F436013
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 405 | 187 | 811 | 163 |
Family's Representative Sequence
| Representative Sequence | 3300041486|Ga0451807_0458474|Ga0451807_0458474_32_508 |
| Length | 158 |
| Sequence | MKRSIIALIAICAVTFLGCENSNGQENAKKLSKPAKEWKKTLSANAYHIMVESGTEPPFQNAYHDNHQKGIYVSAATGEVLFSSEDKFDSGTGWPSFVKPVDPKKIKIVKDYTYGVREEVIEASTGLHLGHVFDDGPANRGGKRYCMNSGALKFIKQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 42 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 66 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 107 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 108 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 109 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 112 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 113 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 114 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 115 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 116 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 117 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 118 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 119 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 120 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 121 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 122 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 123 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 124 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 125 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 157 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 163 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 164 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 165 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 166 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 167 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 168 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 169 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 170 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 171 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 172 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 173 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 174 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 175 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 176 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 177 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 178 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 179 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 180 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 181 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 182 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 183 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 184 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 185 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 186 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 187 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.31 |
| Metatranscriptomes | 0.49 |
| Isolates | 4.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.89 |
| Nodule | 0 |
| Rhizoplane | 1.48 |
| Rhizosphere | 78.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451807_0458474 | 3300041486 | Bacteria | 578 |
| 2 | JGI24740J21852_10006519 | 3300001979 | Bacteria | 4822 |
| 3 | JGI24740J21852_10011146 | 3300001979 | Bacteria | 3432 |
| 4 | JGI24739J22299_10012706 | 3300001989 | Bacteria | 3088 |
| 5 | JGI24737J22298_10015167 | 3300001990 | Unclassified | 2495 |
| 6 | JGI24735J21928_10000003 | 3300002067 | Bacteria | 385983 |
| 7 | JGI24744J21845_10011597 | 3300002077 | Bacteria | 1801 |
| 8 | JGI25162J39368_1000022 | 3300002737 | Bacteria | 239510 |
| 9 | JGI25154J39366_1000041 | 3300002738 | Bacteria | 144221 |
| 10 | JGI25157J39369_1005103 | 3300002741 | Bacteria | 2202 |
| 11 | JGI25157J39369_1009319 | 3300002741 | Bacteria | 1326 |
| 12 | JGI25164J39214_1001399 | 3300002772 | Bacteria | 5723 |
| 13 | JGI25165J46597_1001179 | 3300003214 | Bacteria | 16018 |
| 14 | JGI25153J46596_10007527 | 3300003215 | Bacteria | 5336 |
| 15 | rootH1_10038740 | 3300003316 | Bacteria | 12495 |
| 16 | rootH1_10038740 | 3300003323 | Bacteria | 4304 |
| 17 | rootH1_10043582 | 3300003316 | Bacteria | 19382 |
| 18 | rootH1_10061015 | 3300003316 | Bacteria | 2913 |
| 19 | rootH1_10126176 | 3300003316 | Bacteria | 4481 |
| 20 | rootH1_10193810 | 3300003316 | Bacteria | 1860 |
| 21 | rootH2_10002077 | 3300003320 | Bacteria | 2407 |
| 22 | rootH2_10003269 | 3300003320 | Bacteria | 51191 |
| 23 | rootH2_10004415 | 3300003320 | Bacteria | 27098 |
| 24 | rootH2_10057092 | 3300003320 | Bacteria | 3648 |
| 25 | rootH2_10073845 | 3300003320 | Bacteria | 5806 |
| 26 | rootH2_10096525 | 3300003320 | Bacteria | 5981 |
| 27 | rootH2_10250623 | 3300003320 | Bacteria | 1595 |
| 28 | rootL2_10109183 | 3300003322 | Bacteria | 3216 |
| 29 | rootL2_10310450 | 3300003322 | Bacteria | 1366 |
| 30 | rootH1_10006785 | 3300003323 | Bacteria | 51850 |
| 31 | rootH1_10028473 | 3300003323 | Bacteria | 8789 |
| 32 | rootH1_10083018 | 3300003323 | Bacteria | 5372 |
| 33 | rootH1_10106222 | 3300003323 | Bacteria | 4126 |
| 34 | rootH1_10256739 | 3300003323 | Bacteria | 2474 |
| 35 | rootH1_10295516 | 3300003323 | Bacteria | 1684 |
| 36 | JGI25160J50197_1023926 | 3300003354 | Bacteria | 1746 |
| 37 | Ga0065165_1036539 | 3300005262 | Bacteria | 1498 |
| 38 | Ga0065714_10078008 | 3300005288 | Bacteria | 2625 |
| 39 | Ga0070658_10000019 | 3300005327 | Bacteria | 194742 |
| 40 | Ga0070658_10302097 | 3300005327 | Bacteria | 1365 |
| 41 | Ga0070676_10001139 | 3300005328 | Bacteria | 13274 |
| 42 | Ga0070683_100082764 | 3300005329 | Bacteria | 3006 |
| 43 | Ga0070660_100076030 | 3300005339 | Unclassified | 2630 |
| 44 | Ga0070660_100290070 | 3300005339 | Bacteria | 1340 |
| 45 | Ga0070660_100812259 | 3300005339 | Unclassified | 787 |
| 46 | Ga0070661_100586282 | 3300005344 | Bacteria | 900 |
| 47 | Ga0070671_100014867 | 3300005355 | Bacteria | 6289 |
| 48 | Ga0070673_100010060 | 3300005364 | Bacteria | 6385 |
| 49 | Ga0070673_100022160 | 3300005364 | Bacteria | 4619 |
| 50 | Ga0070673_100745816 | 3300005364 | Bacteria | 901 |
| 51 | Ga0070659_100000516 | 3300005366 | Bacteria | 28377 |
| 52 | Ga0070659_100052720 | 3300005366 | Unclassified | 3200 |
| 53 | Ga0070659_100184461 | 3300005366 | Bacteria | 1713 |
| 54 | Ga0070662_100000167 | 3300005457 | Bacteria | 38204 |
| 55 | Ga0068867_100000116 | 3300005459 | Bacteria | 50447 |
| 56 | Ga0070679_100107671 | 3300005530 | Bacteria | 2773 |
| 57 | Ga0068853_100029566 | 3300005539 | Bacteria | 4621 |
| 58 | Ga0068853_100061885 | 3300005539 | Bacteria | 3238 |
| 59 | Ga0068853_100310347 | 3300005539 | Bacteria | 1460 |
| 60 | Ga0068853_100317367 | 3300005539 | Bacteria | 1444 |
| 61 | Ga0068853_100476372 | 3300005539 | Bacteria | 1176 |
| 62 | Ga0070672_100044786 | 3300005543 | Bacteria | 3419 |
| 63 | Ga0070665_100000003 | 3300005548 | Bacteria | 811857 |
| 64 | Ga0070665_100000118 | 3300005548 | Bacteria | 149830 |
| 65 | Ga0068855_100000519 | 3300005563 | Bacteria | 47297 |
| 66 | Ga0068855_100004987 | 3300005563 | Bacteria | 16203 |
| 67 | Ga0068855_100036541 | 3300005563 | Bacteria | 5846 |
| 68 | Ga0068855_100104634 | 3300005563 | Bacteria | 3255 |
| 69 | Ga0068855_100147695 | 3300005563 | Bacteria | 2675 |
| 70 | Ga0068855_100246565 | 3300005563 | Bacteria | 1994 |
| 71 | Ga0068855_100247567 | 3300005563 | Bacteria | 1989 |
| 72 | Ga0068855_100433366 | 3300005563 | Bacteria | 1437 |
| 73 | Ga0068855_100865230 | 3300005563 | Bacteria | 957 |
| 74 | Ga0068854_100452075 | 3300005578 | Bacteria | 1073 |
| 75 | Ga0068856_100286632 | 3300005614 | Bacteria | 1664 |
| 76 | Ga0068856_100508535 | 3300005614 | Bacteria | 1226 |
| 77 | Ga0068856_101080656 | 3300005614 | Bacteria | 820 |
| 78 | Ga0068852_100022204 | 3300005616 | Bacteria | 5085 |
| 79 | Ga0068852_100027413 | 3300005616 | Bacteria | 4643 |
| 80 | Ga0068852_100221709 | 3300005616 | Bacteria | 1799 |
| 81 | Ga0068866_10158306 | 3300005718 | Bacteria | 1318 |
| 82 | Ga0068851_10511185 | 3300005834 | Bacteria | 721 |
| 83 | Ga0068858_100493617 | 3300005842 | Bacteria | 1182 |
| 84 | Ga0075366_10000849 | 3300006195 | Bacteria | 14722 |
| 85 | Ga0075366_10033461 | 3300006195 | Bacteria | 3028 |
| 86 | Ga0075366_10156095 | 3300006195 | Bacteria | 1382 |
| 87 | Ga0097621_100000054 | 3300006237 | Bacteria | 59756 |
| 88 | Ga0097621_100000365 | 3300006237 | Bacteria | 31399 |
| 89 | Ga0068871_100000145 | 3300006358 | Bacteria | 46320 |
| 90 | Ga0068871_100000248 | 3300006358 | Bacteria | 37581 |
| 91 | Ga0068865_100000051 | 3300006881 | Bacteria | 65346 |
| 92 | Ga0068865_100000211 | 3300006881 | Bacteria | 32506 |
| 93 | Ga0105240_10002706 | 3300009093 | Bacteria | 28164 |
| 94 | Ga0105240_10010766 | 3300009093 | Bacteria | 12824 |
| 95 | Ga0105240_10109758 | 3300009093 | Bacteria | 3340 |
| 96 | Ga0105240_10155147 | 3300009093 | Bacteria | 2724 |
| 97 | Ga0105240_10219528 | 3300009093 | Bacteria | 2216 |
| 98 | Ga0105240_10222857 | 3300009093 | Bacteria | 2196 |
| 99 | Ga0105240_10249441 | 3300009093 | Bacteria | 2054 |
| 100 | Ga0105240_10267936 | 3300009093 | Bacteria | 1968 |
| 101 | Ga0105240_10544904 | 3300009093 | Bacteria | 1284 |
| 102 | Ga0105240_10652558 | 3300009093 | Bacteria | 1153 |
| 103 | Ga0105240_10908367 | 3300009093 | Bacteria | 947 |
| 104 | Ga0105240_11759600 | 3300009093 | Bacteria | 646 |
| 105 | Ga0105245_10182148 | 3300009098 | Bacteria | 2008 |
| 106 | Ga0105241_10002488 | 3300009174 | Bacteria | 13845 |
| 107 | Ga0105241_10004950 | 3300009174 | Bacteria | 9827 |
| 108 | Ga0105241_10018205 | 3300009174 | Bacteria | 5164 |
| 109 | Ga0105241_10642219 | 3300009174 | Bacteria | 963 |
| 110 | Ga0105242_10081974 | 3300009176 | Unclassified | 2699 |
| 111 | Ga0105237_10001447 | 3300009545 | Bacteria | 31365 |
| 112 | Ga0105237_10001687 | 3300009545 | Bacteria | 28587 |
| 113 | Ga0105237_10002107 | 3300009545 | Bacteria | 25126 |
| 114 | Ga0105237_10002246 | 3300009545 | Bacteria | 24061 |
| 115 | Ga0105237_10026057 | 3300009545 | Bacteria | 5976 |
| 116 | Ga0105237_10026966 | 3300009545 | Bacteria | 5869 |
| 117 | Ga0105237_10255784 | 3300009545 | Bacteria | 1753 |
| 118 | Ga0105237_10359144 | 3300009545 | Bacteria | 1461 |
| 119 | Ga0105237_10523327 | 3300009545 | Bacteria | 1193 |
| 120 | Ga0105237_10726683 | 3300009545 | Bacteria | 999 |
| 121 | Ga0105237_10994846 | 3300009545 | Bacteria | 845 |
| 122 | Ga0105238_10096637 | 3300009551 | Bacteria | 2940 |
| 123 | Ga0105238_10183082 | 3300009551 | Bacteria | 2071 |
| 124 | Ga0105238_11102221 | 3300009551 | Bacteria | 817 |
| 125 | Ga0105239_10000002 | 3300010375 | Bacteria | 610298 |
| 126 | Ga0105239_10000440 | 3300010375 | Bacteria | 60691 |
| 127 | Ga0105239_10001688 | 3300010375 | Bacteria | 29112 |
| 128 | Ga0105239_10013721 | 3300010375 | Bacteria | 8996 |
| 129 | Ga0105239_10067347 | 3300010375 | Bacteria | 3934 |
| 130 | Ga0105239_10075730 | 3300010375 | Bacteria | 3701 |
| 131 | Ga0105239_10133585 | 3300010375 | Bacteria | 2762 |
| 132 | Ga0105239_10655837 | 3300010375 | Bacteria | 1199 |
| 133 | Ga0105239_10727843 | 3300010375 | Bacteria | 1135 |
| 134 | Ga0105246_10104735 | 3300011119 | Bacteria | 2066 |
| 135 | Ga0157373_10000273 | 3300013100 | Bacteria | 41492 |
| 136 | Ga0157371_10042240 | 3300013102 | Bacteria | 3250 |
| 137 | Ga0157371_10142645 | 3300013102 | Bacteria | 1706 |
| 138 | Ga0157370_10223259 | 3300013104 | Bacteria | 1745 |
| 139 | Ga0157370_10386921 | 3300013104 | Bacteria | 1288 |
| 140 | Ga0157370_10664814 | 3300013104 | Unclassified | 952 |
| 141 | Ga0157369_10003273 | 3300013105 | Bacteria | 19291 |
| 142 | Ga0157369_10368658 | 3300013105 | Bacteria | 1491 |
| 143 | Ga0157374_10010923 | 3300013296 | Bacteria | 7840 |
| 144 | Ga0157374_10014928 | 3300013296 | Bacteria | 6807 |
| 145 | Ga0157374_10027886 | 3300013296 | Bacteria | 5098 |
| 146 | Ga0157374_10036041 | 3300013296 | Bacteria | 4530 |
| 147 | Ga0157374_10078775 | 3300013296 | Bacteria | 3121 |
| 148 | Ga0157374_10238055 | 3300013296 | Unclassified | 1789 |
| 149 | Ga0157374_10394370 | 3300013296 | Bacteria | 1380 |
| 150 | Ga0157374_10939819 | 3300013296 | Bacteria | 883 |
| 151 | Ga0157378_10006148 | 3300013297 | Bacteria | 10518 |
| 152 | Ga0157378_10049108 | 3300013297 | Bacteria | 3753 |
| 153 | Ga0157378_10088410 | 3300013297 | Bacteria | 2812 |
| 154 | Ga0157378_10126255 | 3300013297 | Bacteria | 2363 |
| 155 | Ga0163162_10000012 | 3300013306 | Bacteria | 292674 |
| 156 | Ga0163162_10000064 | 3300013306 | Bacteria | 103542 |
| 157 | Ga0163162_10045985 | 3300013306 | Bacteria | 4375 |
| 158 | Ga0157372_10000021 | 3300013307 | Bacteria | 207801 |
| 159 | Ga0157372_10000428 | 3300013307 | Bacteria | 46270 |
| 160 | Ga0157372_10013237 | 3300013307 | Bacteria | 8805 |
| 161 | Ga0157372_10148143 | 3300013307 | Bacteria | 2707 |
| 162 | Ga0157372_10221212 | 3300013307 | Bacteria | 2195 |
| 163 | Ga0157372_11577403 | 3300013307 | Bacteria | 756 |
| 164 | Ga0157375_10006705 | 3300013308 | Bacteria | 10031 |
| 165 | Ga0157375_10132747 | 3300013308 | Bacteria | 2611 |
| 166 | Ga0157375_11058585 | 3300013308 | Bacteria | 948 |
| 167 | Ga0157377_10031946 | 3300014745 | Bacteria | 2864 |
| 168 | Ga0157377_10604563 | 3300014745 | Bacteria | 783 |
| 169 | Ga0157376_10176159 | 3300014969 | Bacteria | 1951 |
| 170 | Ga0163161_10000046 | 3300017792 | Bacteria | 127211 |
| 171 | Ga0213872_10218640 | 3300021361 | Bacteria | 811 |
| 172 | Ga0224712_10157962 | 3300022467 | Bacteria | 1009 |
| 173 | Ga0207427_100171 | 3300025231 | Bacteria | 71988 |
| 174 | Ga0209437_100024 | 3300025233 | Bacteria | 592878 |
| 175 | Ga0209437_100052 | 3300025233 | Bacteria | 380548 |
| 176 | Ga0209646_1000122 | 3300025246 | Bacteria | 144486 |
| 177 | Ga0209026_1000631 | 3300025250 | Bacteria | 22097 |
| 178 | Ga0209026_1001074 | 3300025250 | Bacteria | 13206 |
| 179 | Ga0209026_1004283 | 3300025250 | Bacteria | 4308 |
| 180 | Ga0209129_1008760 | 3300025258 | Bacteria | 2765 |
| 181 | Ga0209233_1000067 | 3300025261 | Bacteria | 380554 |
| 182 | Ga0209233_1017605 | 3300025261 | Bacteria | 1943 |
| 183 | Ga0209758_1008810 | 3300025297 | Bacteria | 6426 |
| 184 | Ga0207426_1000530 | 3300025302 | Bacteria | 55033 |
| 185 | Ga0207642_10049288 | 3300025899 | Bacteria | 1893 |
| 186 | Ga0207647_10001745 | 3300025904 | Bacteria | 16667 |
| 187 | Ga0207647_10048827 | 3300025904 | Bacteria | 2627 |
| 188 | Ga0207647_10346872 | 3300025904 | Bacteria | 841 |
| 189 | Ga0207645_10000652 | 3300025907 | Bacteria | 28838 |
| 190 | Ga0207645_10000689 | 3300025907 | Bacteria | 28055 |
| 191 | Ga0207705_10000069 | 3300025909 | Bacteria | 133094 |
| 192 | Ga0207705_10000090 | 3300025909 | Bacteria | 113233 |
| 193 | Ga0207705_10222965 | 3300025909 | Bacteria | 1432 |
| 194 | Ga0207654_10002503 | 3300025911 | Bacteria | 9337 |
| 195 | Ga0207695_10005523 | 3300025913 | Bacteria | 16736 |
| 196 | Ga0207695_10008620 | 3300025913 | Bacteria | 12740 |
| 197 | Ga0207695_10057959 | 3300025913 | Bacteria | 4022 |
| 198 | Ga0207695_10070621 | 3300025913 | Bacteria | 3569 |
| 199 | Ga0207695_10103414 | 3300025913 | Bacteria | 2840 |
| 200 | Ga0207695_10378568 | 3300025913 | Bacteria | 1301 |
| 201 | Ga0207695_10426860 | 3300025913 | Unclassified | 1209 |
| 202 | Ga0207695_10469605 | 3300025913 | Bacteria | 1141 |
| 203 | Ga0207695_10858774 | 3300025913 | Bacteria | 787 |
| 204 | Ga0207671_10000514 | 3300025914 | Bacteria | 52449 |
| 205 | Ga0207671_10001726 | 3300025914 | Bacteria | 24605 |
| 206 | Ga0207671_10005896 | 3300025914 | Bacteria | 11115 |
| 207 | Ga0207671_10015797 | 3300025914 | Bacteria | 5892 |
| 208 | Ga0207671_10016854 | 3300025914 | Bacteria | 5659 |
| 209 | Ga0207671_10029911 | 3300025914 | Bacteria | 4064 |
| 210 | Ga0207671_10030260 | 3300025914 | Bacteria | 4039 |
| 211 | Ga0207671_10043295 | 3300025914 | Bacteria | 3329 |
| 212 | Ga0207671_10459431 | 3300025914 | Bacteria | 1014 |
| 213 | Ga0207671_10572392 | 3300025914 | Bacteria | 900 |
| 214 | Ga0207657_10059476 | 3300025919 | Bacteria | 3283 |
| 215 | Ga0207657_10194181 | 3300025919 | Bacteria | 1636 |
| 216 | Ga0207649_10768412 | 3300025920 | Bacteria | 751 |
| 217 | Ga0207652_10218800 | 3300025921 | Bacteria | 1716 |
| 218 | Ga0207694_10044494 | 3300025924 | Bacteria | 3428 |
| 219 | Ga0207694_10313937 | 3300025924 | Bacteria | 1293 |
| 220 | Ga0207687_10957381 | 3300025927 | Bacteria | 733 |
| 221 | Ga0207644_10000740 | 3300025931 | Bacteria | 20704 |
| 222 | Ga0207644_10084522 | 3300025931 | Bacteria | 2352 |
| 223 | Ga0207690_10000858 | 3300025932 | Bacteria | 19501 |
| 224 | Ga0207690_10135939 | 3300025932 | Bacteria | 1805 |
| 225 | Ga0207706_10000257 | 3300025933 | Bacteria | 57965 |
| 226 | Ga0207686_10085649 | 3300025934 | Unclassified | 2068 |
| 227 | Ga0207669_10788387 | 3300025937 | Bacteria | 787 |
| 228 | Ga0207704_10000046 | 3300025938 | Bacteria | 86187 |
| 229 | Ga0207704_10000124 | 3300025938 | Bacteria | 41992 |
| 230 | Ga0207691_10125730 | 3300025940 | Bacteria | 2269 |
| 231 | Ga0207661_10059886 | 3300025944 | Bacteria | 3070 |
| 232 | Ga0207667_10000037 | 3300025949 | Bacteria | 297252 |
| 233 | Ga0207667_10009468 | 3300025949 | Bacteria | 11471 |
| 234 | Ga0207667_10013674 | 3300025949 | Bacteria | 9276 |
| 235 | Ga0207667_10029747 | 3300025949 | Bacteria | 5918 |
| 236 | Ga0207667_10037208 | 3300025949 | Bacteria | 5204 |
| 237 | Ga0207667_10063923 | 3300025949 | Bacteria | 3844 |
| 238 | Ga0207667_10105967 | 3300025949 | Bacteria | 2900 |
| 239 | Ga0207667_10216246 | 3300025949 | Bacteria | 1964 |
| 240 | Ga0207667_10336000 | 3300025949 | Bacteria | 1542 |
| 241 | Ga0207667_11478407 | 3300025949 | Bacteria | 651 |
| 242 | Ga0207651_10013857 | 3300025960 | Bacteria | 4632 |
| 243 | Ga0207651_10669449 | 3300025960 | Bacteria | 912 |
| 244 | Ga0207640_11125079 | 3300025981 | Bacteria | 696 |
| 245 | Ga0207677_10093089 | 3300026023 | Bacteria | 2196 |
| 246 | Ga0207703_10417559 | 3300026035 | Bacteria | 1248 |
| 247 | Ga0207639_10007160 | 3300026041 | Bacteria | 7599 |
| 248 | Ga0207639_10014135 | 3300026041 | Bacteria | 5605 |
| 249 | Ga0207639_10040324 | 3300026041 | Bacteria | 3484 |
| 250 | Ga0207639_10360390 | 3300026041 | Bacteria | 1301 |
| 251 | Ga0207639_11029301 | 3300026041 | Bacteria | 771 |
| 252 | Ga0207639_11299376 | 3300026041 | Unclassified | 683 |
| 253 | Ga0207639_12098895 | 3300026041 | Bacteria | 526 |
| 254 | Ga0207702_10001627 | 3300026078 | Bacteria | 22236 |
| 255 | Ga0207702_10052628 | 3300026078 | Unclassified | 3446 |
| 256 | Ga0207702_10501487 | 3300026078 | Bacteria | 1183 |
| 257 | Ga0207648_10000257 | 3300026089 | Bacteria | 57438 |
| 258 | Ga0207683_11028565 | 3300026121 | Bacteria | 765 |
| 259 | Ga0207698_10016186 | 3300026142 | Bacteria | 5019 |
| 260 | Ga0207698_10094490 | 3300026142 | Bacteria | 2458 |
| 261 | Ga0207698_10377284 | 3300026142 | Bacteria | 1348 |
| 262 | Ga0268266_10000078 | 3300028379 | Bacteria | 213632 |
| 263 | Ga0268266_10000121 | 3300028379 | Bacteria | 154995 |
| 264 | Ga0307517_10002529 | 3300028786 | Bacteria | 29143 |
| 265 | Ga0307515_10000778 | 3300028794 | Bacteria | 73451 |
| 266 | Ga0307515_10003029 | 3300028794 | Bacteria | 35637 |
| 267 | Ga0265327_10228315 | 3300031251 | Bacteria | 835 |
| 268 | Ga0265327_10265282 | 3300031251 | Bacteria | 762 |
| 269 | Ga0307516_10323489 | 3300031730 | Bacteria | 1213 |
| 270 | Ga0307416_100000001 | 3300032002 | Bacteria | 515017 |
| 271 | Ga0307507_10002030 | 3300033179 | Bacteria | 43887 |
| 272 | Ga0307510_10001211 | 3300033180 | Bacteria | 27977 |
| 273 | Ga0307510_10006887 | 3300033180 | Bacteria | 13556 |
| 274 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 275 | Ga0395899_0000534 | 3300037312 | Bacteria | 41504 |
| 276 | Ga0395899_0008563 | 3300037312 | Bacteria | 7880 |
| 277 | Ga0395899_0030071 | 3300037312 | Bacteria | 4087 |
| 278 | Ga0395899_0080360 | 3300037312 | Bacteria | 2373 |
| 279 | Ga0395900_0001900 | 3300037418 | Bacteria | 23785 |
| 280 | Ga0395900_0010207 | 3300037418 | Bacteria | 9604 |
| 281 | Ga0395900_0012659 | 3300037418 | Bacteria | 8624 |
| 282 | Ga0395898_0034902 | 3300037466 | Bacteria | 5005 |
| 283 | Ga0395898_0085793 | 3300037466 | Bacteria | 3035 |
| 284 | Ga0395898_0113865 | 3300037466 | Bacteria | 2592 |
| 285 | Ga0395905_0000347 | 3300037471 | Bacteria | 65943 |
| 286 | Ga0395905_0000807 | 3300037471 | Bacteria | 41139 |
| 287 | Ga0395905_0001935 | 3300037471 | Bacteria | 23767 |
| 288 | Ga0395901_0004286 | 3300038443 | Bacteria | 14391 |
| 289 | Ga0395901_0012756 | 3300038443 | Bacteria | 8524 |
| 290 | Ga0395901_0014688 | 3300038443 | Bacteria | 7958 |
| 291 | Ga0436361_0527238 | 3300039447 | Bacteria | 5128 |
| 292 | Ga0451794_03868 | 3300041446 | Bacteria | 506 |
| 293 | Ga0451791_0631650 | 3300041451 | Bacteria | 719 |
| 294 | Ga0451807_1440092 | 3300041486 | Bacteria | 626 |
| 295 | Ga0451845_0976831 | 3300041501 | Bacteria | 675 |
| 296 | Ga0439448_0009718 | 3300042005 | Bacteria | 2840 |
| 297 | Ga0439448_0040466 | 3300042005 | Bacteria | 1506 |
| 298 | Ga0466966_0005500 | 3300044684 | Bacteria | 8322 |
| 299 | Ga0466966_0050448 | 3300044684 | Bacteria | 2647 |
| 300 | Ga0466959_0082070 | 3300045049 | Bacteria | 2323 |
| 301 | Ga0495592_0175107 | 3300046454 | Bacteria | 1466 |
| 302 | Ga0495638_0144358 | 3300046460 | Bacteria | 1386 |
| 303 | Ga0495638_0194796 | 3300046460 | Bacteria | 1148 |
| 304 | Ga0495650_0000023 | 3300046471 | Bacteria | 527763 |
| 305 | Ga0495585_0000801 | 3300046492 | Bacteria | 27427 |
| 306 | Ga0495585_0001092 | 3300046492 | Bacteria | 22350 |
| 307 | Ga0495585_0002645 | 3300046492 | Bacteria | 12593 |
| 308 | Ga0495583_0085099 | 3300046506 | Bacteria | 1369 |
| 309 | Ga0495606_0000654 | 3300046507 | Bacteria | 54570 |
| 310 | Ga0495606_0021048 | 3300046507 | Bacteria | 4786 |
| 311 | Ga0495606_0024461 | 3300046507 | Bacteria | 4351 |
| 312 | Ga0495606_0140490 | 3300046507 | Unclassified | 1427 |
| 313 | Ga0495606_0292720 | 3300046507 | Bacteria | 885 |
| 314 | Ga0495606_0550798 | 3300046507 | Bacteria | 574 |
| 315 | Ga0495610_0002450 | 3300046512 | Bacteria | 15599 |
| 316 | Ga0495610_0155525 | 3300046512 | Bacteria | 971 |
| 317 | Ga0495616_0000975 | 3300046513 | Bacteria | 20508 |
| 318 | Ga0495616_0005764 | 3300046513 | Bacteria | 7575 |
| 319 | Ga0495616_0006078 | 3300046513 | Bacteria | 7357 |
| 320 | Ga0495631_0008419 | 3300046518 | Bacteria | 5199 |
| 321 | Ga0495631_0015907 | 3300046518 | Bacteria | 3595 |
| 322 | Ga0495632_0094409 | 3300046519 | Bacteria | 1415 |
| 323 | Ga0495637_0094597 | 3300046520 | Bacteria | 1174 |
| 324 | Ga0495644_0006888 | 3300046523 | Bacteria | 4401 |
| 325 | Ga0495648_0003373 | 3300046524 | Bacteria | 14063 |
| 326 | Ga0495652_0029328 | 3300046529 | Bacteria | 4835 |
| 327 | Ga0495587_0315603 | 3300046536 | Bacteria | 873 |
| 328 | Ga0495609_0244700 | 3300046538 | Bacteria | 740 |
| 329 | Ga0495622_0027492 | 3300046557 | Bacteria | 2655 |
| 330 | Ga0495633_0000081 | 3300046558 | Bacteria | 125903 |
| 331 | Ga0495668_0000003 | 3300046616 | Bacteria | 695023 |
| 332 | Ga0495668_0267647 | 3300046616 | Bacteria | 936 |
| 333 | Ga0495611_0155468 | 3300046648 | Bacteria | 1068 |
| 334 | Ga0495625_0000003 | 3300046660 | Bacteria | 686847 |
| 335 | Ga0495625_0000308 | 3300046660 | Bacteria | 74661 |
| 336 | Ga0495625_0000846 | 3300046660 | Bacteria | 41815 |
| 337 | Ga0495625_0007119 | 3300046660 | Bacteria | 9827 |
| 338 | Ga0495625_0052665 | 3300046660 | Bacteria | 2913 |
| 339 | Ga0495625_0095093 | 3300046660 | Bacteria | 2055 |
| 340 | Ga0495661_0007257 | 3300046665 | Bacteria | 7727 |
| 341 | Ga0495661_0011791 | 3300046665 | Bacteria | 5921 |
| 342 | Ga0495661_0090970 | 3300046665 | Bacteria | 1736 |
| 343 | Ga0495661_0134149 | 3300046665 | Bacteria | 1353 |
| 344 | Ga0495599_0496517 | 3300046678 | Bacteria | 719 |
| 345 | Ga0495669_0182631 | 3300046684 | Bacteria | 1000 |
| 346 | Ga0495649_0000105 | 3300046694 | Bacteria | 74750 |
| 347 | Ga0495649_0052972 | 3300046694 | Bacteria | 2198 |
| 348 | Ga0495649_0159660 | 3300046694 | Unclassified | 1182 |
| 349 | Ga0495589_0235803 | 3300046794 | Bacteria | 857 |
| 350 | Ga0495683_0063052 | 3300047323 | Bacteria | 1832 |
| 351 | Ga0495683_0182841 | 3300047323 | Bacteria | 956 |
| 352 | Ga0495683_0193913 | 3300047323 | Bacteria | 920 |
| 353 | Ga0495687_000304 | 3300047443 | Bacteria | 64746 |
| 354 | Ga0495687_001036 | 3300047443 | Bacteria | 27592 |
| 355 | Ga0495687_001602 | 3300047443 | Bacteria | 20428 |
| 356 | Ga0495687_003533 | 3300047443 | Bacteria | 11252 |
| 357 | Ga0495687_026477 | 3300047443 | Bacteria | 2729 |
| 358 | Ga0495679_096763 | 3300047446 | Bacteria | 823 |
| 359 | Ga0495686_0000367 | 3300047472 | Bacteria | 73112 |
| 360 | Ga0495686_0003019 | 3300047472 | Bacteria | 14949 |
| 361 | Ga0495686_0043771 | 3300047472 | Bacteria | 2837 |
| 362 | Ga0495686_0234944 | 3300047472 | Bacteria | 1036 |
| 363 | Ga0495686_0498500 | 3300047472 | Bacteria | 641 |
| 364 | Ga0495614_0079342 | 3300048089 | Bacteria | 1421 |
| 365 | Ga0496126_0732500 | 3300048929 | Bacteria | 765 |
| 366 | Ga0495678_014896 | 3300049459 | Bacteria | 3601 |
| 367 | Ga0501034_0372145 | 3300049571 | Bacteria | 1355 |
| 368 | Ga0501037_0130154 | 3300049573 | Bacteria | 1805 |
| 369 | Ga0501047_0058846 | 3300049581 | Bacteria | 3712 |
| 370 | Ga0501044_0122979 | 3300049823 | Bacteria | 2594 |
| 371 | nmdc:mga0k408_15328_c1 | 3300050493 | Bacteria | 4237 |
| 372 | nmdc:mga0k408_175_c1 | 3300050493 | Bacteria | 32183 |
| 373 | nmdc:mga0k408_28311_c1 | 3300050493 | Bacteria | 3185 |
| 374 | nmdc:mga0k408_58301_c2 | 3300050493 | Bacteria | 1918 |
| 375 | Ga0500635_0001938 | 3300053080 | Bacteria | 5050 |
| 376 | Ga0500635_0003111 | 3300053080 | Bacteria | 4150 |
| 377 | Ga0500635_0004872 | 3300053080 | Bacteria | 3484 |
| 378 | Ga0500635_0072720 | 3300053080 | Bacteria | 1222 |
| 379 | Ga0500646_0151007 | 3300053090 | Bacteria | 769 |
| 380 | Ga0500650_0142770 | 3300053098 | Bacteria | 1110 |
| 381 | Ga0500608_000329 | 3300053122 | Bacteria | 18275 |
| 382 | Ga0500608_020757 | 3300053122 | Bacteria | 3025 |
| 383 | Ga0500618_000004 | 3300053125 | Bacteria | 293180 |
| 384 | Ga0500652_027537 | 3300053131 | Bacteria | 2199 |
| 385 | Ga0500564_134933 | 3300053138 | Bacteria | 1065 |
| 386 | Ga0500568_0022342 | 3300053139 | Bacteria | 2707 |
| 387 | Ga0500616_0273092 | 3300053153 | Bacteria | 713 |
| 388 | Ga0500622_0000864 | 3300053156 | Bacteria | 25792 |
| 389 | Ga0500624_000533 | 3300053157 | Bacteria | 10784 |
| 390 | 2599478518 | 2599185184 | Bacteria | 6430550 |
| 391 | 2599479439 | 2599185184 | Bacteria | 6430550 |
| 392 | 2739589445 | 2739367651 | Bacteria | 6359826 |
| 393 | 2739590207 | 2739367651 | Bacteria | 6359826 |
| 394 | 2842723032 | 2842722452 | Bacteria | 6263924 |
| 395 | 2842913988 | 2842909656 | Bacteria | 6185908 |
| 396 | 2849283729 | 2849281842 | Bacteria | 6065644 |
| 397 | 2852623441 | 2852623160 | Bacteria | 4376875 |
| 398 | 2857628151 | 2857627736 | Bacteria | 5625397 |
| 399 | 2884937680 | 2884933994 | Bacteria | 4535041 |
| 400 | 2919441649 | 2919437846 | Bacteria | 6199444 |
| 401 | 2928082255 | 2928078545 | Bacteria | 6534839 |
| 402 | 2928149168 | 2928147474 | Bacteria | 6512076 |
| 403 | 2928149398 | 2928147474 | Bacteria | 6512076 |
| 404 | 2929925310 | 2929921140 | Bacteria | 8649150 |
| 405 | 2932084970 | 2932082852 | Bacteria | 6563563 |
| 406 | 8003154197 | 8003151029 | Bacteria | 8187759 |
| 407 | Ga0451807_0458474 | |||
| 408 | JGI24740J21852_10006519 | |||
| 409 | JGI24740J21852_10011146 | |||
| 410 | JGI24739J22299_10012706 | |||
| 411 | JGI24737J22298_10015167 | |||
| 412 | JGI24735J21928_10000003 | |||
| 413 | JGI24744J21845_10011597 | |||
| 414 | JGI25162J39368_1000022 | |||
| 415 | JGI25154J39366_1000041 | |||
| 416 | JGI25157J39369_1005103 | |||
| 417 | JGI25157J39369_1009319 | |||
| 418 | JGI25164J39214_1001399 | |||
| 419 | JGI25165J46597_1001179 | |||
| 420 | JGI25153J46596_10007527 | |||
| 421 | rootH1_10038740 | |||
| 422 | rootH1_10043582 | |||
| 423 | rootH1_10061015 | |||
| 424 | rootH1_10126176 | |||
| 425 | rootH1_10193810 | |||
| 426 | rootH2_10002077 | |||
| 427 | rootH2_10003269 | |||
| 428 | rootH2_10004415 | |||
| 429 | rootH2_10057092 | |||
| 430 | rootH2_10073845 | |||
| 431 | rootH2_10096525 | |||
| 432 | rootH2_10250623 | |||
| 433 | rootL2_10109183 | |||
| 434 | rootL2_10310450 | |||
| 435 | rootH1_10006785 | |||
| 436 | rootH1_10028473 | |||
| 437 | rootH1_10083018 | |||
| 438 | rootH1_10106222 | |||
| 439 | rootH1_10256739 | |||
| 440 | rootH1_10295516 | |||
| 441 | JGI25160J50197_1023926 | |||
| 442 | Ga0065165_1036539 | |||
| 443 | Ga0065714_10078008 | |||
| 444 | Ga0070658_10000019 | |||
| 445 | Ga0070658_10302097 | |||
| 446 | Ga0070676_10001139 | |||
| 447 | Ga0070683_100082764 | |||
| 448 | Ga0070660_100076030 | |||
| 449 | Ga0070660_100290070 | |||
| 450 | Ga0070660_100812259 | |||
| 451 | Ga0070661_100586282 | |||
| 452 | Ga0070671_100014867 | |||
| 453 | Ga0070673_100010060 | |||
| 454 | Ga0070673_100022160 | |||
| 455 | Ga0070673_100745816 | |||
| 456 | Ga0070659_100000516 | |||
| 457 | Ga0070659_100052720 | |||
| 458 | Ga0070659_100184461 | |||
| 459 | Ga0070662_100000167 | |||
| 460 | Ga0068867_100000116 | |||
| 461 | Ga0070679_100107671 | |||
| 462 | Ga0068853_100029566 | |||
| 463 | Ga0068853_100061885 | |||
| 464 | Ga0068853_100310347 | |||
| 465 | Ga0068853_100317367 | |||
| 466 | Ga0068853_100476372 | |||
| 467 | Ga0070672_100044786 | |||
| 468 | Ga0070665_100000003 | |||
| 469 | Ga0070665_100000118 | |||
| 470 | Ga0068855_100000519 | |||
| 471 | Ga0068855_100004987 | |||
| 472 | Ga0068855_100036541 | |||
| 473 | Ga0068855_100104634 | |||
| 474 | Ga0068855_100147695 | |||
| 475 | Ga0068855_100246565 | |||
| 476 | Ga0068855_100247567 | |||
| 477 | Ga0068855_100433366 | |||
| 478 | Ga0068855_100865230 | |||
| 479 | Ga0068854_100452075 | |||
| 480 | Ga0068856_100286632 | |||
| 481 | Ga0068856_100508535 | |||
| 482 | Ga0068856_101080656 | |||
| 483 | Ga0068852_100022204 | |||
| 484 | Ga0068852_100027413 | |||
| 485 | Ga0068852_100221709 | |||
| 486 | Ga0068866_10158306 | |||
| 487 | Ga0068851_10511185 | |||
| 488 | Ga0068858_100493617 | |||
| 489 | Ga0075366_10000849 | |||
| 490 | Ga0075366_10033461 | |||
| 491 | Ga0075366_10156095 | |||
| 492 | Ga0097621_100000054 | |||
| 493 | Ga0097621_100000365 | |||
| 494 | Ga0068871_100000145 | |||
| 495 | Ga0068871_100000248 | |||
| 496 | Ga0068865_100000051 | |||
| 497 | Ga0068865_100000211 | |||
| 498 | Ga0105240_10002706 | |||
| 499 | Ga0105240_10010766 | |||
| 500 | Ga0105240_10109758 | |||
| 501 | Ga0105240_10155147 | |||
| 502 | Ga0105240_10219528 | |||
| 503 | Ga0105240_10222857 | |||
| 504 | Ga0105240_10249441 | |||
| 505 | Ga0105240_10267936 | |||
| 506 | Ga0105240_10544904 | |||
| 507 | Ga0105240_10652558 | |||
| 508 | Ga0105240_10908367 | |||
| 509 | Ga0105240_11759600 | |||
| 510 | Ga0105245_10182148 | |||
| 511 | Ga0105241_10002488 | |||
| 512 | Ga0105241_10004950 | |||
| 513 | Ga0105241_10018205 | |||
| 514 | Ga0105241_10642219 | |||
| 515 | Ga0105242_10081974 | |||
| 516 | Ga0105237_10001447 | |||
| 517 | Ga0105237_10001687 | |||
| 518 | Ga0105237_10002107 | |||
| 519 | Ga0105237_10002246 | |||
| 520 | Ga0105237_10026057 | |||
| 521 | Ga0105237_10026966 | |||
| 522 | Ga0105237_10255784 | |||
| 523 | Ga0105237_10359144 | |||
| 524 | Ga0105237_10523327 | |||
| 525 | Ga0105237_10726683 | |||
| 526 | Ga0105237_10994846 | |||
| 527 | Ga0105238_10096637 | |||
| 528 | Ga0105238_10183082 | |||
| 529 | Ga0105238_11102221 | |||
| 530 | Ga0105239_10000002 | |||
| 531 | Ga0105239_10000440 | |||
| 532 | Ga0105239_10001688 | |||
| 533 | Ga0105239_10013721 | |||
| 534 | Ga0105239_10067347 | |||
| 535 | Ga0105239_10075730 | |||
| 536 | Ga0105239_10133585 | |||
| 537 | Ga0105239_10655837 | |||
| 538 | Ga0105239_10727843 | |||
| 539 | Ga0105246_10104735 | |||
| 540 | Ga0157373_10000273 | |||
| 541 | Ga0157371_10042240 | |||
| 542 | Ga0157371_10142645 | |||
| 543 | Ga0157370_10223259 | |||
| 544 | Ga0157370_10386921 | |||
| 545 | Ga0157370_10664814 | |||
| 546 | Ga0157369_10003273 | |||
| 547 | Ga0157369_10368658 | |||
| 548 | Ga0157374_10010923 | |||
| 549 | Ga0157374_10014928 | |||
| 550 | Ga0157374_10027886 | |||
| 551 | Ga0157374_10036041 | |||
| 552 | Ga0157374_10078775 | |||
| 553 | Ga0157374_10238055 | |||
| 554 | Ga0157374_10394370 | |||
| 555 | Ga0157374_10939819 | |||
| 556 | Ga0157378_10006148 | |||
| 557 | Ga0157378_10049108 | |||
| 558 | Ga0157378_10088410 | |||
| 559 | Ga0157378_10126255 | |||
| 560 | Ga0163162_10000012 | |||
| 561 | Ga0163162_10000064 | |||
| 562 | Ga0163162_10045985 | |||
| 563 | Ga0157372_10000021 | |||
| 564 | Ga0157372_10000428 | |||
| 565 | Ga0157372_10013237 | |||
| 566 | Ga0157372_10148143 | |||
| 567 | Ga0157372_10221212 | |||
| 568 | Ga0157372_11577403 | |||
| 569 | Ga0157375_10006705 | |||
| 570 | Ga0157375_10132747 | |||
| 571 | Ga0157375_11058585 | |||
| 572 | Ga0157377_10031946 | |||
| 573 | Ga0157377_10604563 | |||
| 574 | Ga0157376_10176159 | |||
| 575 | Ga0163161_10000046 | |||
| 576 | Ga0213872_10218640 | |||
| 577 | Ga0224712_10157962 | |||
| 578 | Ga0207427_100171 | |||
| 579 | Ga0209437_100024 | |||
| 580 | Ga0209437_100052 | |||
| 581 | Ga0209646_1000122 | |||
| 582 | Ga0209026_1000631 | |||
| 583 | Ga0209026_1001074 | |||
| 584 | Ga0209026_1004283 | |||
| 585 | Ga0209129_1008760 | |||
| 586 | Ga0209233_1000067 | |||
| 587 | Ga0209233_1017605 | |||
| 588 | Ga0209758_1008810 | |||
| 589 | Ga0207426_1000530 | |||
| 590 | Ga0207642_10049288 | |||
| 591 | Ga0207647_10001745 | |||
| 592 | Ga0207647_10048827 | |||
| 593 | Ga0207647_10346872 | |||
| 594 | Ga0207645_10000652 | |||
| 595 | Ga0207645_10000689 | |||
| 596 | Ga0207705_10000069 | |||
| 597 | Ga0207705_10000090 | |||
| 598 | Ga0207705_10222965 | |||
| 599 | Ga0207654_10002503 | |||
| 600 | Ga0207695_10005523 | |||
| 601 | Ga0207695_10008620 | |||
| 602 | Ga0207695_10057959 | |||
| 603 | Ga0207695_10070621 | |||
| 604 | Ga0207695_10103414 | |||
| 605 | Ga0207695_10378568 | |||
| 606 | Ga0207695_10426860 | |||
| 607 | Ga0207695_10469605 | |||
| 608 | Ga0207695_10858774 | |||
| 609 | Ga0207671_10000514 | |||
| 610 | Ga0207671_10001726 | |||
| 611 | Ga0207671_10005896 | |||
| 612 | Ga0207671_10015797 | |||
| 613 | Ga0207671_10016854 | |||
| 614 | Ga0207671_10029911 | |||
| 615 | Ga0207671_10030260 | |||
| 616 | Ga0207671_10043295 | |||
| 617 | Ga0207671_10459431 | |||
| 618 | Ga0207671_10572392 | |||
| 619 | Ga0207657_10059476 | |||
| 620 | Ga0207657_10194181 | |||
| 621 | Ga0207649_10768412 | |||
| 622 | Ga0207652_10218800 | |||
| 623 | Ga0207694_10044494 | |||
| 624 | Ga0207694_10313937 | |||
| 625 | Ga0207687_10957381 | |||
| 626 | Ga0207644_10000740 | |||
| 627 | Ga0207644_10084522 | |||
| 628 | Ga0207690_10000858 | |||
| 629 | Ga0207690_10135939 | |||
| 630 | Ga0207706_10000257 | |||
| 631 | Ga0207686_10085649 | |||
| 632 | Ga0207669_10788387 | |||
| 633 | Ga0207704_10000046 | |||
| 634 | Ga0207704_10000124 | |||
| 635 | Ga0207691_10125730 | |||
| 636 | Ga0207661_10059886 | |||
| 637 | Ga0207667_10000037 | |||
| 638 | Ga0207667_10009468 | |||
| 639 | Ga0207667_10013674 | |||
| 640 | Ga0207667_10029747 | |||
| 641 | Ga0207667_10037208 | |||
| 642 | Ga0207667_10063923 | |||
| 643 | Ga0207667_10105967 | |||
| 644 | Ga0207667_10216246 | |||
| 645 | Ga0207667_10336000 | |||
| 646 | Ga0207667_11478407 | |||
| 647 | Ga0207651_10013857 | |||
| 648 | Ga0207651_10669449 | |||
| 649 | Ga0207640_11125079 | |||
| 650 | Ga0207677_10093089 | |||
| 651 | Ga0207703_10417559 | |||
| 652 | Ga0207639_10007160 | |||
| 653 | Ga0207639_10014135 | |||
| 654 | Ga0207639_10040324 | |||
| 655 | Ga0207639_10360390 | |||
| 656 | Ga0207639_11029301 | |||
| 657 | Ga0207639_11299376 | |||
| 658 | Ga0207639_12098895 | |||
| 659 | Ga0207702_10001627 | |||
| 660 | Ga0207702_10052628 | |||
| 661 | Ga0207702_10501487 | |||
| 662 | Ga0207648_10000257 | |||
| 663 | Ga0207683_11028565 | |||
| 664 | Ga0207698_10016186 | |||
| 665 | Ga0207698_10094490 | |||
| 666 | Ga0207698_10377284 | |||
| 667 | Ga0268266_10000078 | |||
| 668 | Ga0268266_10000121 | |||
| 669 | Ga0307517_10002529 | |||
| 670 | Ga0307515_10000778 | |||
| 671 | Ga0307515_10003029 | |||
| 672 | Ga0265327_10228315 | |||
| 673 | Ga0265327_10265282 | |||
| 674 | Ga0307516_10323489 | |||
| 675 | Ga0307416_100000001 | |||
| 676 | Ga0307507_10002030 | |||
| 677 | Ga0307510_10001211 | |||
| 678 | Ga0307510_10006887 | |||
| 679 | Ga0395899_0000001 | |||
| 680 | Ga0395899_0000534 | |||
| 681 | Ga0395899_0008563 | |||
| 682 | Ga0395899_0030071 | |||
| 683 | Ga0395899_0080360 | |||
| 684 | Ga0395900_0001900 | |||
| 685 | Ga0395900_0010207 | |||
| 686 | Ga0395900_0012659 | |||
| 687 | Ga0395898_0034902 | |||
| 688 | Ga0395898_0085793 | |||
| 689 | Ga0395898_0113865 | |||
| 690 | Ga0395905_0000347 | |||
| 691 | Ga0395905_0000807 | |||
| 692 | Ga0395905_0001935 | |||
| 693 | Ga0395901_0004286 | |||
| 694 | Ga0395901_0012756 | |||
| 695 | Ga0395901_0014688 | |||
| 696 | Ga0436361_0527238 | |||
| 697 | Ga0451794_03868 | |||
| 698 | Ga0451791_0631650 | |||
| 699 | Ga0451807_1440092 | |||
| 700 | Ga0451845_0976831 | |||
| 701 | Ga0439448_0009718 | |||
| 702 | Ga0439448_0040466 | |||
| 703 | Ga0466966_0005500 | |||
| 704 | Ga0466966_0050448 | |||
| 705 | Ga0466959_0082070 | |||
| 706 | Ga0495592_0175107 | |||
| 707 | Ga0495638_0144358 | |||
| 708 | Ga0495638_0194796 | |||
| 709 | Ga0495650_0000023 | |||
| 710 | Ga0495585_0000801 | |||
| 711 | Ga0495585_0001092 | |||
| 712 | Ga0495585_0002645 | |||
| 713 | Ga0495583_0085099 | |||
| 714 | Ga0495606_0000654 | |||
| 715 | Ga0495606_0021048 | |||
| 716 | Ga0495606_0024461 | |||
| 717 | Ga0495606_0140490 | |||
| 718 | Ga0495606_0292720 | |||
| 719 | Ga0495606_0550798 | |||
| 720 | Ga0495610_0002450 | |||
| 721 | Ga0495610_0155525 | |||
| 722 | Ga0495616_0000975 | |||
| 723 | Ga0495616_0005764 | |||
| 724 | Ga0495616_0006078 | |||
| 725 | Ga0495631_0008419 | |||
| 726 | Ga0495631_0015907 | |||
| 727 | Ga0495632_0094409 | |||
| 728 | Ga0495637_0094597 | |||
| 729 | Ga0495644_0006888 | |||
| 730 | Ga0495648_0003373 | |||
| 731 | Ga0495652_0029328 | |||
| 732 | Ga0495587_0315603 | |||
| 733 | Ga0495609_0244700 | |||
| 734 | Ga0495622_0027492 | |||
| 735 | Ga0495633_0000081 | |||
| 736 | Ga0495668_0000003 | |||
| 737 | Ga0495668_0267647 | |||
| 738 | Ga0495611_0155468 | |||
| 739 | Ga0495625_0000003 | |||
| 740 | Ga0495625_0000308 | |||
| 741 | Ga0495625_0000846 | |||
| 742 | Ga0495625_0007119 | |||
| 743 | Ga0495625_0052665 | |||
| 744 | Ga0495625_0095093 | |||
| 745 | Ga0495661_0007257 | |||
| 746 | Ga0495661_0011791 | |||
| 747 | Ga0495661_0090970 | |||
| 748 | Ga0495661_0134149 | |||
| 749 | Ga0495599_0496517 | |||
| 750 | Ga0495669_0182631 | |||
| 751 | Ga0495649_0000105 | |||
| 752 | Ga0495649_0052972 | |||
| 753 | Ga0495649_0159660 | |||
| 754 | Ga0495589_0235803 | |||
| 755 | Ga0495683_0063052 | |||
| 756 | Ga0495683_0182841 | |||
| 757 | Ga0495683_0193913 | |||
| 758 | Ga0495687_000304 | |||
| 759 | Ga0495687_001036 | |||
| 760 | Ga0495687_001602 | |||
| 761 | Ga0495687_003533 | |||
| 762 | Ga0495687_026477 | |||
| 763 | Ga0495679_096763 | |||
| 764 | Ga0495686_0000367 | |||
| 765 | Ga0495686_0003019 | |||
| 766 | Ga0495686_0043771 | |||
| 767 | Ga0495686_0234944 | |||
| 768 | Ga0495686_0498500 | |||
| 769 | Ga0495614_0079342 | |||
| 770 | Ga0496126_0732500 | |||
| 771 | Ga0495678_014896 | |||
| 772 | Ga0501034_0372145 | |||
| 773 | Ga0501037_0130154 | |||
| 774 | Ga0501047_0058846 | |||
| 775 | Ga0501044_0122979 | |||
| 776 | nmdc:mga0k408_15328_c1 | |||
| 777 | nmdc:mga0k408_175_c1 | |||
| 778 | nmdc:mga0k408_28311_c1 | |||
| 779 | nmdc:mga0k408_58301_c2 | |||
| 780 | Ga0500635_0001938 | |||
| 781 | Ga0500635_0003111 | |||
| 782 | Ga0500635_0004872 | |||
| 783 | Ga0500635_0072720 | |||
| 784 | Ga0500646_0151007 | |||
| 785 | Ga0500650_0142770 | |||
| 786 | Ga0500608_000329 | |||
| 787 | Ga0500608_020757 | |||
| 788 | Ga0500618_000004 | |||
| 789 | Ga0500652_027537 | |||
| 790 | Ga0500564_134933 | |||
| 791 | Ga0500568_0022342 | |||
| 792 | Ga0500616_0273092 | |||
| 793 | Ga0500622_0000864 | |||
| 794 | Ga0500624_000533 | |||
| 795 | 2599478518 | |||
| 796 | 2599479439 | |||
| 797 | 2739589445 | |||
| 798 | 2739590207 | |||
| 799 | 2842723032 | |||
| 800 | 2842913988 | |||
| 801 | 2849283729 | |||
| 802 | 2852623441 | |||
| 803 | 2857628151 | |||
| 804 | 2884937680 | |||
| 805 | 2919441649 | |||
| 806 | 2928082255 | |||
| 807 | 2928149168 | |||
| 808 | 2928149398 | |||
| 809 | 2929925310 | |||
| 810 | 2932084970 | |||
| 811 | 8003154197 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cxk-assembly1.cif.gz_A | 1.7 a crystal structure of methionine-r-sulfoxide reductase from burkholderia pseudomallei: crystallization in a microfluidic crystal card. | 0.9483 | 38 | 160 |
| 3hch-assembly1.cif.gz_A | structure of the c-terminal domain (msrb) of neisseria meningitidis pilb (complex with substrate) | 0.947 | 33 | 158 |
| 7cto-assembly6.cif.gz_F | staphylococcus aureus msrb | 0.9452 | 41 | 158 |
| 3hch-assembly2.cif.gz_B | structure of the c-terminal domain (msrb) of neisseria meningitidis pilb (complex with substrate) | 0.9436 | 34 | 158 |
| 7cto-assembly1.cif.gz_A | staphylococcus aureus msrb | 0.9425 | 41 | 158 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6YA00_1_135_2.170.150.20 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. | 0.9358 | 30 | 160 | 2.170.150.20 |
| 3cezB00 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. | 0.9349 | 34 | 159 | 2.170.150.20 |
| 3e0oC00 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. | 0.9275 | 35 | 158 | 2.170.150.20 |
| af_Q8BU85_97_242_2.170.150.20 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. | 0.9272 | 27 | 159 | 2.170.150.20 |
| af_P25566_29_168_2.170.150.20 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. | 0.9245 | 44 | 159 | 2.170.150.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T4X0N1-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) | 0.9848 | 30 | 158 |
GO:0008113
GO:0033743 GO:0033744 GO:0036211 |
| AF-A0A497YR04-F1-model_v4 | deleted | 0.9847 | 25 | 160 |
|
| AF-A0A1G7VLF4-F1-model_v4 | peptide-methionine (R)-S-oxide reductase (EC 1.8.4.12) | 0.9789 | 22 | 160 |
GO:0005737
GO:0006979 GO:0030091 GO:0033743 |
| AF-A0A350NWS3-F1-model_v4 | Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) | 0.9779 | 40 | 159 |
GO:0005737
GO:0006979 GO:0008270 GO:0030091 GO:0033743 |
| AF-A0A7V8E792-F1-model_v4 | Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) | 0.9762 | 37 | 162 |
GO:0005737
GO:0006979 GO:0008270 GO:0030091 GO:0033743 |