F436013

General Info

Members Datasets Scaffolds Average Seq Length
405 187 811 163

Family's Representative Sequence

Representative Sequence 3300041486|Ga0451807_0458474|Ga0451807_0458474_32_508
Length 158
Sequence MKRSIIALIAICAVTFLGCENSNGQENAKKLSKPAKEWKKTLSANAYHIMVESGTEPPFQNAYHDNHQKGIYVSAATGEVLFSSEDKFDSGTGWPSFVKPVDPKKIKIVKDYTYGVREEVIEASTGLHLGHVFDDGPANRGGKRYCMNSGALKFIKQP

Samples

Sample ID Description Type Environment
1 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
120 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
121 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
122 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
135 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
136 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
164 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
165 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
166 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
167 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
168 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
169 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
170 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
173 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
174 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
175 2739367651 Pedobacter sp. OK291 Isolate Unclassified
176 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
177 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
178 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
179 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
180 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
181 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
182 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
183 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
184 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
185 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
186 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
187 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.31
Metatranscriptomes 0.49
Isolates 4.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.89
Nodule 0
Rhizoplane 1.48
Rhizosphere 78.27
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451807_0458474 3300041486 Bacteria 578
2 JGI24740J21852_10006519 3300001979 Bacteria 4822
3 JGI24740J21852_10011146 3300001979 Bacteria 3432
4 JGI24739J22299_10012706 3300001989 Bacteria 3088
5 JGI24737J22298_10015167 3300001990 Unclassified 2495
6 JGI24735J21928_10000003 3300002067 Bacteria 385983
7 JGI24744J21845_10011597 3300002077 Bacteria 1801
8 JGI25162J39368_1000022 3300002737 Bacteria 239510
9 JGI25154J39366_1000041 3300002738 Bacteria 144221
10 JGI25157J39369_1005103 3300002741 Bacteria 2202
11 JGI25157J39369_1009319 3300002741 Bacteria 1326
12 JGI25164J39214_1001399 3300002772 Bacteria 5723
13 JGI25165J46597_1001179 3300003214 Bacteria 16018
14 JGI25153J46596_10007527 3300003215 Bacteria 5336
15 rootH1_10038740 3300003316 Bacteria 12495
16 rootH1_10038740 3300003323 Bacteria 4304
17 rootH1_10043582 3300003316 Bacteria 19382
18 rootH1_10061015 3300003316 Bacteria 2913
19 rootH1_10126176 3300003316 Bacteria 4481
20 rootH1_10193810 3300003316 Bacteria 1860
21 rootH2_10002077 3300003320 Bacteria 2407
22 rootH2_10003269 3300003320 Bacteria 51191
23 rootH2_10004415 3300003320 Bacteria 27098
24 rootH2_10057092 3300003320 Bacteria 3648
25 rootH2_10073845 3300003320 Bacteria 5806
26 rootH2_10096525 3300003320 Bacteria 5981
27 rootH2_10250623 3300003320 Bacteria 1595
28 rootL2_10109183 3300003322 Bacteria 3216
29 rootL2_10310450 3300003322 Bacteria 1366
30 rootH1_10006785 3300003323 Bacteria 51850
31 rootH1_10028473 3300003323 Bacteria 8789
32 rootH1_10083018 3300003323 Bacteria 5372
33 rootH1_10106222 3300003323 Bacteria 4126
34 rootH1_10256739 3300003323 Bacteria 2474
35 rootH1_10295516 3300003323 Bacteria 1684
36 JGI25160J50197_1023926 3300003354 Bacteria 1746
37 Ga0065165_1036539 3300005262 Bacteria 1498
38 Ga0065714_10078008 3300005288 Bacteria 2625
39 Ga0070658_10000019 3300005327 Bacteria 194742
40 Ga0070658_10302097 3300005327 Bacteria 1365
41 Ga0070676_10001139 3300005328 Bacteria 13274
42 Ga0070683_100082764 3300005329 Bacteria 3006
43 Ga0070660_100076030 3300005339 Unclassified 2630
44 Ga0070660_100290070 3300005339 Bacteria 1340
45 Ga0070660_100812259 3300005339 Unclassified 787
46 Ga0070661_100586282 3300005344 Bacteria 900
47 Ga0070671_100014867 3300005355 Bacteria 6289
48 Ga0070673_100010060 3300005364 Bacteria 6385
49 Ga0070673_100022160 3300005364 Bacteria 4619
50 Ga0070673_100745816 3300005364 Bacteria 901
51 Ga0070659_100000516 3300005366 Bacteria 28377
52 Ga0070659_100052720 3300005366 Unclassified 3200
53 Ga0070659_100184461 3300005366 Bacteria 1713
54 Ga0070662_100000167 3300005457 Bacteria 38204
55 Ga0068867_100000116 3300005459 Bacteria 50447
56 Ga0070679_100107671 3300005530 Bacteria 2773
57 Ga0068853_100029566 3300005539 Bacteria 4621
58 Ga0068853_100061885 3300005539 Bacteria 3238
59 Ga0068853_100310347 3300005539 Bacteria 1460
60 Ga0068853_100317367 3300005539 Bacteria 1444
61 Ga0068853_100476372 3300005539 Bacteria 1176
62 Ga0070672_100044786 3300005543 Bacteria 3419
63 Ga0070665_100000003 3300005548 Bacteria 811857
64 Ga0070665_100000118 3300005548 Bacteria 149830
65 Ga0068855_100000519 3300005563 Bacteria 47297
66 Ga0068855_100004987 3300005563 Bacteria 16203
67 Ga0068855_100036541 3300005563 Bacteria 5846
68 Ga0068855_100104634 3300005563 Bacteria 3255
69 Ga0068855_100147695 3300005563 Bacteria 2675
70 Ga0068855_100246565 3300005563 Bacteria 1994
71 Ga0068855_100247567 3300005563 Bacteria 1989
72 Ga0068855_100433366 3300005563 Bacteria 1437
73 Ga0068855_100865230 3300005563 Bacteria 957
74 Ga0068854_100452075 3300005578 Bacteria 1073
75 Ga0068856_100286632 3300005614 Bacteria 1664
76 Ga0068856_100508535 3300005614 Bacteria 1226
77 Ga0068856_101080656 3300005614 Bacteria 820
78 Ga0068852_100022204 3300005616 Bacteria 5085
79 Ga0068852_100027413 3300005616 Bacteria 4643
80 Ga0068852_100221709 3300005616 Bacteria 1799
81 Ga0068866_10158306 3300005718 Bacteria 1318
82 Ga0068851_10511185 3300005834 Bacteria 721
83 Ga0068858_100493617 3300005842 Bacteria 1182
84 Ga0075366_10000849 3300006195 Bacteria 14722
85 Ga0075366_10033461 3300006195 Bacteria 3028
86 Ga0075366_10156095 3300006195 Bacteria 1382
87 Ga0097621_100000054 3300006237 Bacteria 59756
88 Ga0097621_100000365 3300006237 Bacteria 31399
89 Ga0068871_100000145 3300006358 Bacteria 46320
90 Ga0068871_100000248 3300006358 Bacteria 37581
91 Ga0068865_100000051 3300006881 Bacteria 65346
92 Ga0068865_100000211 3300006881 Bacteria 32506
93 Ga0105240_10002706 3300009093 Bacteria 28164
94 Ga0105240_10010766 3300009093 Bacteria 12824
95 Ga0105240_10109758 3300009093 Bacteria 3340
96 Ga0105240_10155147 3300009093 Bacteria 2724
97 Ga0105240_10219528 3300009093 Bacteria 2216
98 Ga0105240_10222857 3300009093 Bacteria 2196
99 Ga0105240_10249441 3300009093 Bacteria 2054
100 Ga0105240_10267936 3300009093 Bacteria 1968
101 Ga0105240_10544904 3300009093 Bacteria 1284
102 Ga0105240_10652558 3300009093 Bacteria 1153
103 Ga0105240_10908367 3300009093 Bacteria 947
104 Ga0105240_11759600 3300009093 Bacteria 646
105 Ga0105245_10182148 3300009098 Bacteria 2008
106 Ga0105241_10002488 3300009174 Bacteria 13845
107 Ga0105241_10004950 3300009174 Bacteria 9827
108 Ga0105241_10018205 3300009174 Bacteria 5164
109 Ga0105241_10642219 3300009174 Bacteria 963
110 Ga0105242_10081974 3300009176 Unclassified 2699
111 Ga0105237_10001447 3300009545 Bacteria 31365
112 Ga0105237_10001687 3300009545 Bacteria 28587
113 Ga0105237_10002107 3300009545 Bacteria 25126
114 Ga0105237_10002246 3300009545 Bacteria 24061
115 Ga0105237_10026057 3300009545 Bacteria 5976
116 Ga0105237_10026966 3300009545 Bacteria 5869
117 Ga0105237_10255784 3300009545 Bacteria 1753
118 Ga0105237_10359144 3300009545 Bacteria 1461
119 Ga0105237_10523327 3300009545 Bacteria 1193
120 Ga0105237_10726683 3300009545 Bacteria 999
121 Ga0105237_10994846 3300009545 Bacteria 845
122 Ga0105238_10096637 3300009551 Bacteria 2940
123 Ga0105238_10183082 3300009551 Bacteria 2071
124 Ga0105238_11102221 3300009551 Bacteria 817
125 Ga0105239_10000002 3300010375 Bacteria 610298
126 Ga0105239_10000440 3300010375 Bacteria 60691
127 Ga0105239_10001688 3300010375 Bacteria 29112
128 Ga0105239_10013721 3300010375 Bacteria 8996
129 Ga0105239_10067347 3300010375 Bacteria 3934
130 Ga0105239_10075730 3300010375 Bacteria 3701
131 Ga0105239_10133585 3300010375 Bacteria 2762
132 Ga0105239_10655837 3300010375 Bacteria 1199
133 Ga0105239_10727843 3300010375 Bacteria 1135
134 Ga0105246_10104735 3300011119 Bacteria 2066
135 Ga0157373_10000273 3300013100 Bacteria 41492
136 Ga0157371_10042240 3300013102 Bacteria 3250
137 Ga0157371_10142645 3300013102 Bacteria 1706
138 Ga0157370_10223259 3300013104 Bacteria 1745
139 Ga0157370_10386921 3300013104 Bacteria 1288
140 Ga0157370_10664814 3300013104 Unclassified 952
141 Ga0157369_10003273 3300013105 Bacteria 19291
142 Ga0157369_10368658 3300013105 Bacteria 1491
143 Ga0157374_10010923 3300013296 Bacteria 7840
144 Ga0157374_10014928 3300013296 Bacteria 6807
145 Ga0157374_10027886 3300013296 Bacteria 5098
146 Ga0157374_10036041 3300013296 Bacteria 4530
147 Ga0157374_10078775 3300013296 Bacteria 3121
148 Ga0157374_10238055 3300013296 Unclassified 1789
149 Ga0157374_10394370 3300013296 Bacteria 1380
150 Ga0157374_10939819 3300013296 Bacteria 883
151 Ga0157378_10006148 3300013297 Bacteria 10518
152 Ga0157378_10049108 3300013297 Bacteria 3753
153 Ga0157378_10088410 3300013297 Bacteria 2812
154 Ga0157378_10126255 3300013297 Bacteria 2363
155 Ga0163162_10000012 3300013306 Bacteria 292674
156 Ga0163162_10000064 3300013306 Bacteria 103542
157 Ga0163162_10045985 3300013306 Bacteria 4375
158 Ga0157372_10000021 3300013307 Bacteria 207801
159 Ga0157372_10000428 3300013307 Bacteria 46270
160 Ga0157372_10013237 3300013307 Bacteria 8805
161 Ga0157372_10148143 3300013307 Bacteria 2707
162 Ga0157372_10221212 3300013307 Bacteria 2195
163 Ga0157372_11577403 3300013307 Bacteria 756
164 Ga0157375_10006705 3300013308 Bacteria 10031
165 Ga0157375_10132747 3300013308 Bacteria 2611
166 Ga0157375_11058585 3300013308 Bacteria 948
167 Ga0157377_10031946 3300014745 Bacteria 2864
168 Ga0157377_10604563 3300014745 Bacteria 783
169 Ga0157376_10176159 3300014969 Bacteria 1951
170 Ga0163161_10000046 3300017792 Bacteria 127211
171 Ga0213872_10218640 3300021361 Bacteria 811
172 Ga0224712_10157962 3300022467 Bacteria 1009
173 Ga0207427_100171 3300025231 Bacteria 71988
174 Ga0209437_100024 3300025233 Bacteria 592878
175 Ga0209437_100052 3300025233 Bacteria 380548
176 Ga0209646_1000122 3300025246 Bacteria 144486
177 Ga0209026_1000631 3300025250 Bacteria 22097
178 Ga0209026_1001074 3300025250 Bacteria 13206
179 Ga0209026_1004283 3300025250 Bacteria 4308
180 Ga0209129_1008760 3300025258 Bacteria 2765
181 Ga0209233_1000067 3300025261 Bacteria 380554
182 Ga0209233_1017605 3300025261 Bacteria 1943
183 Ga0209758_1008810 3300025297 Bacteria 6426
184 Ga0207426_1000530 3300025302 Bacteria 55033
185 Ga0207642_10049288 3300025899 Bacteria 1893
186 Ga0207647_10001745 3300025904 Bacteria 16667
187 Ga0207647_10048827 3300025904 Bacteria 2627
188 Ga0207647_10346872 3300025904 Bacteria 841
189 Ga0207645_10000652 3300025907 Bacteria 28838
190 Ga0207645_10000689 3300025907 Bacteria 28055
191 Ga0207705_10000069 3300025909 Bacteria 133094
192 Ga0207705_10000090 3300025909 Bacteria 113233
193 Ga0207705_10222965 3300025909 Bacteria 1432
194 Ga0207654_10002503 3300025911 Bacteria 9337
195 Ga0207695_10005523 3300025913 Bacteria 16736
196 Ga0207695_10008620 3300025913 Bacteria 12740
197 Ga0207695_10057959 3300025913 Bacteria 4022
198 Ga0207695_10070621 3300025913 Bacteria 3569
199 Ga0207695_10103414 3300025913 Bacteria 2840
200 Ga0207695_10378568 3300025913 Bacteria 1301
201 Ga0207695_10426860 3300025913 Unclassified 1209
202 Ga0207695_10469605 3300025913 Bacteria 1141
203 Ga0207695_10858774 3300025913 Bacteria 787
204 Ga0207671_10000514 3300025914 Bacteria 52449
205 Ga0207671_10001726 3300025914 Bacteria 24605
206 Ga0207671_10005896 3300025914 Bacteria 11115
207 Ga0207671_10015797 3300025914 Bacteria 5892
208 Ga0207671_10016854 3300025914 Bacteria 5659
209 Ga0207671_10029911 3300025914 Bacteria 4064
210 Ga0207671_10030260 3300025914 Bacteria 4039
211 Ga0207671_10043295 3300025914 Bacteria 3329
212 Ga0207671_10459431 3300025914 Bacteria 1014
213 Ga0207671_10572392 3300025914 Bacteria 900
214 Ga0207657_10059476 3300025919 Bacteria 3283
215 Ga0207657_10194181 3300025919 Bacteria 1636
216 Ga0207649_10768412 3300025920 Bacteria 751
217 Ga0207652_10218800 3300025921 Bacteria 1716
218 Ga0207694_10044494 3300025924 Bacteria 3428
219 Ga0207694_10313937 3300025924 Bacteria 1293
220 Ga0207687_10957381 3300025927 Bacteria 733
221 Ga0207644_10000740 3300025931 Bacteria 20704
222 Ga0207644_10084522 3300025931 Bacteria 2352
223 Ga0207690_10000858 3300025932 Bacteria 19501
224 Ga0207690_10135939 3300025932 Bacteria 1805
225 Ga0207706_10000257 3300025933 Bacteria 57965
226 Ga0207686_10085649 3300025934 Unclassified 2068
227 Ga0207669_10788387 3300025937 Bacteria 787
228 Ga0207704_10000046 3300025938 Bacteria 86187
229 Ga0207704_10000124 3300025938 Bacteria 41992
230 Ga0207691_10125730 3300025940 Bacteria 2269
231 Ga0207661_10059886 3300025944 Bacteria 3070
232 Ga0207667_10000037 3300025949 Bacteria 297252
233 Ga0207667_10009468 3300025949 Bacteria 11471
234 Ga0207667_10013674 3300025949 Bacteria 9276
235 Ga0207667_10029747 3300025949 Bacteria 5918
236 Ga0207667_10037208 3300025949 Bacteria 5204
237 Ga0207667_10063923 3300025949 Bacteria 3844
238 Ga0207667_10105967 3300025949 Bacteria 2900
239 Ga0207667_10216246 3300025949 Bacteria 1964
240 Ga0207667_10336000 3300025949 Bacteria 1542
241 Ga0207667_11478407 3300025949 Bacteria 651
242 Ga0207651_10013857 3300025960 Bacteria 4632
243 Ga0207651_10669449 3300025960 Bacteria 912
244 Ga0207640_11125079 3300025981 Bacteria 696
245 Ga0207677_10093089 3300026023 Bacteria 2196
246 Ga0207703_10417559 3300026035 Bacteria 1248
247 Ga0207639_10007160 3300026041 Bacteria 7599
248 Ga0207639_10014135 3300026041 Bacteria 5605
249 Ga0207639_10040324 3300026041 Bacteria 3484
250 Ga0207639_10360390 3300026041 Bacteria 1301
251 Ga0207639_11029301 3300026041 Bacteria 771
252 Ga0207639_11299376 3300026041 Unclassified 683
253 Ga0207639_12098895 3300026041 Bacteria 526
254 Ga0207702_10001627 3300026078 Bacteria 22236
255 Ga0207702_10052628 3300026078 Unclassified 3446
256 Ga0207702_10501487 3300026078 Bacteria 1183
257 Ga0207648_10000257 3300026089 Bacteria 57438
258 Ga0207683_11028565 3300026121 Bacteria 765
259 Ga0207698_10016186 3300026142 Bacteria 5019
260 Ga0207698_10094490 3300026142 Bacteria 2458
261 Ga0207698_10377284 3300026142 Bacteria 1348
262 Ga0268266_10000078 3300028379 Bacteria 213632
263 Ga0268266_10000121 3300028379 Bacteria 154995
264 Ga0307517_10002529 3300028786 Bacteria 29143
265 Ga0307515_10000778 3300028794 Bacteria 73451
266 Ga0307515_10003029 3300028794 Bacteria 35637
267 Ga0265327_10228315 3300031251 Bacteria 835
268 Ga0265327_10265282 3300031251 Bacteria 762
269 Ga0307516_10323489 3300031730 Bacteria 1213
270 Ga0307416_100000001 3300032002 Bacteria 515017
271 Ga0307507_10002030 3300033179 Bacteria 43887
272 Ga0307510_10001211 3300033180 Bacteria 27977
273 Ga0307510_10006887 3300033180 Bacteria 13556
274 Ga0395899_0000001 3300037312 Bacteria 1750322
275 Ga0395899_0000534 3300037312 Bacteria 41504
276 Ga0395899_0008563 3300037312 Bacteria 7880
277 Ga0395899_0030071 3300037312 Bacteria 4087
278 Ga0395899_0080360 3300037312 Bacteria 2373
279 Ga0395900_0001900 3300037418 Bacteria 23785
280 Ga0395900_0010207 3300037418 Bacteria 9604
281 Ga0395900_0012659 3300037418 Bacteria 8624
282 Ga0395898_0034902 3300037466 Bacteria 5005
283 Ga0395898_0085793 3300037466 Bacteria 3035
284 Ga0395898_0113865 3300037466 Bacteria 2592
285 Ga0395905_0000347 3300037471 Bacteria 65943
286 Ga0395905_0000807 3300037471 Bacteria 41139
287 Ga0395905_0001935 3300037471 Bacteria 23767
288 Ga0395901_0004286 3300038443 Bacteria 14391
289 Ga0395901_0012756 3300038443 Bacteria 8524
290 Ga0395901_0014688 3300038443 Bacteria 7958
291 Ga0436361_0527238 3300039447 Bacteria 5128
292 Ga0451794_03868 3300041446 Bacteria 506
293 Ga0451791_0631650 3300041451 Bacteria 719
294 Ga0451807_1440092 3300041486 Bacteria 626
295 Ga0451845_0976831 3300041501 Bacteria 675
296 Ga0439448_0009718 3300042005 Bacteria 2840
297 Ga0439448_0040466 3300042005 Bacteria 1506
298 Ga0466966_0005500 3300044684 Bacteria 8322
299 Ga0466966_0050448 3300044684 Bacteria 2647
300 Ga0466959_0082070 3300045049 Bacteria 2323
301 Ga0495592_0175107 3300046454 Bacteria 1466
302 Ga0495638_0144358 3300046460 Bacteria 1386
303 Ga0495638_0194796 3300046460 Bacteria 1148
304 Ga0495650_0000023 3300046471 Bacteria 527763
305 Ga0495585_0000801 3300046492 Bacteria 27427
306 Ga0495585_0001092 3300046492 Bacteria 22350
307 Ga0495585_0002645 3300046492 Bacteria 12593
308 Ga0495583_0085099 3300046506 Bacteria 1369
309 Ga0495606_0000654 3300046507 Bacteria 54570
310 Ga0495606_0021048 3300046507 Bacteria 4786
311 Ga0495606_0024461 3300046507 Bacteria 4351
312 Ga0495606_0140490 3300046507 Unclassified 1427
313 Ga0495606_0292720 3300046507 Bacteria 885
314 Ga0495606_0550798 3300046507 Bacteria 574
315 Ga0495610_0002450 3300046512 Bacteria 15599
316 Ga0495610_0155525 3300046512 Bacteria 971
317 Ga0495616_0000975 3300046513 Bacteria 20508
318 Ga0495616_0005764 3300046513 Bacteria 7575
319 Ga0495616_0006078 3300046513 Bacteria 7357
320 Ga0495631_0008419 3300046518 Bacteria 5199
321 Ga0495631_0015907 3300046518 Bacteria 3595
322 Ga0495632_0094409 3300046519 Bacteria 1415
323 Ga0495637_0094597 3300046520 Bacteria 1174
324 Ga0495644_0006888 3300046523 Bacteria 4401
325 Ga0495648_0003373 3300046524 Bacteria 14063
326 Ga0495652_0029328 3300046529 Bacteria 4835
327 Ga0495587_0315603 3300046536 Bacteria 873
328 Ga0495609_0244700 3300046538 Bacteria 740
329 Ga0495622_0027492 3300046557 Bacteria 2655
330 Ga0495633_0000081 3300046558 Bacteria 125903
331 Ga0495668_0000003 3300046616 Bacteria 695023
332 Ga0495668_0267647 3300046616 Bacteria 936
333 Ga0495611_0155468 3300046648 Bacteria 1068
334 Ga0495625_0000003 3300046660 Bacteria 686847
335 Ga0495625_0000308 3300046660 Bacteria 74661
336 Ga0495625_0000846 3300046660 Bacteria 41815
337 Ga0495625_0007119 3300046660 Bacteria 9827
338 Ga0495625_0052665 3300046660 Bacteria 2913
339 Ga0495625_0095093 3300046660 Bacteria 2055
340 Ga0495661_0007257 3300046665 Bacteria 7727
341 Ga0495661_0011791 3300046665 Bacteria 5921
342 Ga0495661_0090970 3300046665 Bacteria 1736
343 Ga0495661_0134149 3300046665 Bacteria 1353
344 Ga0495599_0496517 3300046678 Bacteria 719
345 Ga0495669_0182631 3300046684 Bacteria 1000
346 Ga0495649_0000105 3300046694 Bacteria 74750
347 Ga0495649_0052972 3300046694 Bacteria 2198
348 Ga0495649_0159660 3300046694 Unclassified 1182
349 Ga0495589_0235803 3300046794 Bacteria 857
350 Ga0495683_0063052 3300047323 Bacteria 1832
351 Ga0495683_0182841 3300047323 Bacteria 956
352 Ga0495683_0193913 3300047323 Bacteria 920
353 Ga0495687_000304 3300047443 Bacteria 64746
354 Ga0495687_001036 3300047443 Bacteria 27592
355 Ga0495687_001602 3300047443 Bacteria 20428
356 Ga0495687_003533 3300047443 Bacteria 11252
357 Ga0495687_026477 3300047443 Bacteria 2729
358 Ga0495679_096763 3300047446 Bacteria 823
359 Ga0495686_0000367 3300047472 Bacteria 73112
360 Ga0495686_0003019 3300047472 Bacteria 14949
361 Ga0495686_0043771 3300047472 Bacteria 2837
362 Ga0495686_0234944 3300047472 Bacteria 1036
363 Ga0495686_0498500 3300047472 Bacteria 641
364 Ga0495614_0079342 3300048089 Bacteria 1421
365 Ga0496126_0732500 3300048929 Bacteria 765
366 Ga0495678_014896 3300049459 Bacteria 3601
367 Ga0501034_0372145 3300049571 Bacteria 1355
368 Ga0501037_0130154 3300049573 Bacteria 1805
369 Ga0501047_0058846 3300049581 Bacteria 3712
370 Ga0501044_0122979 3300049823 Bacteria 2594
371 nmdc:mga0k408_15328_c1 3300050493 Bacteria 4237
372 nmdc:mga0k408_175_c1 3300050493 Bacteria 32183
373 nmdc:mga0k408_28311_c1 3300050493 Bacteria 3185
374 nmdc:mga0k408_58301_c2 3300050493 Bacteria 1918
375 Ga0500635_0001938 3300053080 Bacteria 5050
376 Ga0500635_0003111 3300053080 Bacteria 4150
377 Ga0500635_0004872 3300053080 Bacteria 3484
378 Ga0500635_0072720 3300053080 Bacteria 1222
379 Ga0500646_0151007 3300053090 Bacteria 769
380 Ga0500650_0142770 3300053098 Bacteria 1110
381 Ga0500608_000329 3300053122 Bacteria 18275
382 Ga0500608_020757 3300053122 Bacteria 3025
383 Ga0500618_000004 3300053125 Bacteria 293180
384 Ga0500652_027537 3300053131 Bacteria 2199
385 Ga0500564_134933 3300053138 Bacteria 1065
386 Ga0500568_0022342 3300053139 Bacteria 2707
387 Ga0500616_0273092 3300053153 Bacteria 713
388 Ga0500622_0000864 3300053156 Bacteria 25792
389 Ga0500624_000533 3300053157 Bacteria 10784
390 2599478518 2599185184 Bacteria 6430550
391 2599479439 2599185184 Bacteria 6430550
392 2739589445 2739367651 Bacteria 6359826
393 2739590207 2739367651 Bacteria 6359826
394 2842723032 2842722452 Bacteria 6263924
395 2842913988 2842909656 Bacteria 6185908
396 2849283729 2849281842 Bacteria 6065644
397 2852623441 2852623160 Bacteria 4376875
398 2857628151 2857627736 Bacteria 5625397
399 2884937680 2884933994 Bacteria 4535041
400 2919441649 2919437846 Bacteria 6199444
401 2928082255 2928078545 Bacteria 6534839
402 2928149168 2928147474 Bacteria 6512076
403 2928149398 2928147474 Bacteria 6512076
404 2929925310 2929921140 Bacteria 8649150
405 2932084970 2932082852 Bacteria 6563563
406 8003154197 8003151029 Bacteria 8187759
407 Ga0451807_0458474
408 JGI24740J21852_10006519
409 JGI24740J21852_10011146
410 JGI24739J22299_10012706
411 JGI24737J22298_10015167
412 JGI24735J21928_10000003
413 JGI24744J21845_10011597
414 JGI25162J39368_1000022
415 JGI25154J39366_1000041
416 JGI25157J39369_1005103
417 JGI25157J39369_1009319
418 JGI25164J39214_1001399
419 JGI25165J46597_1001179
420 JGI25153J46596_10007527
421 rootH1_10038740
422 rootH1_10043582
423 rootH1_10061015
424 rootH1_10126176
425 rootH1_10193810
426 rootH2_10002077
427 rootH2_10003269
428 rootH2_10004415
429 rootH2_10057092
430 rootH2_10073845
431 rootH2_10096525
432 rootH2_10250623
433 rootL2_10109183
434 rootL2_10310450
435 rootH1_10006785
436 rootH1_10028473
437 rootH1_10083018
438 rootH1_10106222
439 rootH1_10256739
440 rootH1_10295516
441 JGI25160J50197_1023926
442 Ga0065165_1036539
443 Ga0065714_10078008
444 Ga0070658_10000019
445 Ga0070658_10302097
446 Ga0070676_10001139
447 Ga0070683_100082764
448 Ga0070660_100076030
449 Ga0070660_100290070
450 Ga0070660_100812259
451 Ga0070661_100586282
452 Ga0070671_100014867
453 Ga0070673_100010060
454 Ga0070673_100022160
455 Ga0070673_100745816
456 Ga0070659_100000516
457 Ga0070659_100052720
458 Ga0070659_100184461
459 Ga0070662_100000167
460 Ga0068867_100000116
461 Ga0070679_100107671
462 Ga0068853_100029566
463 Ga0068853_100061885
464 Ga0068853_100310347
465 Ga0068853_100317367
466 Ga0068853_100476372
467 Ga0070672_100044786
468 Ga0070665_100000003
469 Ga0070665_100000118
470 Ga0068855_100000519
471 Ga0068855_100004987
472 Ga0068855_100036541
473 Ga0068855_100104634
474 Ga0068855_100147695
475 Ga0068855_100246565
476 Ga0068855_100247567
477 Ga0068855_100433366
478 Ga0068855_100865230
479 Ga0068854_100452075
480 Ga0068856_100286632
481 Ga0068856_100508535
482 Ga0068856_101080656
483 Ga0068852_100022204
484 Ga0068852_100027413
485 Ga0068852_100221709
486 Ga0068866_10158306
487 Ga0068851_10511185
488 Ga0068858_100493617
489 Ga0075366_10000849
490 Ga0075366_10033461
491 Ga0075366_10156095
492 Ga0097621_100000054
493 Ga0097621_100000365
494 Ga0068871_100000145
495 Ga0068871_100000248
496 Ga0068865_100000051
497 Ga0068865_100000211
498 Ga0105240_10002706
499 Ga0105240_10010766
500 Ga0105240_10109758
501 Ga0105240_10155147
502 Ga0105240_10219528
503 Ga0105240_10222857
504 Ga0105240_10249441
505 Ga0105240_10267936
506 Ga0105240_10544904
507 Ga0105240_10652558
508 Ga0105240_10908367
509 Ga0105240_11759600
510 Ga0105245_10182148
511 Ga0105241_10002488
512 Ga0105241_10004950
513 Ga0105241_10018205
514 Ga0105241_10642219
515 Ga0105242_10081974
516 Ga0105237_10001447
517 Ga0105237_10001687
518 Ga0105237_10002107
519 Ga0105237_10002246
520 Ga0105237_10026057
521 Ga0105237_10026966
522 Ga0105237_10255784
523 Ga0105237_10359144
524 Ga0105237_10523327
525 Ga0105237_10726683
526 Ga0105237_10994846
527 Ga0105238_10096637
528 Ga0105238_10183082
529 Ga0105238_11102221
530 Ga0105239_10000002
531 Ga0105239_10000440
532 Ga0105239_10001688
533 Ga0105239_10013721
534 Ga0105239_10067347
535 Ga0105239_10075730
536 Ga0105239_10133585
537 Ga0105239_10655837
538 Ga0105239_10727843
539 Ga0105246_10104735
540 Ga0157373_10000273
541 Ga0157371_10042240
542 Ga0157371_10142645
543 Ga0157370_10223259
544 Ga0157370_10386921
545 Ga0157370_10664814
546 Ga0157369_10003273
547 Ga0157369_10368658
548 Ga0157374_10010923
549 Ga0157374_10014928
550 Ga0157374_10027886
551 Ga0157374_10036041
552 Ga0157374_10078775
553 Ga0157374_10238055
554 Ga0157374_10394370
555 Ga0157374_10939819
556 Ga0157378_10006148
557 Ga0157378_10049108
558 Ga0157378_10088410
559 Ga0157378_10126255
560 Ga0163162_10000012
561 Ga0163162_10000064
562 Ga0163162_10045985
563 Ga0157372_10000021
564 Ga0157372_10000428
565 Ga0157372_10013237
566 Ga0157372_10148143
567 Ga0157372_10221212
568 Ga0157372_11577403
569 Ga0157375_10006705
570 Ga0157375_10132747
571 Ga0157375_11058585
572 Ga0157377_10031946
573 Ga0157377_10604563
574 Ga0157376_10176159
575 Ga0163161_10000046
576 Ga0213872_10218640
577 Ga0224712_10157962
578 Ga0207427_100171
579 Ga0209437_100024
580 Ga0209437_100052
581 Ga0209646_1000122
582 Ga0209026_1000631
583 Ga0209026_1001074
584 Ga0209026_1004283
585 Ga0209129_1008760
586 Ga0209233_1000067
587 Ga0209233_1017605
588 Ga0209758_1008810
589 Ga0207426_1000530
590 Ga0207642_10049288
591 Ga0207647_10001745
592 Ga0207647_10048827
593 Ga0207647_10346872
594 Ga0207645_10000652
595 Ga0207645_10000689
596 Ga0207705_10000069
597 Ga0207705_10000090
598 Ga0207705_10222965
599 Ga0207654_10002503
600 Ga0207695_10005523
601 Ga0207695_10008620
602 Ga0207695_10057959
603 Ga0207695_10070621
604 Ga0207695_10103414
605 Ga0207695_10378568
606 Ga0207695_10426860
607 Ga0207695_10469605
608 Ga0207695_10858774
609 Ga0207671_10000514
610 Ga0207671_10001726
611 Ga0207671_10005896
612 Ga0207671_10015797
613 Ga0207671_10016854
614 Ga0207671_10029911
615 Ga0207671_10030260
616 Ga0207671_10043295
617 Ga0207671_10459431
618 Ga0207671_10572392
619 Ga0207657_10059476
620 Ga0207657_10194181
621 Ga0207649_10768412
622 Ga0207652_10218800
623 Ga0207694_10044494
624 Ga0207694_10313937
625 Ga0207687_10957381
626 Ga0207644_10000740
627 Ga0207644_10084522
628 Ga0207690_10000858
629 Ga0207690_10135939
630 Ga0207706_10000257
631 Ga0207686_10085649
632 Ga0207669_10788387
633 Ga0207704_10000046
634 Ga0207704_10000124
635 Ga0207691_10125730
636 Ga0207661_10059886
637 Ga0207667_10000037
638 Ga0207667_10009468
639 Ga0207667_10013674
640 Ga0207667_10029747
641 Ga0207667_10037208
642 Ga0207667_10063923
643 Ga0207667_10105967
644 Ga0207667_10216246
645 Ga0207667_10336000
646 Ga0207667_11478407
647 Ga0207651_10013857
648 Ga0207651_10669449
649 Ga0207640_11125079
650 Ga0207677_10093089
651 Ga0207703_10417559
652 Ga0207639_10007160
653 Ga0207639_10014135
654 Ga0207639_10040324
655 Ga0207639_10360390
656 Ga0207639_11029301
657 Ga0207639_11299376
658 Ga0207639_12098895
659 Ga0207702_10001627
660 Ga0207702_10052628
661 Ga0207702_10501487
662 Ga0207648_10000257
663 Ga0207683_11028565
664 Ga0207698_10016186
665 Ga0207698_10094490
666 Ga0207698_10377284
667 Ga0268266_10000078
668 Ga0268266_10000121
669 Ga0307517_10002529
670 Ga0307515_10000778
671 Ga0307515_10003029
672 Ga0265327_10228315
673 Ga0265327_10265282
674 Ga0307516_10323489
675 Ga0307416_100000001
676 Ga0307507_10002030
677 Ga0307510_10001211
678 Ga0307510_10006887
679 Ga0395899_0000001
680 Ga0395899_0000534
681 Ga0395899_0008563
682 Ga0395899_0030071
683 Ga0395899_0080360
684 Ga0395900_0001900
685 Ga0395900_0010207
686 Ga0395900_0012659
687 Ga0395898_0034902
688 Ga0395898_0085793
689 Ga0395898_0113865
690 Ga0395905_0000347
691 Ga0395905_0000807
692 Ga0395905_0001935
693 Ga0395901_0004286
694 Ga0395901_0012756
695 Ga0395901_0014688
696 Ga0436361_0527238
697 Ga0451794_03868
698 Ga0451791_0631650
699 Ga0451807_1440092
700 Ga0451845_0976831
701 Ga0439448_0009718
702 Ga0439448_0040466
703 Ga0466966_0005500
704 Ga0466966_0050448
705 Ga0466959_0082070
706 Ga0495592_0175107
707 Ga0495638_0144358
708 Ga0495638_0194796
709 Ga0495650_0000023
710 Ga0495585_0000801
711 Ga0495585_0001092
712 Ga0495585_0002645
713 Ga0495583_0085099
714 Ga0495606_0000654
715 Ga0495606_0021048
716 Ga0495606_0024461
717 Ga0495606_0140490
718 Ga0495606_0292720
719 Ga0495606_0550798
720 Ga0495610_0002450
721 Ga0495610_0155525
722 Ga0495616_0000975
723 Ga0495616_0005764
724 Ga0495616_0006078
725 Ga0495631_0008419
726 Ga0495631_0015907
727 Ga0495632_0094409
728 Ga0495637_0094597
729 Ga0495644_0006888
730 Ga0495648_0003373
731 Ga0495652_0029328
732 Ga0495587_0315603
733 Ga0495609_0244700
734 Ga0495622_0027492
735 Ga0495633_0000081
736 Ga0495668_0000003
737 Ga0495668_0267647
738 Ga0495611_0155468
739 Ga0495625_0000003
740 Ga0495625_0000308
741 Ga0495625_0000846
742 Ga0495625_0007119
743 Ga0495625_0052665
744 Ga0495625_0095093
745 Ga0495661_0007257
746 Ga0495661_0011791
747 Ga0495661_0090970
748 Ga0495661_0134149
749 Ga0495599_0496517
750 Ga0495669_0182631
751 Ga0495649_0000105
752 Ga0495649_0052972
753 Ga0495649_0159660
754 Ga0495589_0235803
755 Ga0495683_0063052
756 Ga0495683_0182841
757 Ga0495683_0193913
758 Ga0495687_000304
759 Ga0495687_001036
760 Ga0495687_001602
761 Ga0495687_003533
762 Ga0495687_026477
763 Ga0495679_096763
764 Ga0495686_0000367
765 Ga0495686_0003019
766 Ga0495686_0043771
767 Ga0495686_0234944
768 Ga0495686_0498500
769 Ga0495614_0079342
770 Ga0496126_0732500
771 Ga0495678_014896
772 Ga0501034_0372145
773 Ga0501037_0130154
774 Ga0501047_0058846
775 Ga0501044_0122979
776 nmdc:mga0k408_15328_c1
777 nmdc:mga0k408_175_c1
778 nmdc:mga0k408_28311_c1
779 nmdc:mga0k408_58301_c2
780 Ga0500635_0001938
781 Ga0500635_0003111
782 Ga0500635_0004872
783 Ga0500635_0072720
784 Ga0500646_0151007
785 Ga0500650_0142770
786 Ga0500608_000329
787 Ga0500608_020757
788 Ga0500618_000004
789 Ga0500652_027537
790 Ga0500564_134933
791 Ga0500568_0022342
792 Ga0500616_0273092
793 Ga0500622_0000864
794 Ga0500624_000533
795 2599478518
796 2599479439
797 2739589445
798 2739590207
799 2842723032
800 2842913988
801 2849283729
802 2852623441
803 2857628151
804 2884937680
805 2919441649
806 2928082255
807 2928149168
808 2928149398
809 2929925310
810 2932084970
811 8003154197

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01641

SelR

SelR domain

37

156

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cxk-assembly1.cif.gz_A 1.7 a crystal structure of methionine-r-sulfoxide reductase from burkholderia pseudomallei: crystallization in a microfluidic crystal card. 0.9483 38 160
3hch-assembly1.cif.gz_A structure of the c-terminal domain (msrb) of neisseria meningitidis pilb (complex with substrate) 0.947 33 158
7cto-assembly6.cif.gz_F staphylococcus aureus msrb 0.9452 41 158
3hch-assembly2.cif.gz_B structure of the c-terminal domain (msrb) of neisseria meningitidis pilb (complex with substrate) 0.9436 34 158
7cto-assembly1.cif.gz_A staphylococcus aureus msrb 0.9425 41 158
ID Description Score Start End Superfamily
af_I6YA00_1_135_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9358 30 160 2.170.150.20
3cezB00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9349 34 159 2.170.150.20
3e0oC00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9275 35 158 2.170.150.20
af_Q8BU85_97_242_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9272 27 159 2.170.150.20
af_P25566_29_168_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9245 44 159 2.170.150.20
ID Description Score Start End GO Terms
AF-A0A2T4X0N1-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9848 30 158 GO:0008113
GO:0033743
GO:0033744
GO:0036211
AF-A0A497YR04-F1-model_v4 deleted 0.9847 25 160
AF-A0A1G7VLF4-F1-model_v4 peptide-methionine (R)-S-oxide reductase (EC 1.8.4.12) 0.9789 22 160 GO:0005737
GO:0006979
GO:0030091
GO:0033743
AF-A0A350NWS3-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.9779 40 159 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743
AF-A0A7V8E792-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.9762 37 162 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743

Map