F436176

General Info

Members Datasets Scaffolds Average Seq Length
406 231 405 352

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100000003|Ga0075428_100000003110
Length 347
Sequence MSAKRHRIAVIPGDGIGQEVIPAALTVLEAVASRSGFAFDLVEFPYGCAYYSKHGRMMAADAFDRLAEFPAIYFGAVGDPSVPDHVAVWELILPLRQRFDQYVNLRPMRLFPGVTSPLANRGPADIDMICVRENSEGEYAGIGGRIHAGTPYEAVEQAGLFTRHGISRIARYAFELASRRPRRELASATKSNALQHSMVLWDTVVDEVRKDYPGVAFKKYHVDALAARMVTHPQTLDVIVASNLFGDILTDLGAAISGSNINPERKYPSMFEPIHGSAPDIKGKGIANPIGAIWAGALMLDHLGEPAAHDAVVAAITKVLSSGNTKTPDMGGKASTKEMAAAIQAAI

Samples

Sample ID Description Type Environment
1 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
138 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
139 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
140 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
141 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
142 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
143 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
144 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
145 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
146 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
165 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.22
Nodule 0
Rhizoplane 2.71
Rhizosphere 94.58
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10009533 3300002459 Bacteria 1997
2 Ga0065712_10070358 3300005290 Bacteria 6083
3 Ga0065712_10070543 3300005290 Bacteria 5919
4 Ga0065712_10079104 3300005290 Bacteria 3259
5 Ga0065715_10001286 3300005293 Bacteria 9820
6 Ga0065715_10177011 3300005293 Bacteria 1504
7 Ga0065707_10000894 3300005295 Bacteria 9824
8 Ga0065707_10139475 3300005295 Bacteria 1792
9 Ga0070670_100084745 3300005331 Bacteria 2723
10 Ga0070670_100088070 3300005331 Bacteria 2669
11 Ga0070670_100144624 3300005331 Bacteria 2057
12 Ga0070680_100024169 3300005336 Bacteria 4850
13 Ga0068868_100010052 3300005338 Bacteria 6837
14 Ga0070668_100172302 3300005347 Bacteria 1763
15 Ga0070669_100018395 3300005353 Bacteria 4995
16 Ga0070669_100102603 3300005353 Bacteria 2160
17 Ga0070669_100113772 3300005353 Bacteria 2056
18 Ga0070675_100200671 3300005354 Bacteria 1731
19 Ga0070675_100261034 3300005354 Bacteria 1518
20 Ga0070674_100007855 3300005356 Bacteria 6310
21 Ga0070674_100312922 3300005356 Bacteria 1256
22 Ga0070673_100035710 3300005364 Bacteria 3771
23 Ga0070673_100041662 3300005364 Bacteria 3535
24 Ga0070673_100072485 3300005364 Bacteria 2770
25 Ga0070688_100012507 3300005365 Bacteria 4757
26 Ga0070688_100151084 3300005365 Bacteria 1587
27 Ga0070659_100067025 3300005366 Bacteria 2846
28 Ga0070667_100197496 3300005367 Bacteria 1784
29 Ga0070703_10011410 3300005406 Bacteria 2509
30 Ga0070713_100003083 3300005436 Bacteria 10955
31 Ga0070711_100043021 3300005439 Bacteria 3057
32 Ga0070711_100060435 3300005439 Bacteria 2634
33 Ga0070700_100005546 3300005441 Bacteria 6688
34 Ga0070694_100042609 3300005444 Bacteria 3033
35 Ga0070694_100157009 3300005444 Bacteria 1666
36 Ga0070708_100100113 3300005445 Bacteria 2652
37 Ga0070681_10009756 3300005458 Bacteria 9448
38 Ga0068867_100017251 3300005459 Bacteria 5128
39 Ga0068867_100075302 3300005459 Bacteria 2532
40 Ga0068867_100100108 3300005459 Bacteria 2212
41 Ga0070706_100262354 3300005467 Bacteria 1612
42 Ga0070707_100012798 3300005468 Bacteria 7832
43 Ga0070698_100038364 3300005471 Bacteria 4936
44 Ga0070698_100041328 3300005471 Bacteria 4733
45 Ga0070699_100002075 3300005518 Bacteria 18133
46 Ga0070699_100010933 3300005518 Bacteria 7851
47 Ga0070679_100031022 3300005530 Bacteria 5281
48 Ga0070679_100041246 3300005530 Bacteria 4594
49 Ga0070697_100010004 3300005536 Bacteria 7401
50 Ga0070697_100039212 3300005536 Bacteria 3829
51 Ga0070697_100338804 3300005536 Bacteria 1297
52 Ga0070672_100034136 3300005543 Bacteria 3859
53 Ga0070686_100091951 3300005544 Bacteria 2031
54 Ga0070695_100019492 3300005545 Bacteria 4131
55 Ga0070695_100065980 3300005545 Bacteria 2358
56 Ga0070695_100092752 3300005545 Bacteria 2019
57 Ga0070696_100031530 3300005546 Bacteria 3633
58 Ga0070665_100008321 3300005548 Bacteria 10492
59 Ga0070665_100068411 3300005548 Bacteria 3561
60 Ga0070665_100240161 3300005548 Bacteria 1812
61 Ga0070665_100254608 3300005548 Bacteria 1756
62 Ga0070665_100391514 3300005548 Bacteria 1397
63 Ga0070704_100016250 3300005549 Bacteria 4699
64 Ga0070704_100051184 3300005549 Bacteria 2907
65 Ga0068855_100030220 3300005563 Bacteria 6480
66 Ga0070664_100199561 3300005564 Bacteria 1785
67 Ga0070664_100210663 3300005564 Bacteria 1737
68 Ga0070702_100012265 3300005615 Bacteria 4289
69 Ga0068859_100005205 3300005617 Bacteria 13216
70 Ga0068859_100195728 3300005617 Bacteria 2106
71 Ga0068859_100350496 3300005617 Bacteria 1571
72 Ga0068864_100190706 3300005618 Bacteria 1879
73 Ga0068866_10142717 3300005718 Bacteria 1377
74 Ga0068861_100001513 3300005719 Bacteria 14718
75 Ga0068861_100170835 3300005719 Bacteria 1802
76 Ga0068863_100079945 3300005841 Bacteria 3097
77 Ga0068863_100163940 3300005841 Bacteria 2131
78 Ga0068858_100014454 3300005842 Bacteria 7438
79 Ga0068858_100030096 3300005842 Bacteria 5042
80 Ga0068858_100183756 3300005842 Bacteria 1975
81 Ga0068860_100183405 3300005843 Bacteria 2023
82 Ga0068862_100031431 3300005844 Bacteria 4482
83 Ga0068862_100040347 3300005844 Bacteria 3968
84 Ga0081455_10001424 3300005937 Bacteria 29569
85 Ga0070717_10009835 3300006028 Bacteria 7202
86 Ga0075364_10008651 3300006051 Bacteria 6087
87 Ga0075362_10000445 3300006177 Bacteria 11997
88 Ga0075367_10032474 3300006178 Bacteria 3004
89 Ga0075366_10023604 3300006195 Bacteria 3584
90 Ga0097621_100003820 3300006237 Bacteria 10439
91 Ga0097621_100029383 3300006237 Bacteria 4341
92 Ga0097621_100043790 3300006237 Bacteria 3609
93 Ga0097621_100079361 3300006237 Bacteria 2728
94 Ga0068871_100000783 3300006358 Bacteria 21404
95 Ga0068871_100002214 3300006358 Bacteria 13207
96 Ga0068871_100041050 3300006358 Bacteria 3708
97 Ga0075428_100000003 3300006844 Bacteria 365483
98 Ga0075428_100001453 3300006844 Bacteria 25347
99 Ga0075428_100042177 3300006844 Bacteria 5018
100 Ga0075430_100004088 3300006846 Bacteria 12313
101 Ga0075431_100000913 3300006847 Bacteria 26025
102 Ga0075431_100125314 3300006847 Bacteria 2651
103 Ga0075431_100431852 3300006847 Bacteria 1315
104 Ga0075434_100076267 3300006871 Bacteria 3347
105 Ga0075429_100154847 3300006880 Bacteria 2007
106 Ga0075429_100281416 3300006880 Bacteria 1457
107 Ga0068865_100013554 3300006881 Bacteria 5156
108 Ga0068865_100025255 3300006881 Bacteria 3906
109 Ga0068865_100273660 3300006881 Bacteria 1342
110 Ga0075436_100003144 3300006914 Bacteria 11321
111 Ga0075436_100019911 3300006914 Bacteria 4602
112 Ga0075436_100105265 3300006914 Bacteria 1967
113 Ga0097620_100005205 3300006931 Bacteria 13216
114 Ga0097620_100195742 3300006931 Bacteria 2106
115 Ga0097620_100350471 3300006931 Bacteria 1571
116 Ga0075435_100003305 3300007076 Bacteria 10935
117 Ga0075435_100004177 3300007076 Bacteria 9907
118 Ga0075435_100026553 3300007076 Bacteria 4520
119 Ga0075435_100097189 3300007076 Bacteria 2437
120 Ga0105240_10038337 3300009093 Bacteria 6147
121 Ga0105240_10152563 3300009093 Bacteria 2750
122 Ga0111539_10000001 3300009094 Bacteria 1035431
123 Ga0111539_10198244 3300009094 Bacteria 2342
124 Ga0111539_10238577 3300009094 Bacteria 2116
125 Ga0105245_10007987 3300009098 Bacteria 9255
126 Ga0105245_10008450 3300009098 Bacteria 8989
127 Ga0114129_10017643 3300009147 Bacteria 10162
128 Ga0114129_10017888 3300009147 Bacteria 10090
129 Ga0114129_10035504 3300009147 Bacteria 7042
130 Ga0114129_10065667 3300009147 Bacteria 5064
131 Ga0114129_10078160 3300009147 Bacteria 4603
132 Ga0114129_10083177 3300009147 Bacteria 4447
133 Ga0114129_10137725 3300009147 Bacteria 3348
134 Ga0114129_10162243 3300009147 Bacteria 3052
135 Ga0114129_10708285 3300009147 Bacteria 1293
136 Ga0105243_10043479 3300009148 Bacteria 3521
137 Ga0105242_10006725 3300009176 Bacteria 8872
138 Ga0105242_10012615 3300009176 Bacteria 6507
139 Ga0105242_10059142 3300009176 Bacteria 3144
140 Ga0105248_10004072 3300009177 Bacteria 16157
141 Ga0105238_10273392 3300009551 Bacteria 1670
142 Ga0105249_10173335 3300009553 Bacteria 2093
143 Ga0105246_10203556 3300011119 Bacteria 1540
144 Ga0105246_10251732 3300011119 Bacteria 1402
145 Ga0157374_10022651 3300013296 Bacteria 5606
146 Ga0157374_10114787 3300013296 Bacteria 2593
147 Ga0163162_10574109 3300013306 Bacteria 1255
148 Ga0157375_10231152 3300013308 Bacteria 2008
149 Ga0163163_10020580 3300014325 Bacteria 6217
150 Ga0163163_10047087 3300014325 Bacteria 4237
151 Ga0163163_10103148 3300014325 Bacteria 2876
152 Ga0157380_10106166 3300014326 Bacteria 2350
153 Ga0157376_10004230 3300014969 Bacteria 9963
154 Ga0157376_10024342 3300014969 Bacteria 4751
155 Ga0157376_10419356 3300014969 Bacteria 1298
156 Ga0157376_10499348 3300014969 Bacteria 1195
157 Ga0207697_10000133 3300025315 Bacteria 35922
158 Ga0207682_10025974 3300025893 Bacteria 2324
159 Ga0207642_10038537 3300025899 Bacteria 2069
160 Ga0207645_10005463 3300025907 Bacteria 9199
161 Ga0207645_10162030 3300025907 Bacteria 1463
162 Ga0207684_10002038 3300025910 Bacteria 20809
163 Ga0207684_10005761 3300025910 Bacteria 11372
164 Ga0207707_10003425 3300025912 Bacteria 14065
165 Ga0207707_10217513 3300025912 Bacteria 1663
166 Ga0207707_10256134 3300025912 Bacteria 1519
167 Ga0207695_10421356 3300025913 Bacteria 1219
168 Ga0207663_10148086 3300025916 Bacteria 1643
169 Ga0207660_10018548 3300025917 Bacteria 4639
170 Ga0207660_10057710 3300025917 Bacteria 2780
171 Ga0207660_10089048 3300025917 Bacteria 2284
172 Ga0207657_10002155 3300025919 Bacteria 21326
173 Ga0207652_10023460 3300025921 Bacteria 5112
174 Ga0207652_10029873 3300025921 Bacteria 4561
175 Ga0207646_10000810 3300025922 Bacteria 40719
176 Ga0207646_10035057 3300025922 Bacteria 4534
177 Ga0207646_10040481 3300025922 Bacteria 4190
178 Ga0207681_10031342 3300025923 Bacteria 3472
179 Ga0207694_10250510 3300025924 Bacteria 1449
180 Ga0207650_10085091 3300025925 Bacteria 2405
181 Ga0207650_10094649 3300025925 Bacteria 2289
182 Ga0207659_10049735 3300025926 Bacteria 2975
183 Ga0207659_10214608 3300025926 Bacteria 1544
184 Ga0207687_10040001 3300025927 Bacteria 3212
185 Ga0207687_10070759 3300025927 Bacteria 2491
186 Ga0207700_10002471 3300025928 Bacteria 10606
187 Ga0207664_10043699 3300025929 Bacteria 3506
188 Ga0207644_10200026 3300025931 Bacteria 1576
189 Ga0207644_10375369 3300025931 Bacteria 1159
190 Ga0207706_10157387 3300025933 Bacteria 1998
191 Ga0207686_10004325 3300025934 Bacteria 7611
192 Ga0207686_10035326 3300025934 Bacteria 2999
193 Ga0207686_10105538 3300025934 Bacteria 1890
194 Ga0207709_10130094 3300025935 Bacteria 1714
195 Ga0207669_10026594 3300025937 Bacteria 3151
196 Ga0207669_10155885 3300025937 Bacteria 1606
197 Ga0207704_10022742 3300025938 Bacteria 3365
198 Ga0207704_10036796 3300025938 Bacteria 2819
199 Ga0207704_10110860 3300025938 Bacteria 1855
200 Ga0207704_10126068 3300025938 Bacteria 1763
201 Ga0207665_10033197 3300025939 Bacteria 3420
202 Ga0207691_10029931 3300025940 Bacteria 5091
203 Ga0207711_10012222 3300025941 Bacteria 7140
204 Ga0207711_10044590 3300025941 Bacteria 3786
205 Ga0207711_10074643 3300025941 Bacteria 2950
206 Ga0207711_10151587 3300025941 Bacteria 2092
207 Ga0207711_10240355 3300025941 Bacteria 1660
208 Ga0207711_10397808 3300025941 Bacteria 1280
209 Ga0207689_10036500 3300025942 Bacteria 4079
210 Ga0207689_10265752 3300025942 Bacteria 1420
211 Ga0207679_10177947 3300025945 Bacteria 1757
212 Ga0207679_10332049 3300025945 Bacteria 1320
213 Ga0207667_10073149 3300025949 Bacteria 3562
214 Ga0207651_10010138 3300025960 Bacteria 5204
215 Ga0207651_10227373 3300025960 Bacteria 1512
216 Ga0207712_10085088 3300025961 Bacteria 2313
217 Ga0207668_10079795 3300025972 Bacteria 2369
218 Ga0207668_10234014 3300025972 Bacteria 1483
219 Ga0207640_10032547 3300025981 Bacteria 3234
220 Ga0207677_10047894 3300026023 Bacteria 2874
221 Ga0207703_10031898 3300026035 Bacteria 4169
222 Ga0207703_10036547 3300026035 Bacteria 3911
223 Ga0207708_10011490 3300026075 Bacteria 6597
224 Ga0207708_10025351 3300026075 Bacteria 4485
225 Ga0207708_10340193 3300026075 Bacteria 1229
226 Ga0207641_10138977 3300026088 Bacteria 2189
227 Ga0207648_10004435 3300026089 Bacteria 14401
228 Ga0207648_10013380 3300026089 Bacteria 7635
229 Ga0207648_10060287 3300026089 Bacteria 3309
230 Ga0207676_10031967 3300026095 Bacteria 3961
231 Ga0207675_100002149 3300026118 Bacteria 19583
232 Ga0207675_100032309 3300026118 Bacteria 4875
233 Ga0207675_100156851 3300026118 Bacteria 2169
234 Ga0207683_10005688 3300026121 Bacteria 10693
235 Ga0207683_10257826 3300026121 Bacteria 1592
236 Ga0207683_10332410 3300026121 Bacteria 1393
237 Ga0207428_10000002 3300027907 Bacteria 854851
238 Ga0268266_10016404 3300028379 Bacteria 6332
239 Ga0268265_10028654 3300028380 Bacteria 3990
240 Ga0268265_10200341 3300028380 Bacteria 1731
241 Ga0268264_10167829 3300028381 Bacteria 1983
242 Ga0268264_10253169 3300028381 Bacteria 1637
243 Ga0268264_10291863 3300028381 Bacteria 1532
244 Ga0307408_100025461 3300031548 Bacteria 4054
245 Ga0307408_100235284 3300031548 Bacteria 1502
246 Ga0307413_10017060 3300031824 Bacteria 3773
247 Ga0307413_10057271 3300031824 Bacteria 2382
248 Ga0307410_10054059 3300031852 Bacteria 2720
249 Ga0307410_10056305 3300031852 Bacteria 2673
250 Ga0307410_10092760 3300031852 Bacteria 2147
251 Ga0307406_10132633 3300031901 Bacteria 1751
252 Ga0307406_10220503 3300031901 Bacteria 1409
253 Ga0307407_10028265 3300031903 Bacteria 2996
254 Ga0307407_10081850 3300031903 Bacteria 1955
255 Ga0307407_10100044 3300031903 Bacteria 1797
256 Ga0307409_100029557 3300031995 Bacteria 3923
257 Ga0307409_100039038 3300031995 Bacteria 3519
258 Ga0307409_100117280 3300031995 Bacteria 2246
259 Ga0307416_100219413 3300032002 Bacteria 1822
260 Ga0307416_100299036 3300032002 Bacteria 1598
261 Ga0307416_100650339 3300032002 Bacteria 1139
262 Ga0307411_10006596 3300032005 Bacteria 5824
263 Ga0307411_10093514 3300032005 Bacteria 2105
264 Ga0307411_10093755 3300032005 Bacteria 2103
265 Ga0307415_100131409 3300032126 Bacteria 1896
266 Ga0316585_10022885 3300032137 Bacteria 1924
267 Ga0373930_0000408 3300034816 Bacteria 5699
268 Ga0373959_0001589 3300034820 Bacteria 3613
269 Ga0373938_0003042 3300034957 Bacteria 2722
270 Ga0373928_0001787 3300035084 Bacteria 4181
271 Ga0373929_0000136 3300035085 Bacteria 12486
272 Ga0373940_0036521 3300035088 Bacteria 1334
273 Ga0373949_0000556 3300035090 Bacteria 12277
274 Ga0373951_0000414 3300035091 Bacteria 12575
275 Ga0373952_0000552 3300035092 Bacteria 6597
276 Ga0373923_0007753 3300035111 Bacteria 3792
277 Ga0373932_0001178 3300035112 Bacteria 7476
278 Ga0373939_0001051 3300035114 Bacteria 6801
279 Ga0373941_0000101 3300035115 Bacteria 14297
280 Ga0373960_0000074 3300035121 Bacteria 14453
281 Ga0373943_0006992 3300035170 Bacteria 5063
282 Ga0373946_0015547 3300035171 Bacteria 2888
283 Ga0373946_0022181 3300035171 Bacteria 2469
284 Ga0373955_0012864 3300035172 Bacteria 4034
285 Ga0373955_0207648 3300035172 Bacteria 1167
286 Ga0373942_0001075 3300035207 Bacteria 7330
287 Ga0373962_0000481 3300035242 Bacteria 8833
288 Ga0373931_0005467 3300035691 Bacteria 5881
289 Ga0373931_0160372 3300035691 Bacteria 1318
290 Ga0373937_0004641 3300036401 Bacteria 11666
291 Ga0373937_0096240 3300036401 Bacteria 2746
292 Ga0373937_0291070 3300036401 Bacteria 1543
293 Ga0373937_0541319 3300036401 Bacteria 1106
294 Ga0316584_0003899 3300036712 Bacteria 9795
295 Ga0373925_0001019 3300037068 Bacteria 25348
296 Ga0373925_0015408 3300037068 Bacteria 5527
297 Ga0373925_0152778 3300037068 Bacteria 1814
298 Ga0436364_1192133 3300037853 Bacteria 2975
299 Ga0400483_265560 3300039062 Bacteria 9326
300 Ga0439446_0001704 3300042156 Bacteria 5096
301 Ga0439435_0015513 3300042436 Bacteria 1898
302 Ga0439460_0064620 3300042461 Bacteria 1123
303 Ga0451576_0034359 3300045051 Bacteria 5385
304 Ga0451576_0574793 3300045051 Bacteria 1184
305 Ga0466967_0132299 3300045976 Bacteria 2317
306 Ga0495629_0130665 3300046459 Bacteria 1749
307 Ga0495651_0124970 3300046462 Bacteria 1885
308 Ga0495608_0018934 3300046511 Bacteria 4745
309 Ga0495608_0095035 3300046511 Bacteria 1926
310 Ga0495628_0019609 3300046516 Bacteria 5587
311 Ga0495628_0129182 3300046516 Bacteria 1934
312 Ga0495630_0027255 3300046517 Bacteria 4236
313 Ga0495652_0098550 3300046529 Bacteria 2376
314 Ga0495586_0115844 3300046535 Bacteria 1494
315 Ga0495645_0001183 3300046543 Bacteria 17811
316 Ga0495645_0027038 3300046543 Bacteria 4167
317 Ga0495633_0040626 3300046558 Bacteria 2215
318 Ga0495647_0086139 3300046681 Bacteria 1281
319 Ga0495658_0080451 3300046683 Bacteria 1911
320 Ga0495658_0151810 3300046683 Bacteria 1423
321 Ga0495669_0003123 3300046684 Bacteria 6815
322 Ga0495613_0000819 3300046689 Bacteria 24089
323 Ga0495600_0097837 3300046809 Bacteria 1913
324 Ga0495581_0083253 3300047315 Bacteria 1853
325 Ga0495604_0093513 3300047317 Bacteria 2224
326 Ga0495674_0029578 3300047319 Bacteria 4987
327 Ga0495674_0172425 3300047319 Bacteria 1804
328 Ga0495684_0000235 3300047471 Bacteria 43518
329 Ga0496100_0442520 3300048903 Bacteria 995
330 Ga0496102_0536868 3300048905 Bacteria 1092
331 Ga0496104_0042217 3300048907 Bacteria 4279
332 Ga0496108_0122160 3300048911 Bacteria 2234
333 Ga0496109_0195592 3300048912 Bacteria 1900
334 Ga0496109_0449245 3300048912 Bacteria 1218
335 Ga0496110_0031725 3300048913 Bacteria 4561
336 Ga0496112_0021001 3300048915 Bacteria 6201
337 Ga0496112_0327583 3300048915 Bacteria 1476
338 Ga0496113_0035011 3300048916 Bacteria 3669
339 Ga0496115_0190953 3300048918 Bacteria 1692
340 Ga0501034_0008745 3300049571 Bacteria 10659
341 Ga0501034_0043603 3300049571 Bacteria 4539
342 Ga0501034_0087025 3300049571 Bacteria 3125
343 Ga0501034_0400451 3300049571 Bacteria 1295
344 Ga0501036_0241731 3300049572 Bacteria 1514
345 Ga0501047_0362140 3300049581 Bacteria 1286
346 Ga0501048_0086670 3300049582 Bacteria 2209
347 Ga0501048_0297419 3300049582 Bacteria 1148
348 Ga0501067_0081173 3300049583 Bacteria 1798
349 Ga0501071_0189065 3300049587 Bacteria 1544
350 Ga0501072_0059945 3300049588 Bacteria 3001
351 Ga0501073_0233992 3300049589 Bacteria 1269
352 Ga0501074_0154330 3300049590 Bacteria 1641
353 Ga0501076_0140707 3300049592 Bacteria 1960
354 Ga0501076_0147146 3300049592 Bacteria 1916
355 Ga0501079_0046559 3300049741 Bacteria 3347
356 Ga0501080_0342393 3300049742 Bacteria 1351
357 Ga0501044_0003092 3300049823 Bacteria 18842
358 Ga0501045_0275930 3300049824 Bacteria 1251
359 Ga0501045_0341123 3300049824 Bacteria 1115
360 nmdc:mga00v17_14485_c1 3300050491 Bacteria 4402
361 nmdc:mga0k408_43884_c1 3300050493 Bacteria 2578
362 nmdc:mga05p37_17597_c1 3300050507 Bacteria 8626
363 nmdc:mga05p37_19883_c1 3300050507 Bacteria 8122
364 nmdc:mga05p37_209159_c1 3300050507 Bacteria 2359
365 nmdc:mga05p37_26387_c1 3300050507 Bacteria 7065
366 nmdc:mga05p37_37131_c1 3300050507 Bacteria 5976
367 nmdc:mga05p37_402068_c1 3300050507 Bacteria 1599
368 nmdc:mga09592_251445_c1 3300050508 Bacteria 1532
369 nmdc:mga09592_93072_c1 3300050508 Bacteria 2577
370 nmdc:mga0qj67_351199_c1 3300050509 Bacteria 1192
371 nmdc:mga0qj67_7086_c1 3300050509 Bacteria 8270
372 nmdc:mga06r32_28104_c1 3300050510 Bacteria 5260
373 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
374 nmdc:mga08y16_435304_c1 3300050511 Bacteria 1339
375 nmdc:mga08y16_8464_c1 3300050511 Bacteria 10772
376 nmdc:mga0n895_10_c1 3300050512 Bacteria 115544
377 nmdc:mga0n895_205817_c1 3300050512 Bacteria 1998
378 nmdc:mga0n895_429752_c1 3300050512 Bacteria 1335
379 nmdc:mga0n895_62441_c1 3300050512 Bacteria 3682
380 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
381 nmdc:mga0rr50_3040_c1 3300050513 Bacteria 9597
382 nmdc:mga0rr50_494698_c1 3300050513 Bacteria 1039
383 nmdc:mga08x19_20176_c1 3300050514 Bacteria 4103
384 nmdc:mga08x19_2537_c1 3300050514 Bacteria 11101
385 nmdc:mga08x19_43868_c1 3300050514 Bacteria 2853
386 Ga0495601_0154434 3300053077 Bacteria 1499
387 Ga0495595_0084765 3300053084 Bacteria 1514
388 Ga0495619_0012750 3300053085 Bacteria 5291
389 Ga0495619_0049036 3300053085 Bacteria 2783
390 Ga0495619_0049604 3300053085 Bacteria 2769
391 Ga0500555_000258 3300053103 Bacteria 23303
392 Ga0500616_0001849 3300053153 Bacteria 19174
393 Ga0500645_000060 3300053730 Bacteria 89018
394 Ga0501084_0011682 3300054114 Bacteria 7271
395 Ga0501084_0153141 3300054114 Bacteria 1944
396 Ga0501084_0378643 3300054114 Bacteria 1196
397 Ga0590071_000380 3300059421 Bacteria 13035
398 Ga0590071_000890 3300059421 Bacteria 8300
399 Ga0590074_002618 3300059423 Bacteria 2953
400 Ga0590075_000108 3300059424 Bacteria 21310
401 Ga0590075_001091 3300059424 Bacteria 7004
402 Ga0590075_019483 3300059424 Bacteria 1684
403 Ga0590077_000670 3300059426 Bacteria 9109
404 Ga0501082_0390654 3300060353 Bacteria 1214
405 Ga0530510_0098374 3300061734 Bacteria 2139

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050513 nmdc:mga0rr50_494698_c1 nmdc:mga0rr50_494698_c1_115_1011 291
2 3300025917 Ga0207660_10089048 Ga0207660_100890482 296
3 3300059421 Ga0590071_000380 Ga0590071_000380_3706_4785 314
4 3300048903 Ga0496100_0442520 Ga0496100_0442520_20_973 317
5 3300059424 Ga0590075_000108 Ga0590075_000108_10881_11960 317
6 3300009147 Ga0114129_10162243 Ga0114129_101622433 319
7 3300050507 nmdc:mga05p37_209159_c1 nmdc:mga05p37_209159_c1_426_1523 324
8 3300049588 Ga0501072_0059945 Ga0501072_0059945_38_1030 329
9 3300006914 Ga0075436_100019911 Ga0075436_1000199111 333
10 3300050512 nmdc:mga0n895_205817_c1 nmdc:mga0n895_205817_c1_230_1309 333
11 3300050514 nmdc:mga08x19_20176_c1 nmdc:mga08x19_20176_c1_1370_2449 333
12 3300009147 Ga0114129_10017888 Ga0114129_100178883 334
13 3300050507 nmdc:mga05p37_37131_c1 nmdc:mga05p37_37131_c1_2685_3689 334
14 3300048905 Ga0496102_0536868 Ga0496102_0536868_14_1057 338
15 3300005842 Ga0068858_100183756 Ga0068858_1001837562 343
16 3300005290 Ga0065712_10079104 Ga0065712_100791043 345
17 3300005293 Ga0065715_10001286 Ga0065715_100012864 345
18 3300005406 Ga0070703_10011410 Ga0070703_100114102 345
19 3300005444 Ga0070694_100157009 Ga0070694_1001570092 345
20 3300005545 Ga0070695_100019492 Ga0070695_1000194922 345
21 3300005545 Ga0070695_100092752 Ga0070695_1000927522 345
22 3300005617 Ga0068859_100005205 Ga0068859_10000520512 345
23 3300005844 Ga0068862_100031431 Ga0068862_1000314313 345
24 3300006931 Ga0097620_100005205 Ga0097620_1000052053 345
25 3300014325 Ga0163163_10103148 Ga0163163_101031483 345
26 3300025922 Ga0207646_10040481 Ga0207646_100404813 345
27 3300042461 Ga0439460_0064620 Ga0439460_0064620_13_1059 345
28 3300005295 Ga0065707_10000894 Ga0065707_100008947 346
29 3300005356 Ga0070674_100312922 Ga0070674_1003129221 346
30 3300009553 Ga0105249_10173335 Ga0105249_101733352 346
31 3300025923 Ga0207681_10031342 Ga0207681_100313424 346
32 3300025937 Ga0207669_10026594 Ga0207669_100265943 346
33 3300028380 Ga0268265_10028654 Ga0268265_100286542 346
34 3300042436 Ga0439435_0015513 Ga0439435_0015513_269_1333 346
35 3300049572 Ga0501036_0241731 Ga0501036_0241731_393_1454 346
36 3300049582 Ga0501048_0086670 Ga0501048_0086670_114_1175 346
37 3300049824 Ga0501045_0275930 Ga0501045_0275930_57_1118 346
38 3300005548 Ga0070665_100240161 Ga0070665_1002401612 347
39 3300006844 Ga0075428_100000003 Ga0075428_100000003110 347
40 3300007076 Ga0075435_100097189 Ga0075435_1000971893 347
41 3300009094 Ga0111539_10000001 Ga0111539_10000001369 347
42 3300009147 Ga0114129_10708285 Ga0114129_107082851 347
43 3300011119 Ga0105246_10203556 Ga0105246_102035561 347
44 3300014969 Ga0157376_10419356 Ga0157376_104193561 347
45 3300025315 Ga0207697_10000133 Ga0207697_100001335 347
46 3300027907 Ga0207428_10000002 Ga0207428_10000002380 347
47 3300048912 Ga0496109_0449245 Ga0496109_0449245_53_1096 347
48 3300050511 nmdc:mga08y16_3_c1 nmdc:mga08y16_3_c1_399643_400707 347
49 3300049582 Ga0501048_0297419 Ga0501048_0297419_70_1119 348
50 3300049741 Ga0501079_0046559 Ga0501079_0046559_116_1165 348
51 3300049742 Ga0501080_0342393 Ga0501080_0342393_267_1316 348
52 3300061734 Ga0530510_0098374 Ga0530510_0098374_167_1216 348
53 3300005445 Ga0070708_100100113 Ga0070708_1001001132 349
54 3300005518 Ga0070699_100010933 Ga0070699_1000109335 349
55 3300006914 Ga0075436_100105265 Ga0075436_1001052651 349
56 3300005290 Ga0065712_10070358 Ga0065712_100703583 350
57 3300005536 Ga0070697_100338804 Ga0070697_1003388041 350
58 3300005564 Ga0070664_100210663 Ga0070664_1002106632 350
59 3300005841 Ga0068863_100079945 Ga0068863_1000799452 350
60 3300005842 Ga0068858_100014454 Ga0068858_1000144545 350
61 3300006051 Ga0075364_10008651 Ga0075364_100086512 350
62 3300006177 Ga0075362_10000445 Ga0075362_1000044510 350
63 3300006178 Ga0075367_10032474 Ga0075367_100324742 350
64 3300006195 Ga0075366_10023604 Ga0075366_100236043 350
65 3300009147 Ga0114129_10137725 Ga0114129_101377253 350
66 3300009177 Ga0105248_10004072 Ga0105248_100040729 350
67 3300014325 Ga0163163_10047087 Ga0163163_100470873 350
68 3300025941 Ga0207711_10012222 Ga0207711_100122225 350
69 3300025945 Ga0207679_10177947 Ga0207679_101779472 350
70 3300026035 Ga0207703_10031898 Ga0207703_100318983 350
71 3300026088 Ga0207641_10138977 Ga0207641_101389773 350
72 3300026095 Ga0207676_10031967 Ga0207676_100319671 350
73 3300026121 Ga0207683_10257826 Ga0207683_102578262 350
74 3300035172 Ga0373955_0207648 Ga0373955_0207648_105_1157 350
75 3300037068 Ga0373925_0001019 Ga0373925_0001019_12799_13851 350
76 3300047319 Ga0495674_0172425 Ga0495674_0172425_484_1536 350
77 3300048907 Ga0496104_0042217 Ga0496104_0042217_2071_3123 350
78 3300048911 Ga0496108_0122160 Ga0496108_0122160_618_1670 350
79 3300048915 Ga0496112_0021001 Ga0496112_0021001_1321_2373 350
80 3300048916 Ga0496113_0035011 Ga0496113_0035011_720_1772 350
81 3300049571 Ga0501034_0043603 Ga0501034_0043603_1872_2924 350
82 3300049581 Ga0501047_0362140 Ga0501047_0362140_108_1160 350
83 3300049590 Ga0501074_0154330 Ga0501074_0154330_177_1229 350
84 3300050491 nmdc:mga00v17_14485_c1 nmdc:mga00v17_14485_c1_992_2044 350
85 3300050493 nmdc:mga0k408_43884_c1 nmdc:mga0k408_43884_c1_49_1101 350
86 3300005331 Ga0070670_100088070 Ga0070670_1000880702 351
87 3300005338 Ga0068868_100010052 Ga0068868_1000100525 351
88 3300005354 Ga0070675_100200671 Ga0070675_1002006711 351
89 3300005459 Ga0068867_100017251 Ga0068867_1000172511 351
90 3300005548 Ga0070665_100391514 Ga0070665_1003915142 351
91 3300005549 Ga0070704_100016250 Ga0070704_1000162504 351
92 3300005564 Ga0070664_100199561 Ga0070664_1001995612 351
93 3300005618 Ga0068864_100190706 Ga0068864_1001907061 351
94 3300005841 Ga0068863_100163940 Ga0068863_1001639401 351
95 3300005842 Ga0068858_100030096 Ga0068858_1000300964 351
96 3300005937 Ga0081455_10001424 Ga0081455_1000142424 351
97 3300006237 Ga0097621_100003820 Ga0097621_1000038202 351
98 3300006358 Ga0068871_100002214 Ga0068871_1000022142 351
99 3300006847 Ga0075431_100125314 Ga0075431_1001253141 351
100 3300006847 Ga0075431_100431852 Ga0075431_1004318521 351
101 3300006881 Ga0068865_100013554 Ga0068865_1000135541 351
102 3300006881 Ga0068865_100025255 Ga0068865_1000252552 351
103 3300009098 Ga0105245_10007987 Ga0105245_100079876 351
104 3300009098 Ga0105245_10008450 Ga0105245_100084508 351
105 3300009147 Ga0114129_10083177 Ga0114129_100831772 351
106 3300009176 Ga0105242_10006725 Ga0105242_100067252 351
107 3300009176 Ga0105242_10059142 Ga0105242_100591422 351
108 3300011119 Ga0105246_10251732 Ga0105246_102517322 351
109 3300013296 Ga0157374_10022651 Ga0157374_100226515 351
110 3300014969 Ga0157376_10004230 Ga0157376_100042302 351
111 3300014969 Ga0157376_10024342 Ga0157376_100243422 351
112 3300014969 Ga0157376_10499348 Ga0157376_104993481 351
113 3300025926 Ga0207659_10214608 Ga0207659_102146082 351
114 3300025927 Ga0207687_10040001 Ga0207687_100400012 351
115 3300025927 Ga0207687_10070759 Ga0207687_100707593 351
116 3300025934 Ga0207686_10004325 Ga0207686_100043252 351
117 3300025934 Ga0207686_10035326 Ga0207686_100353262 351
118 3300025938 Ga0207704_10022742 Ga0207704_100227423 351
119 3300025938 Ga0207704_10036796 Ga0207704_100367961 351
120 3300025941 Ga0207711_10397808 Ga0207711_103978081 351
121 3300026023 Ga0207677_10047894 Ga0207677_100478943 351
122 3300026035 Ga0207703_10036547 Ga0207703_100365473 351
123 3300026089 Ga0207648_10060287 Ga0207648_100602871 351
124 3300026121 Ga0207683_10332410 Ga0207683_103324101 351
125 3300028379 Ga0268266_10016404 Ga0268266_100164042 351
126 3300031548 Ga0307408_100025461 Ga0307408_1000254612 351
127 3300031824 Ga0307413_10017060 Ga0307413_100170602 351
128 3300031852 Ga0307410_10056305 Ga0307410_100563052 351
129 3300031901 Ga0307406_10132633 Ga0307406_101326332 351
130 3300031903 Ga0307407_10081850 Ga0307407_100818502 351
131 3300031995 Ga0307409_100039038 Ga0307409_1000390382 351
132 3300031995 Ga0307409_100117280 Ga0307409_1001172802 351
133 3300032002 Ga0307416_100299036 Ga0307416_1002990361 351
134 3300032005 Ga0307411_10006596 Ga0307411_100065963 351
135 3300032126 Ga0307415_100131409 Ga0307415_1001314092 351
136 3300036401 Ga0373937_0004641 Ga0373937_0004641_10412_11467 351
137 3300036401 Ga0373937_0096240 Ga0373937_0096240_1548_2603 351
138 3300045976 Ga0466967_0132299 Ga0466967_0132299_1199_2254 351
139 3300046511 Ga0495608_0095035 Ga0495608_0095035_560_1615 351
140 3300046516 Ga0495628_0129182 Ga0495628_0129182_410_1465 351
141 3300046535 Ga0495586_0115844 Ga0495586_0115844_22_1077 351
142 3300046543 Ga0495645_0001183 Ga0495645_0001183_14003_15058 351
143 3300046809 Ga0495600_0097837 Ga0495600_0097837_74_1129 351
144 3300048918 Ga0496115_0190953 Ga0496115_0190953_522_1577 351
145 3300049592 Ga0501076_0147146 Ga0501076_0147146_674_1735 351
146 3300049824 Ga0501045_0341123 Ga0501045_0341123_19_1080 351
147 3300050507 nmdc:mga05p37_17597_c1 nmdc:mga05p37_17597_c1_2715_3770 351
148 3300053077 Ga0495601_0154434 Ga0495601_0154434_265_1320 351
149 3300053084 Ga0495595_0084765 Ga0495595_0084765_135_1190 351
150 3300053085 Ga0495619_0049036 Ga0495619_0049036_840_1895 351
151 3300053085 Ga0495619_0049604 Ga0495619_0049604_980_2035 351
152 3300054114 Ga0501084_0378643 Ga0501084_0378643_22_1083 351
153 3300059421 Ga0590071_000890 Ga0590071_000890_4538_5605 351
154 3300059423 Ga0590074_002618 Ga0590074_002618_772_1839 351
155 3300059424 Ga0590075_001091 Ga0590075_001091_1216_2283 351
156 3300059426 Ga0590077_000670 Ga0590077_000670_1850_2917 351
157 iso_pu_bacteria 2883354860 2883357695 351
158 3300005353 Ga0070669_100018395 Ga0070669_1000183952 352
159 3300005364 Ga0070673_100041662 Ga0070673_1000416623 352
160 3300005365 Ga0070688_100151084 Ga0070688_1001510842 352
161 3300005367 Ga0070667_100197496 Ga0070667_1001974961 352
162 3300005441 Ga0070700_100005546 Ga0070700_1000055465 352
163 3300005444 Ga0070694_100042609 Ga0070694_1000426092 352
164 3300005459 Ga0068867_100100108 Ga0068867_1001001081 352
165 3300005471 Ga0070698_100038364 Ga0070698_1000383643 352
166 3300005536 Ga0070697_100039212 Ga0070697_1000392122 352
167 3300005544 Ga0070686_100091951 Ga0070686_1000919512 352
168 3300005545 Ga0070695_100065980 Ga0070695_1000659802 352
169 3300005546 Ga0070696_100031530 Ga0070696_1000315301 352
170 3300005548 Ga0070665_100254608 Ga0070665_1002546081 352
171 3300005549 Ga0070704_100051184 Ga0070704_1000511842 352
172 3300005615 Ga0070702_100012265 Ga0070702_1000122654 352
173 3300005719 Ga0068861_100001513 Ga0068861_1000015136 352
174 3300005844 Ga0068862_100040347 Ga0068862_1000403473 352
175 3300006028 Ga0070717_10009835 Ga0070717_100098358 352
176 3300006844 Ga0075428_100001453 Ga0075428_10000145315 352
177 3300006844 Ga0075428_100042177 Ga0075428_1000421774 352
178 3300006847 Ga0075431_100000913 Ga0075431_10000091322 352
179 3300006880 Ga0075429_100154847 Ga0075429_1001548472 352
180 3300006880 Ga0075429_100281416 Ga0075429_1002814161 352
181 3300009094 Ga0111539_10198244 Ga0111539_101982442 352
182 3300009094 Ga0111539_10238577 Ga0111539_102385772 352
183 3300009147 Ga0114129_10035504 Ga0114129_100355049 352
184 3300013306 Ga0163162_10574109 Ga0163162_105741091 352
185 3300025907 Ga0207645_10005463 Ga0207645_100054632 352
186 3300025907 Ga0207645_10162030 Ga0207645_101620301 352
187 3300025910 Ga0207684_10005761 Ga0207684_100057614 352
188 3300025922 Ga0207646_10035057 Ga0207646_100350573 352
189 3300025933 Ga0207706_10157387 Ga0207706_101573872 352
190 3300025935 Ga0207709_10130094 Ga0207709_101300942 352
191 3300025937 Ga0207669_10155885 Ga0207669_101558852 352
192 3300025939 Ga0207665_10033197 Ga0207665_100331974 352
193 3300025940 Ga0207691_10029931 Ga0207691_100299314 352
194 3300025941 Ga0207711_10074643 Ga0207711_100746433 352
195 3300025942 Ga0207689_10265752 Ga0207689_102657522 352
196 3300025960 Ga0207651_10227373 Ga0207651_102273732 352
197 3300025981 Ga0207640_10032547 Ga0207640_100325473 352
198 3300026075 Ga0207708_10011490 Ga0207708_100114905 352
199 3300026075 Ga0207708_10025351 Ga0207708_100253514 352
200 3300026089 Ga0207648_10004435 Ga0207648_100044356 352
201 3300026118 Ga0207675_100002149 Ga0207675_10000214916 352
202 3300026118 Ga0207675_100156851 Ga0207675_1001568512 352
203 3300028381 Ga0268264_10167829 Ga0268264_101678292 352
204 3300031548 Ga0307408_100235284 Ga0307408_1002352841 352
205 3300031824 Ga0307413_10057271 Ga0307413_100572712 352
206 3300031852 Ga0307410_10054059 Ga0307410_100540592 352
207 3300031852 Ga0307410_10092760 Ga0307410_100927602 352
208 3300031901 Ga0307406_10220503 Ga0307406_102205032 352
209 3300031903 Ga0307407_10028265 Ga0307407_100282651 352
210 3300031903 Ga0307407_10100044 Ga0307407_101000441 352
211 3300031995 Ga0307409_100029557 Ga0307409_1000295571 352
212 3300032002 Ga0307416_100219413 Ga0307416_1002194132 352
213 3300032002 Ga0307416_100650339 Ga0307416_1006503391 352
214 3300032005 Ga0307411_10093514 Ga0307411_100935142 352
215 3300032005 Ga0307411_10093755 Ga0307411_100937552 352
216 3300032137 Ga0316585_10022885 Ga0316585_100228851 352
217 3300036712 Ga0316584_0003899 Ga0316584_0003899_7500_8567 352
218 3300037853 Ga0436364_1192133 Ga0436364_1192133_203_1282 352
219 3300045051 Ga0451576_0574793 Ga0451576_0574793_39_1103 352
220 3300046558 Ga0495633_0040626 Ga0495633_0040626_114_1199 352
221 3300049571 Ga0501034_0087025 Ga0501034_0087025_514_1578 352
222 3300049583 Ga0501067_0081173 Ga0501067_0081173_417_1475 352
223 3300050507 nmdc:mga05p37_26387_c1 nmdc:mga05p37_26387_c1_877_1941 352
224 3300050507 nmdc:mga05p37_402068_c1 nmdc:mga05p37_402068_c1_189_1280 352
225 3300050508 nmdc:mga09592_251445_c1 nmdc:mga09592_251445_c1_181_1239 352
226 3300050508 nmdc:mga09592_93072_c1 nmdc:mga09592_93072_c1_881_1945 352
227 3300050509 nmdc:mga0qj67_351199_c1 nmdc:mga0qj67_351199_c1_64_1128 352
228 3300050510 nmdc:mga06r32_28104_c1 nmdc:mga06r32_28104_c1_2149_3213 352
229 3300050511 nmdc:mga08y16_435304_c1 nmdc:mga08y16_435304_c1_158_1222 352
230 3300050511 nmdc:mga08y16_8464_c1 nmdc:mga08y16_8464_c1_9270_10331 352
231 3300050512 nmdc:mga0n895_62441_c1 nmdc:mga0n895_62441_c1_1442_2500 352
232 3300059424 Ga0590075_019483 Ga0590075_019483_220_1299 352
233 3300005336 Ga0070680_100024169 Ga0070680_1000241693 353
234 3300005366 Ga0070659_100067025 Ga0070659_1000670252 353
235 3300005436 Ga0070713_100003083 Ga0070713_1000030836 353
236 3300005439 Ga0070711_100043021 Ga0070711_1000430212 353
237 3300005439 Ga0070711_100060435 Ga0070711_1000604351 353
238 3300005530 Ga0070679_100031022 Ga0070679_1000310223 353
239 3300005530 Ga0070679_100041246 Ga0070679_1000412462 353
240 3300005563 Ga0068855_100030220 Ga0068855_1000302203 353
241 3300006237 Ga0097621_100079361 Ga0097621_1000793612 353
242 3300006358 Ga0068871_100000783 Ga0068871_1000007834 353
243 3300006846 Ga0075430_100004088 Ga0075430_10000408810 353
244 3300006871 Ga0075434_100076267 Ga0075434_1000762673 353
245 3300007076 Ga0075435_100004177 Ga0075435_1000041776 353
246 3300007076 Ga0075435_100026553 Ga0075435_1000265534 353
247 3300009093 Ga0105240_10152563 Ga0105240_101525632 353
248 3300009147 Ga0114129_10017643 Ga0114129_100176439 353
249 3300009147 Ga0114129_10078160 Ga0114129_100781602 353
250 3300013296 Ga0157374_10114787 Ga0157374_101147872 353
251 3300025912 Ga0207707_10003425 Ga0207707_100034252 353
252 3300025912 Ga0207707_10217513 Ga0207707_102175132 353
253 3300025913 Ga0207695_10421356 Ga0207695_104213561 353
254 3300025916 Ga0207663_10148086 Ga0207663_101480861 353
255 3300025917 Ga0207660_10057710 Ga0207660_100577103 353
256 3300025919 Ga0207657_10002155 Ga0207657_100021556 353
257 3300025921 Ga0207652_10023460 Ga0207652_100234603 353
258 3300025921 Ga0207652_10029873 Ga0207652_100298733 353
259 3300025928 Ga0207700_10002471 Ga0207700_100024718 353
260 3300025929 Ga0207664_10043699 Ga0207664_100436992 353
261 3300025941 Ga0207711_10240355 Ga0207711_102403551 353
262 3300025949 Ga0207667_10073149 Ga0207667_100731492 353
263 3300025972 Ga0207668_10079795 Ga0207668_100797952 353
264 3300034816 Ga0373930_0000408 Ga0373930_0000408_1957_3018 353
265 3300034820 Ga0373959_0001589 Ga0373959_0001589_396_1457 353
266 3300034957 Ga0373938_0003042 Ga0373938_0003042_194_1255 353
267 3300035084 Ga0373928_0001787 Ga0373928_0001787_13_1074 353
268 3300035085 Ga0373929_0000136 Ga0373929_0000136_1236_2297 353
269 3300035088 Ga0373940_0036521 Ga0373940_0036521_41_1102 353
270 3300035090 Ga0373949_0000556 Ga0373949_0000556_1015_2076 353
271 3300035091 Ga0373951_0000414 Ga0373951_0000414_5723_6784 353
272 3300035092 Ga0373952_0000552 Ga0373952_0000552_477_1538 353
273 3300035111 Ga0373923_0007753 Ga0373923_0007753_1739_2800 353
274 3300035112 Ga0373932_0001178 Ga0373932_0001178_3405_4466 353
275 3300035114 Ga0373939_0001051 Ga0373939_0001051_3211_4272 353
276 3300035115 Ga0373941_0000101 Ga0373941_0000101_9333_10394 353
277 3300035121 Ga0373960_0000074 Ga0373960_0000074_10037_11098 353
278 3300035171 Ga0373946_0022181 Ga0373946_0022181_75_1136 353
279 3300035207 Ga0373942_0001075 Ga0373942_0001075_3265_4326 353
280 3300035242 Ga0373962_0000481 Ga0373962_0000481_4338_5399 353
281 3300035691 Ga0373931_0005467 Ga0373931_0005467_4793_5854 353
282 3300036401 Ga0373937_0291070 Ga0373937_0291070_225_1286 353
283 3300036401 Ga0373937_0541319 Ga0373937_0541319_15_1076 353
284 3300037068 Ga0373925_0152778 Ga0373925_0152778_718_1779 353
285 3300045051 Ga0451576_0034359 Ga0451576_0034359_752_1813 353
286 3300046462 Ga0495651_0124970 Ga0495651_0124970_214_1275 353
287 3300046511 Ga0495608_0018934 Ga0495608_0018934_1493_2554 353
288 3300046516 Ga0495628_0019609 Ga0495628_0019609_2107_3168 353
289 3300046517 Ga0495630_0027255 Ga0495630_0027255_2948_4009 353
290 3300046529 Ga0495652_0098550 Ga0495652_0098550_992_2053 353
291 3300046543 Ga0495645_0027038 Ga0495645_0027038_1179_2240 353
292 3300046683 Ga0495658_0080451 Ga0495658_0080451_805_1866 353
293 3300046684 Ga0495669_0003123 Ga0495669_0003123_4515_5576 353
294 3300046689 Ga0495613_0000819 Ga0495613_0000819_18465_19526 353
295 3300047315 Ga0495581_0083253 Ga0495581_0083253_20_1081 353
296 3300047317 Ga0495604_0093513 Ga0495604_0093513_168_1229 353
297 3300047319 Ga0495674_0029578 Ga0495674_0029578_2674_3735 353
298 3300047471 Ga0495684_0000235 Ga0495684_0000235_37210_38271 353
299 3300050509 nmdc:mga0qj67_7086_c1 nmdc:mga0qj67_7086_c1_6138_7211 353
300 3300050512 nmdc:mga0n895_429752_c1 nmdc:mga0n895_429752_c1_74_1153 353
301 3300050513 nmdc:mga0rr50_3040_c1 nmdc:mga0rr50_3040_c1_217_1278 353
302 3300053085 Ga0495619_0012750 Ga0495619_0012750_1068_2129 353
303 3300054114 Ga0501084_0153141 Ga0501084_0153141_10_1071 353
304 3300005295 Ga0065707_10139475 Ga0065707_101394752 354
305 3300005331 Ga0070670_100144624 Ga0070670_1001446242 354
306 3300005347 Ga0070668_100172302 Ga0070668_1001723021 354
307 3300005353 Ga0070669_100102603 Ga0070669_1001026032 354
308 3300005353 Ga0070669_100113772 Ga0070669_1001137721 354
309 3300005354 Ga0070675_100261034 Ga0070675_1002610342 354
310 3300005356 Ga0070674_100007855 Ga0070674_1000078556 354
311 3300005364 Ga0070673_100072485 Ga0070673_1000724853 354
312 3300005365 Ga0070688_100012507 Ga0070688_1000125073 354
313 3300005543 Ga0070672_100034136 Ga0070672_1000341363 354
314 3300005548 Ga0070665_100068411 Ga0070665_1000684112 354
315 3300005617 Ga0068859_100195728 Ga0068859_1001957282 354
316 3300005718 Ga0068866_10142717 Ga0068866_101427172 354
317 3300005719 Ga0068861_100170835 Ga0068861_1001708351 354
318 3300006881 Ga0068865_100273660 Ga0068865_1002736601 354
319 3300006931 Ga0097620_100195742 Ga0097620_1001957422 354
320 3300009093 Ga0105240_10038337 Ga0105240_100383371 354
321 3300009147 Ga0114129_10065667 Ga0114129_100656673 354
322 3300009148 Ga0105243_10043479 Ga0105243_100434792 354
323 3300025893 Ga0207682_10025974 Ga0207682_100259742 354
324 3300025924 Ga0207694_10250510 Ga0207694_102505101 354
325 3300025925 Ga0207650_10094649 Ga0207650_100946492 354
326 3300025926 Ga0207659_10049735 Ga0207659_100497351 354
327 3300025931 Ga0207644_10200026 Ga0207644_102000262 354
328 3300025931 Ga0207644_10375369 Ga0207644_103753691 354
329 3300025938 Ga0207704_10126068 Ga0207704_101260682 354
330 3300025941 Ga0207711_10151587 Ga0207711_101515872 354
331 3300025960 Ga0207651_10010138 Ga0207651_100101382 354
332 3300025961 Ga0207712_10085088 Ga0207712_100850882 354
333 3300026075 Ga0207708_10340193 Ga0207708_103401931 354
334 3300026118 Ga0207675_100032309 Ga0207675_1000323093 354
335 3300026121 Ga0207683_10005688 Ga0207683_100056889 354
336 3300028380 Ga0268265_10200341 Ga0268265_102003413 354
337 3300035170 Ga0373943_0006992 Ga0373943_0006992_3642_4706 354
338 3300035172 Ga0373955_0012864 Ga0373955_0012864_2835_3899 354
339 3300035691 Ga0373931_0160372 Ga0373931_0160372_157_1221 354
340 3300037068 Ga0373925_0015408 Ga0373925_0015408_949_2013 354
341 3300046681 Ga0495647_0086139 Ga0495647_0086139_135_1199 354
342 3300049571 Ga0501034_0008745 Ga0501034_0008745_6982_8046 354
343 3300049571 Ga0501034_0400451 Ga0501034_0400451_199_1266 354
344 3300049823 Ga0501044_0003092 Ga0501044_0003092_1130_2194 354
345 3300050507 nmdc:mga05p37_19883_c1 nmdc:mga05p37_19883_c1_486_1553 354
346 3300060353 Ga0501082_0390654 Ga0501082_0390654_80_1147 354
347 3300005331 Ga0070670_100084745 Ga0070670_1000847452 355
348 3300005364 Ga0070673_100035710 Ga0070673_1000357102 355
349 3300005459 Ga0068867_100075302 Ga0068867_1000753023 355
350 3300005467 Ga0070706_100262354 Ga0070706_1002623542 355
351 3300005468 Ga0070707_100012798 Ga0070707_1000127982 355
352 3300005471 Ga0070698_100041328 Ga0070698_1000413282 355
353 3300005518 Ga0070699_100002075 Ga0070699_10000207513 355
354 3300005536 Ga0070697_100010004 Ga0070697_1000100042 355
355 3300005548 Ga0070665_100008321 Ga0070665_1000083218 355
356 3300006237 Ga0097621_100029383 Ga0097621_1000293833 355
357 3300006237 Ga0097621_100043790 Ga0097621_1000437903 355
358 3300006358 Ga0068871_100041050 Ga0068871_1000410502 355
359 3300009176 Ga0105242_10012615 Ga0105242_100126152 355
360 3300009551 Ga0105238_10273392 Ga0105238_102733921 355
361 3300013308 Ga0157375_10231152 Ga0157375_102311522 355
362 3300014325 Ga0163163_10020580 Ga0163163_100205802 355
363 3300025899 Ga0207642_10038537 Ga0207642_100385372 355
364 3300025910 Ga0207684_10002038 Ga0207684_100020387 355
365 3300025912 Ga0207707_10256134 Ga0207707_102561341 355
366 3300025917 Ga0207660_10018548 Ga0207660_100185486 355
367 3300025922 Ga0207646_10000810 Ga0207646_100008106 355
368 3300025925 Ga0207650_10085091 Ga0207650_100850912 355
369 3300025934 Ga0207686_10105538 Ga0207686_101055382 355
370 3300025938 Ga0207704_10110860 Ga0207704_101108602 355
371 3300025941 Ga0207711_10044590 Ga0207711_100445903 355
372 3300025942 Ga0207689_10036500 Ga0207689_100365002 355
373 3300025945 Ga0207679_10332049 Ga0207679_103320492 355
374 3300026089 Ga0207648_10013380 Ga0207648_100133803 355
375 3300028381 Ga0268264_10291863 Ga0268264_102918631 355
376 3300035171 Ga0373946_0015547 Ga0373946_0015547_1534_2601 355
377 3300039062 Ga0400483_265560 Ga0400483_265560_3369_4436 355
378 3300042156 Ga0439446_0001704 Ga0439446_0001704_2794_3873 355
379 3300048915 Ga0496112_0327583 Ga0496112_0327583_241_1308 355
380 3300049587 Ga0501071_0189065 Ga0501071_0189065_39_1112 355
381 3300049589 Ga0501073_0233992 Ga0501073_0233992_36_1103 355
382 3300049592 Ga0501076_0140707 Ga0501076_0140707_175_1248 355
383 3300053103 Ga0500555_000258 Ga0500555_000258_21262_22347 355
384 3300053153 Ga0500616_0001849 Ga0500616_0001849_2891_3976 355
385 3300053730 Ga0500645_000060 Ga0500645_000060_57265_58350 355
386 3300054114 Ga0501084_0011682 Ga0501084_0011682_3079_4152 355
387 3300046459 Ga0495629_0130665 Ga0495629_0130665_363_1478 357
388 3300046683 Ga0495658_0151810 Ga0495658_0151810_154_1269 357
389 3300014326 Ga0157380_10106166 Ga0157380_101061662 358
390 3300005458 Ga0070681_10009756 Ga0070681_100097562 359
391 3300006914 Ga0075436_100003144 Ga0075436_1000031441 359
392 3300007076 Ga0075435_100003305 Ga0075435_1000033051 359
393 3300050512 nmdc:mga0n895_10_c1 nmdc:mga0n895_10_c1_88130_89230 359
394 3300050513 nmdc:mga0rr50_20_c1 nmdc:mga0rr50_20_c1_139561_140661 359
395 3300050514 nmdc:mga08x19_2537_c1 nmdc:mga08x19_2537_c1_139_1239 359
396 3300002459 JGI24751J29686_10009533 JGI24751J29686_100095332 361
397 3300005290 Ga0065712_10070543 Ga0065712_100705435 361
398 3300005293 Ga0065715_10177011 Ga0065715_101770112 361
399 3300005617 Ga0068859_100350496 Ga0068859_1003504962 361
400 3300005843 Ga0068860_100183405 Ga0068860_1001834052 361
401 3300006931 Ga0097620_100350471 Ga0097620_1003504712 361
402 3300025972 Ga0207668_10234014 Ga0207668_102340142 361
403 3300028381 Ga0268264_10253169 Ga0268264_102531692 361
404 3300048912 Ga0496109_0195592 Ga0496109_0195592_569_1654 361
405 3300048913 Ga0496110_0031725 Ga0496110_0031725_1639_2724 361
406 3300050514 nmdc:mga08x19_43868_c1 nmdc:mga08x19_43868_c1_668_1780 361

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00180

Iso_dh

Isocitrate/isopropylmalate dehydrogenase

7

343

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fmx-assembly1.cif.gz_X crystal structure of tartrate dehydrogenase from pseudomonas putida complexed with nadh 0.9533 13 360
2g4o-assembly1.cif.gz_A anomalous substructure of 3-isopropylmalate dehydrogenase 0.9384 13 361
2g4o-assembly1.cif.gz_A anomalous substructure of 3-isopropylmalate dehydrogenase 0.933 13 361
6lky-assembly1.cif.gz_B crystal structure of isocitrate dehydrogenase from methylococcus capsulatus 0.9297 13 360
6xxy-assembly1.cif.gz_B crystal structure of haemophilus influenzae 3-isopropylmalate dehydrogenase in complex with o-isobutenyl oxalylhydroxamate. 0.9245 11 361
ID Description Score Start End Superfamily
af_P76251_1_360_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.964 11 360 3.40.718.10
1w0dB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9425 13 361 3.40.718.10
1w0dB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9371 13 361 3.40.718.10
af_P76251_1_360_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9353 11 360 3.40.718.10
5hn5A00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9264 13 360 3.40.718.10
ID Description Score Start End GO Terms
AF-A0A382X5Y5-F1-model_v4 Isopropylmalate dehydrogenase-like domain-containing protein 0.9765 12 109
AF-A0A3B9S1N1-F1-model_v4 Tartrate dehydrogenase 0.975 11 181
AF-A0A7Z9UXS5-F1-model_v4 Tartrate dehydrogenase 0.9748 10 107
AF-A0A3D5FWU8-F1-model_v4 deleted 0.9724 12 110
AF-A0A3N5YZP0-F1-model_v4 D-malate dehydrogenase (decarboxylating) (EC 1.1.1.83) 0.972 26 360 GO:0000287
GO:0046553
GO:0051287

Feature Viewer

pLDDT pTM Quality
91.3 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map