019700
591 Ga0207639_10011413
592 Ga0207639_10175504
593 Ga0207639_10390119
594 Ga0207702_10018346
595 Ga0207702_10143033
596 Ga0207648_10004191
597 Ga0207683_10008462
598 Ga0207698_10467715
599 Ga0207698_11205952
600 Ga0209281_1000094
601 Ga0209281_1042301
602 Ga0209489_111537
603 Ga0209282_1110587
604 Ga0268266_10000037
605 Ga0268266_10622869
606 Ga0265323_10000861
607 Ga0307517_10001130
608 Ga0307515_10000077
609 Ga0307515_10001268
610 Ga0316177_1191401
611 Ga0316176_1132212
612 Ga0316183_1121655
613 Ga0316181_1251786
614 Ga0316181_1251850
615 Ga0265327_10203236
616 Ga0265316_10000445
617 Ga0307513_10661981
618 Ga0307509_10036898
619 Ga0307509_10580194
620 Ga0307408_100004934
621 Ga0307413_10000721
622 Ga0307413_10158670
623 Ga0307410_10000794
624 Ga0307406_10000035
625 Ga0307407_10001839
626 Ga0307412_10085146
627 Ga0307412_10952705
628 Ga0307416_100011766
629 Ga0307414_10003842
630 Ga0307414_10007351
631 Ga0307414_10010475
632 Ga0307414_10039458
633 Ga0307414_10094201
634 Ga0307414_10355868
635 Ga0307414_10899442
636 Ga0307414_10929347
637 Ga0307411_10000001
638 Ga0307411_10471737
639 Ga0307510_10003117
640 Ga0307510_10008468
641 Ga0316574_0112984
642 Ga0316582_0221195
643 Ga0395899_0000793
644 Ga0395899_0432419
645 Ga0395900_0001235
646 Ga0395900_0015395
647 Ga0395900_0832611
648 Ga0395898_0002540
649 Ga0395898_0082490
650 Ga0395905_0000001
651 Ga0395905_0001253
652 Ga0395905_0003224
653 Ga0395901_0000941
654 Ga0395901_0003465
655 Ga0436361_0693619
656 Ga0439447_021983
657 Ga0439466_0000900
658 Ga0451793_1641723
659 Ga0451795_0104742
660 Ga0451795_1526939
661 Ga0451841_0590126
662 Ga0451855_0585470
663 Ga0451855_1682377
664 Ga0439434_0192226
665 Ga0466959_0129264
666 Ga0495590_0249564
667 Ga0495629_0045785
668 Ga0495651_0513977
669 Ga0495650_0000268
670 Ga0495650_0022329
671 Ga0495650_0084385
672 Ga0495605_0070906
673 Ga0495585_0000034
674 Ga0495585_0000092
675 Ga0495585_0065385
676 Ga0495583_0336281
677 Ga0495606_0000009
678 Ga0495606_0017622
679 Ga0495606_0018340
680 Ga0495606_0018377
681 Ga0495606_0049051
682 Ga0495606_0164891
683 Ga0495606_0168909
684 Ga0495606_0405832
685 Ga0495610_0003590
686 Ga0495610_0055033
687 Ga0495610_0168595
688 Ga0495616_0000907
689 Ga0495618_0933301
690 Ga0495631_0002726
691 Ga0495631_0079037
692 Ga0495631_0223107
693 Ga0495632_0048095
694 Ga0495644_0006660
695 Ga0495648_0026374
696 Ga0495663_0029348
697 Ga0495652_0033146
698 Ga0495652_0316638
699 Ga0495654_0034393
700 Ga0495609_0003700
701 Ga0495622_0303254
702 Ga0495633_0000004
703 Ga0495633_0002693
704 Ga0495668_0000058
705 Ga0495668_0014321
706 Ga0495668_0062609
707 Ga0495668_0312969
708 Ga0495625_0000007
709 Ga0495625_0001150
710 Ga0495625_0003596
711 Ga0495625_0003990
712 Ga0495625_0025592
713 Ga0495625_0062263
714 Ga0495625_0101229
715 Ga0495625_0104406
716 Ga0495625_0200383
717 Ga0495625_0219855
718 Ga0495625_0808808
719 Ga0495661_0014872
720 Ga0495661_0095328
721 Ga0495661_0173750
722 Ga0495588_0336877
723 Ga0495658_0007035
724 Ga0495669_0388293
725 Ga0495649_0000007
726 Ga0495683_0039499
727 Ga0495687_001260
728 Ga0495687_001497
729 Ga0495677_0022571
730 Ga0495677_0117690
731 Ga0495673_0013418
732 Ga0495686_0000965
733 Ga0495686_0111552
734 Ga0495686_0374474
735 Ga0495602_0832509
736 Ga0495614_0009240
737 Ga0496116_0000032
738 Ga0496121_0087421
739 Ga0496124_0025658
740 Ga0496124_0081715
741 Ga0496124_0085437
742 Ga0496125_0000059
743 Ga0496126_0034667
744 Ga0495678_008815
745 Ga0501238_000033
746 Ga0501249_000033
747 Ga0501249_015455
748 Ga0501249_019339
749 Ga0501266_000011
750 Ga0501280_000268
751 nmdc:mga0k408_1836_c1
752 nmdc:mga07m45_396675_c1
753 Ga0500578_0190116
754 Ga0500644_0089100
755 Ga0500646_0000865
756 Ga0500641_0000017
757 Ga0500641_0000197
758 Ga0500594_0019976
759 Ga0500608_080987
760 Ga0500614_045512
761 Ga0500618_000006
762 Ga0500618_026620
763 Ga0500658_0000003
764 Ga0500559_0008593
765 Ga0500561_0043542
766 Ga0500568_0095945
767 Ga0500622_0000173
768 Ga0500624_000187
769 Ga0500587_019872
770 2513235916
771 2520879379
772 2599480752
773 2644013092
774 2644372409
775 2644642578
776 2644684881
777 2738732429
778 2738764994
779 2739214009
780 2740001292
781 2740006108
782 2802653803
783 2817416245
784 2842904853
785 2852626391
786 2857614923
787 2857618629
788 2881363082
789 2884934843
790 2890740307
791 2896347110
792 2898716021
793 2903896921
794 2904422763
795 2904557040
796 2919195340
797 2919439941
798 2919687696
799 2928081645
800 2928150327
801 2929153532
802 2932085150
803 2958461085
804 2977270199
805 3003236481
806 8054310111
807 8055421904
808 8055590130
809 8055593459
810 8056442930

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02367

TsaE

Threonylcarbamoyl adenosine biosynthesis protein TsaE

27

155

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5np9-assembly1.cif.gz_A crystal structure of bacillus subtilis ydib in complex with adp 0.8742 1 138
6s84-assembly1.cif.gz_E tsabde complex from thermotoga maritima 0.8477 1 135
5np9-assembly1.cif.gz_A crystal structure of bacillus subtilis ydib in complex with adp 0.8449 1 138
5mvr-assembly1.cif.gz_A crystal structure of bacillus subtilus ydib 0.838 1 138
6s84-assembly1.cif.gz_E tsabde complex from thermotoga maritima 0.8254 1 135
ID Description Score Start End Superfamily
af_P0AF67_2_153_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8629 1 138 3.40.50.300
af_P0AF67_2_153_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8572 1 138 3.40.50.300
af_Q2FWK9_1_139_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8527 7 137 3.40.50.300
af_P9WFS7_20_166_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8212 1 138 3.40.50.300
af_P9WFS7_20_166_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8159 1 138 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3B0U9P2-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9735 1 137 GO:0002949
GO:0005524
GO:0005737
AF-A0A1M7KR79-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9727 1 138 GO:0002949
GO:0005524
GO:0005737
AF-A0A1T5C791-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9727 1 138 GO:0002949
GO:0005524
GO:0005737
AF-A0A2P8G3Q5-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.97 1 138 GO:0002949
GO:0005524
GO:0005737
AF-A0A5E7Y938-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9697 1 137 GO:0002949
GO:0005524
GO:0005737

Map