F436176
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 406 | 231 | 405 | 352 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100000003|Ga0075428_100000003110 |
| Length | 347 |
| Sequence | MSAKRHRIAVIPGDGIGQEVIPAALTVLEAVASRSGFAFDLVEFPYGCAYYSKHGRMMAADAFDRLAEFPAIYFGAVGDPSVPDHVAVWELILPLRQRFDQYVNLRPMRLFPGVTSPLANRGPADIDMICVRENSEGEYAGIGGRIHAGTPYEAVEQAGLFTRHGISRIARYAFELASRRPRRELASATKSNALQHSMVLWDTVVDEVRKDYPGVAFKKYHVDALAARMVTHPQTLDVIVASNLFGDILTDLGAAISGSNINPERKYPSMFEPIHGSAPDIKGKGIANPIGAIWAGALMLDHLGEPAAHDAVVAAITKVLSSGNTKTPDMGGKASTKEMAAAIQAAI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 52 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 129 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 130 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 131 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 132 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 133 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 136 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 137 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 138 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 139 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 140 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 141 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 142 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 143 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 144 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 145 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 146 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 147 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 148 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 150 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 152 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 153 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 155 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 157 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 160 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 162 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 163 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 164 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 165 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 166 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 167 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 168 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 188 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 189 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 192 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 193 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 194 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 195 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 210 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 211 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 223 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 224 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 225 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 227 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 228 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 229 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 230 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.75 |
| Metatranscriptomes | 0 |
| Isolates | 0.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.22 |
| Nodule | 0 |
| Rhizoplane | 2.71 |
| Rhizosphere | 94.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10009533 | 3300002459 | Bacteria | 1997 |
| 2 | Ga0065712_10070358 | 3300005290 | Bacteria | 6083 |
| 3 | Ga0065712_10070543 | 3300005290 | Bacteria | 5919 |
| 4 | Ga0065712_10079104 | 3300005290 | Bacteria | 3259 |
| 5 | Ga0065715_10001286 | 3300005293 | Bacteria | 9820 |
| 6 | Ga0065715_10177011 | 3300005293 | Bacteria | 1504 |
| 7 | Ga0065707_10000894 | 3300005295 | Bacteria | 9824 |
| 8 | Ga0065707_10139475 | 3300005295 | Bacteria | 1792 |
| 9 | Ga0070670_100084745 | 3300005331 | Bacteria | 2723 |
| 10 | Ga0070670_100088070 | 3300005331 | Bacteria | 2669 |
| 11 | Ga0070670_100144624 | 3300005331 | Bacteria | 2057 |
| 12 | Ga0070680_100024169 | 3300005336 | Bacteria | 4850 |
| 13 | Ga0068868_100010052 | 3300005338 | Bacteria | 6837 |
| 14 | Ga0070668_100172302 | 3300005347 | Bacteria | 1763 |
| 15 | Ga0070669_100018395 | 3300005353 | Bacteria | 4995 |
| 16 | Ga0070669_100102603 | 3300005353 | Bacteria | 2160 |
| 17 | Ga0070669_100113772 | 3300005353 | Bacteria | 2056 |
| 18 | Ga0070675_100200671 | 3300005354 | Bacteria | 1731 |
| 19 | Ga0070675_100261034 | 3300005354 | Bacteria | 1518 |
| 20 | Ga0070674_100007855 | 3300005356 | Bacteria | 6310 |
| 21 | Ga0070674_100312922 | 3300005356 | Bacteria | 1256 |
| 22 | Ga0070673_100035710 | 3300005364 | Bacteria | 3771 |
| 23 | Ga0070673_100041662 | 3300005364 | Bacteria | 3535 |
| 24 | Ga0070673_100072485 | 3300005364 | Bacteria | 2770 |
| 25 | Ga0070688_100012507 | 3300005365 | Bacteria | 4757 |
| 26 | Ga0070688_100151084 | 3300005365 | Bacteria | 1587 |
| 27 | Ga0070659_100067025 | 3300005366 | Bacteria | 2846 |
| 28 | Ga0070667_100197496 | 3300005367 | Bacteria | 1784 |
| 29 | Ga0070703_10011410 | 3300005406 | Bacteria | 2509 |
| 30 | Ga0070713_100003083 | 3300005436 | Bacteria | 10955 |
| 31 | Ga0070711_100043021 | 3300005439 | Bacteria | 3057 |
| 32 | Ga0070711_100060435 | 3300005439 | Bacteria | 2634 |
| 33 | Ga0070700_100005546 | 3300005441 | Bacteria | 6688 |
| 34 | Ga0070694_100042609 | 3300005444 | Bacteria | 3033 |
| 35 | Ga0070694_100157009 | 3300005444 | Bacteria | 1666 |
| 36 | Ga0070708_100100113 | 3300005445 | Bacteria | 2652 |
| 37 | Ga0070681_10009756 | 3300005458 | Bacteria | 9448 |
| 38 | Ga0068867_100017251 | 3300005459 | Bacteria | 5128 |
| 39 | Ga0068867_100075302 | 3300005459 | Bacteria | 2532 |
| 40 | Ga0068867_100100108 | 3300005459 | Bacteria | 2212 |
| 41 | Ga0070706_100262354 | 3300005467 | Bacteria | 1612 |
| 42 | Ga0070707_100012798 | 3300005468 | Bacteria | 7832 |
| 43 | Ga0070698_100038364 | 3300005471 | Bacteria | 4936 |
| 44 | Ga0070698_100041328 | 3300005471 | Bacteria | 4733 |
| 45 | Ga0070699_100002075 | 3300005518 | Bacteria | 18133 |
| 46 | Ga0070699_100010933 | 3300005518 | Bacteria | 7851 |
| 47 | Ga0070679_100031022 | 3300005530 | Bacteria | 5281 |
| 48 | Ga0070679_100041246 | 3300005530 | Bacteria | 4594 |
| 49 | Ga0070697_100010004 | 3300005536 | Bacteria | 7401 |
| 50 | Ga0070697_100039212 | 3300005536 | Bacteria | 3829 |
| 51 | Ga0070697_100338804 | 3300005536 | Bacteria | 1297 |
| 52 | Ga0070672_100034136 | 3300005543 | Bacteria | 3859 |
| 53 | Ga0070686_100091951 | 3300005544 | Bacteria | 2031 |
| 54 | Ga0070695_100019492 | 3300005545 | Bacteria | 4131 |
| 55 | Ga0070695_100065980 | 3300005545 | Bacteria | 2358 |
| 56 | Ga0070695_100092752 | 3300005545 | Bacteria | 2019 |
| 57 | Ga0070696_100031530 | 3300005546 | Bacteria | 3633 |
| 58 | Ga0070665_100008321 | 3300005548 | Bacteria | 10492 |
| 59 | Ga0070665_100068411 | 3300005548 | Bacteria | 3561 |
| 60 | Ga0070665_100240161 | 3300005548 | Bacteria | 1812 |
| 61 | Ga0070665_100254608 | 3300005548 | Bacteria | 1756 |
| 62 | Ga0070665_100391514 | 3300005548 | Bacteria | 1397 |
| 63 | Ga0070704_100016250 | 3300005549 | Bacteria | 4699 |
| 64 | Ga0070704_100051184 | 3300005549 | Bacteria | 2907 |
| 65 | Ga0068855_100030220 | 3300005563 | Bacteria | 6480 |
| 66 | Ga0070664_100199561 | 3300005564 | Bacteria | 1785 |
| 67 | Ga0070664_100210663 | 3300005564 | Bacteria | 1737 |
| 68 | Ga0070702_100012265 | 3300005615 | Bacteria | 4289 |
| 69 | Ga0068859_100005205 | 3300005617 | Bacteria | 13216 |
| 70 | Ga0068859_100195728 | 3300005617 | Bacteria | 2106 |
| 71 | Ga0068859_100350496 | 3300005617 | Bacteria | 1571 |
| 72 | Ga0068864_100190706 | 3300005618 | Bacteria | 1879 |
| 73 | Ga0068866_10142717 | 3300005718 | Bacteria | 1377 |
| 74 | Ga0068861_100001513 | 3300005719 | Bacteria | 14718 |
| 75 | Ga0068861_100170835 | 3300005719 | Bacteria | 1802 |
| 76 | Ga0068863_100079945 | 3300005841 | Bacteria | 3097 |
| 77 | Ga0068863_100163940 | 3300005841 | Bacteria | 2131 |
| 78 | Ga0068858_100014454 | 3300005842 | Bacteria | 7438 |
| 79 | Ga0068858_100030096 | 3300005842 | Bacteria | 5042 |
| 80 | Ga0068858_100183756 | 3300005842 | Bacteria | 1975 |
| 81 | Ga0068860_100183405 | 3300005843 | Bacteria | 2023 |
| 82 | Ga0068862_100031431 | 3300005844 | Bacteria | 4482 |
| 83 | Ga0068862_100040347 | 3300005844 | Bacteria | 3968 |
| 84 | Ga0081455_10001424 | 3300005937 | Bacteria | 29569 |
| 85 | Ga0070717_10009835 | 3300006028 | Bacteria | 7202 |
| 86 | Ga0075364_10008651 | 3300006051 | Bacteria | 6087 |
| 87 | Ga0075362_10000445 | 3300006177 | Bacteria | 11997 |
| 88 | Ga0075367_10032474 | 3300006178 | Bacteria | 3004 |
| 89 | Ga0075366_10023604 | 3300006195 | Bacteria | 3584 |
| 90 | Ga0097621_100003820 | 3300006237 | Bacteria | 10439 |
| 91 | Ga0097621_100029383 | 3300006237 | Bacteria | 4341 |
| 92 | Ga0097621_100043790 | 3300006237 | Bacteria | 3609 |
| 93 | Ga0097621_100079361 | 3300006237 | Bacteria | 2728 |
| 94 | Ga0068871_100000783 | 3300006358 | Bacteria | 21404 |
| 95 | Ga0068871_100002214 | 3300006358 | Bacteria | 13207 |
| 96 | Ga0068871_100041050 | 3300006358 | Bacteria | 3708 |
| 97 | Ga0075428_100000003 | 3300006844 | Bacteria | 365483 |
| 98 | Ga0075428_100001453 | 3300006844 | Bacteria | 25347 |
| 99 | Ga0075428_100042177 | 3300006844 | Bacteria | 5018 |
| 100 | Ga0075430_100004088 | 3300006846 | Bacteria | 12313 |
| 101 | Ga0075431_100000913 | 3300006847 | Bacteria | 26025 |
| 102 | Ga0075431_100125314 | 3300006847 | Bacteria | 2651 |
| 103 | Ga0075431_100431852 | 3300006847 | Bacteria | 1315 |
| 104 | Ga0075434_100076267 | 3300006871 | Bacteria | 3347 |
| 105 | Ga0075429_100154847 | 3300006880 | Bacteria | 2007 |
| 106 | Ga0075429_100281416 | 3300006880 | Bacteria | 1457 |
| 107 | Ga0068865_100013554 | 3300006881 | Bacteria | 5156 |
| 108 | Ga0068865_100025255 | 3300006881 | Bacteria | 3906 |
| 109 | Ga0068865_100273660 | 3300006881 | Bacteria | 1342 |
| 110 | Ga0075436_100003144 | 3300006914 | Bacteria | 11321 |
| 111 | Ga0075436_100019911 | 3300006914 | Bacteria | 4602 |
| 112 | Ga0075436_100105265 | 3300006914 | Bacteria | 1967 |
| 113 | Ga0097620_100005205 | 3300006931 | Bacteria | 13216 |
| 114 | Ga0097620_100195742 | 3300006931 | Bacteria | 2106 |
| 115 | Ga0097620_100350471 | 3300006931 | Bacteria | 1571 |
| 116 | Ga0075435_100003305 | 3300007076 | Bacteria | 10935 |
| 117 | Ga0075435_100004177 | 3300007076 | Bacteria | 9907 |
| 118 | Ga0075435_100026553 | 3300007076 | Bacteria | 4520 |
| 119 | Ga0075435_100097189 | 3300007076 | Bacteria | 2437 |
| 120 | Ga0105240_10038337 | 3300009093 | Bacteria | 6147 |
| 121 | Ga0105240_10152563 | 3300009093 | Bacteria | 2750 |
| 122 | Ga0111539_10000001 | 3300009094 | Bacteria | 1035431 |
| 123 | Ga0111539_10198244 | 3300009094 | Bacteria | 2342 |
| 124 | Ga0111539_10238577 | 3300009094 | Bacteria | 2116 |
| 125 | Ga0105245_10007987 | 3300009098 | Bacteria | 9255 |
| 126 | Ga0105245_10008450 | 3300009098 | Bacteria | 8989 |
| 127 | Ga0114129_10017643 | 3300009147 | Bacteria | 10162 |
| 128 | Ga0114129_10017888 | 3300009147 | Bacteria | 10090 |
| 129 | Ga0114129_10035504 | 3300009147 | Bacteria | 7042 |
| 130 | Ga0114129_10065667 | 3300009147 | Bacteria | 5064 |
| 131 | Ga0114129_10078160 | 3300009147 | Bacteria | 4603 |
| 132 | Ga0114129_10083177 | 3300009147 | Bacteria | 4447 |
| 133 | Ga0114129_10137725 | 3300009147 | Bacteria | 3348 |
| 134 | Ga0114129_10162243 | 3300009147 | Bacteria | 3052 |
| 135 | Ga0114129_10708285 | 3300009147 | Bacteria | 1293 |
| 136 | Ga0105243_10043479 | 3300009148 | Bacteria | 3521 |
| 137 | Ga0105242_10006725 | 3300009176 | Bacteria | 8872 |
| 138 | Ga0105242_10012615 | 3300009176 | Bacteria | 6507 |
| 139 | Ga0105242_10059142 | 3300009176 | Bacteria | 3144 |
| 140 | Ga0105248_10004072 | 3300009177 | Bacteria | 16157 |
| 141 | Ga0105238_10273392 | 3300009551 | Bacteria | 1670 |
| 142 | Ga0105249_10173335 | 3300009553 | Bacteria | 2093 |
| 143 | Ga0105246_10203556 | 3300011119 | Bacteria | 1540 |
| 144 | Ga0105246_10251732 | 3300011119 | Bacteria | 1402 |
| 145 | Ga0157374_10022651 | 3300013296 | Bacteria | 5606 |
| 146 | Ga0157374_10114787 | 3300013296 | Bacteria | 2593 |
| 147 | Ga0163162_10574109 | 3300013306 | Bacteria | 1255 |
| 148 | Ga0157375_10231152 | 3300013308 | Bacteria | 2008 |
| 149 | Ga0163163_10020580 | 3300014325 | Bacteria | 6217 |
| 150 | Ga0163163_10047087 | 3300014325 | Bacteria | 4237 |
| 151 | Ga0163163_10103148 | 3300014325 | Bacteria | 2876 |
| 152 | Ga0157380_10106166 | 3300014326 | Bacteria | 2350 |
| 153 | Ga0157376_10004230 | 3300014969 | Bacteria | 9963 |
| 154 | Ga0157376_10024342 | 3300014969 | Bacteria | 4751 |
| 155 | Ga0157376_10419356 | 3300014969 | Bacteria | 1298 |
| 156 | Ga0157376_10499348 | 3300014969 | Bacteria | 1195 |
| 157 | Ga0207697_10000133 | 3300025315 | Bacteria | 35922 |
| 158 | Ga0207682_10025974 | 3300025893 | Bacteria | 2324 |
| 159 | Ga0207642_10038537 | 3300025899 | Bacteria | 2069 |
| 160 | Ga0207645_10005463 | 3300025907 | Bacteria | 9199 |
| 161 | Ga0207645_10162030 | 3300025907 | Bacteria | 1463 |
| 162 | Ga0207684_10002038 | 3300025910 | Bacteria | 20809 |
| 163 | Ga0207684_10005761 | 3300025910 | Bacteria | 11372 |
| 164 | Ga0207707_10003425 | 3300025912 | Bacteria | 14065 |
| 165 | Ga0207707_10217513 | 3300025912 | Bacteria | 1663 |
| 166 | Ga0207707_10256134 | 3300025912 | Bacteria | 1519 |
| 167 | Ga0207695_10421356 | 3300025913 | Bacteria | 1219 |
| 168 | Ga0207663_10148086 | 3300025916 | Bacteria | 1643 |
| 169 | Ga0207660_10018548 | 3300025917 | Bacteria | 4639 |
| 170 | Ga0207660_10057710 | 3300025917 | Bacteria | 2780 |
| 171 | Ga0207660_10089048 | 3300025917 | Bacteria | 2284 |
| 172 | Ga0207657_10002155 | 3300025919 | Bacteria | 21326 |
| 173 | Ga0207652_10023460 | 3300025921 | Bacteria | 5112 |
| 174 | Ga0207652_10029873 | 3300025921 | Bacteria | 4561 |
| 175 | Ga0207646_10000810 | 3300025922 | Bacteria | 40719 |
| 176 | Ga0207646_10035057 | 3300025922 | Bacteria | 4534 |
| 177 | Ga0207646_10040481 | 3300025922 | Bacteria | 4190 |
| 178 | Ga0207681_10031342 | 3300025923 | Bacteria | 3472 |
| 179 | Ga0207694_10250510 | 3300025924 | Bacteria | 1449 |
| 180 | Ga0207650_10085091 | 3300025925 | Bacteria | 2405 |
| 181 | Ga0207650_10094649 | 3300025925 | Bacteria | 2289 |
| 182 | Ga0207659_10049735 | 3300025926 | Bacteria | 2975 |
| 183 | Ga0207659_10214608 | 3300025926 | Bacteria | 1544 |
| 184 | Ga0207687_10040001 | 3300025927 | Bacteria | 3212 |
| 185 | Ga0207687_10070759 | 3300025927 | Bacteria | 2491 |
| 186 | Ga0207700_10002471 | 3300025928 | Bacteria | 10606 |
| 187 | Ga0207664_10043699 | 3300025929 | Bacteria | 3506 |
| 188 | Ga0207644_10200026 | 3300025931 | Bacteria | 1576 |
| 189 | Ga0207644_10375369 | 3300025931 | Bacteria | 1159 |
| 190 | Ga0207706_10157387 | 3300025933 | Bacteria | 1998 |
| 191 | Ga0207686_10004325 | 3300025934 | Bacteria | 7611 |
| 192 | Ga0207686_10035326 | 3300025934 | Bacteria | 2999 |
| 193 | Ga0207686_10105538 | 3300025934 | Bacteria | 1890 |
| 194 | Ga0207709_10130094 | 3300025935 | Bacteria | 1714 |
| 195 | Ga0207669_10026594 | 3300025937 | Bacteria | 3151 |
| 196 | Ga0207669_10155885 | 3300025937 | Bacteria | 1606 |
| 197 | Ga0207704_10022742 | 3300025938 | Bacteria | 3365 |
| 198 | Ga0207704_10036796 | 3300025938 | Bacteria | 2819 |
| 199 | Ga0207704_10110860 | 3300025938 | Bacteria | 1855 |
| 200 | Ga0207704_10126068 | 3300025938 | Bacteria | 1763 |
| 201 | Ga0207665_10033197 | 3300025939 | Bacteria | 3420 |
| 202 | Ga0207691_10029931 | 3300025940 | Bacteria | 5091 |
| 203 | Ga0207711_10012222 | 3300025941 | Bacteria | 7140 |
| 204 | Ga0207711_10044590 | 3300025941 | Bacteria | 3786 |
| 205 | Ga0207711_10074643 | 3300025941 | Bacteria | 2950 |
| 206 | Ga0207711_10151587 | 3300025941 | Bacteria | 2092 |
| 207 | Ga0207711_10240355 | 3300025941 | Bacteria | 1660 |
| 208 | Ga0207711_10397808 | 3300025941 | Bacteria | 1280 |
| 209 | Ga0207689_10036500 | 3300025942 | Bacteria | 4079 |
| 210 | Ga0207689_10265752 | 3300025942 | Bacteria | 1420 |
| 211 | Ga0207679_10177947 | 3300025945 | Bacteria | 1757 |
| 212 | Ga0207679_10332049 | 3300025945 | Bacteria | 1320 |
| 213 | Ga0207667_10073149 | 3300025949 | Bacteria | 3562 |
| 214 | Ga0207651_10010138 | 3300025960 | Bacteria | 5204 |
| 215 | Ga0207651_10227373 | 3300025960 | Bacteria | 1512 |
| 216 | Ga0207712_10085088 | 3300025961 | Bacteria | 2313 |
| 217 | Ga0207668_10079795 | 3300025972 | Bacteria | 2369 |
| 218 | Ga0207668_10234014 | 3300025972 | Bacteria | 1483 |
| 219 | Ga0207640_10032547 | 3300025981 | Bacteria | 3234 |
| 220 | Ga0207677_10047894 | 3300026023 | Bacteria | 2874 |
| 221 | Ga0207703_10031898 | 3300026035 | Bacteria | 4169 |
| 222 | Ga0207703_10036547 | 3300026035 | Bacteria | 3911 |
| 223 | Ga0207708_10011490 | 3300026075 | Bacteria | 6597 |
| 224 | Ga0207708_10025351 | 3300026075 | Bacteria | 4485 |
| 225 | Ga0207708_10340193 | 3300026075 | Bacteria | 1229 |
| 226 | Ga0207641_10138977 | 3300026088 | Bacteria | 2189 |
| 227 | Ga0207648_10004435 | 3300026089 | Bacteria | 14401 |
| 228 | Ga0207648_10013380 | 3300026089 | Bacteria | 7635 |
| 229 | Ga0207648_10060287 | 3300026089 | Bacteria | 3309 |
| 230 | Ga0207676_10031967 | 3300026095 | Bacteria | 3961 |
| 231 | Ga0207675_100002149 | 3300026118 | Bacteria | 19583 |
| 232 | Ga0207675_100032309 | 3300026118 | Bacteria | 4875 |
| 233 | Ga0207675_100156851 | 3300026118 | Bacteria | 2169 |
| 234 | Ga0207683_10005688 | 3300026121 | Bacteria | 10693 |
| 235 | Ga0207683_10257826 | 3300026121 | Bacteria | 1592 |
| 236 | Ga0207683_10332410 | 3300026121 | Bacteria | 1393 |
| 237 | Ga0207428_10000002 | 3300027907 | Bacteria | 854851 |
| 238 | Ga0268266_10016404 | 3300028379 | Bacteria | 6332 |
| 239 | Ga0268265_10028654 | 3300028380 | Bacteria | 3990 |
| 240 | Ga0268265_10200341 | 3300028380 | Bacteria | 1731 |
| 241 | Ga0268264_10167829 | 3300028381 | Bacteria | 1983 |
| 242 | Ga0268264_10253169 | 3300028381 | Bacteria | 1637 |
| 243 | Ga0268264_10291863 | 3300028381 | Bacteria | 1532 |
| 244 | Ga0307408_100025461 | 3300031548 | Bacteria | 4054 |
| 245 | Ga0307408_100235284 | 3300031548 | Bacteria | 1502 |
| 246 | Ga0307413_10017060 | 3300031824 | Bacteria | 3773 |
| 247 | Ga0307413_10057271 | 3300031824 | Bacteria | 2382 |
| 248 | Ga0307410_10054059 | 3300031852 | Bacteria | 2720 |
| 249 | Ga0307410_10056305 | 3300031852 | Bacteria | 2673 |
| 250 | Ga0307410_10092760 | 3300031852 | Bacteria | 2147 |
| 251 | Ga0307406_10132633 | 3300031901 | Bacteria | 1751 |
| 252 | Ga0307406_10220503 | 3300031901 | Bacteria | 1409 |
| 253 | Ga0307407_10028265 | 3300031903 | Bacteria | 2996 |
| 254 | Ga0307407_10081850 | 3300031903 | Bacteria | 1955 |
| 255 | Ga0307407_10100044 | 3300031903 | Bacteria | 1797 |
| 256 | Ga0307409_100029557 | 3300031995 | Bacteria | 3923 |
| 257 | Ga0307409_100039038 | 3300031995 | Bacteria | 3519 |
| 258 | Ga0307409_100117280 | 3300031995 | Bacteria | 2246 |
| 259 | Ga0307416_100219413 | 3300032002 | Bacteria | 1822 |
| 260 | Ga0307416_100299036 | 3300032002 | Bacteria | 1598 |
| 261 | Ga0307416_100650339 | 3300032002 | Bacteria | 1139 |
| 262 | Ga0307411_10006596 | 3300032005 | Bacteria | 5824 |
| 263 | Ga0307411_10093514 | 3300032005 | Bacteria | 2105 |
| 264 | Ga0307411_10093755 | 3300032005 | Bacteria | 2103 |
| 265 | Ga0307415_100131409 | 3300032126 | Bacteria | 1896 |
| 266 | Ga0316585_10022885 | 3300032137 | Bacteria | 1924 |
| 267 | Ga0373930_0000408 | 3300034816 | Bacteria | 5699 |
| 268 | Ga0373959_0001589 | 3300034820 | Bacteria | 3613 |
| 269 | Ga0373938_0003042 | 3300034957 | Bacteria | 2722 |
| 270 | Ga0373928_0001787 | 3300035084 | Bacteria | 4181 |
| 271 | Ga0373929_0000136 | 3300035085 | Bacteria | 12486 |
| 272 | Ga0373940_0036521 | 3300035088 | Bacteria | 1334 |
| 273 | Ga0373949_0000556 | 3300035090 | Bacteria | 12277 |
| 274 | Ga0373951_0000414 | 3300035091 | Bacteria | 12575 |
| 275 | Ga0373952_0000552 | 3300035092 | Bacteria | 6597 |
| 276 | Ga0373923_0007753 | 3300035111 | Bacteria | 3792 |
| 277 | Ga0373932_0001178 | 3300035112 | Bacteria | 7476 |
| 278 | Ga0373939_0001051 | 3300035114 | Bacteria | 6801 |
| 279 | Ga0373941_0000101 | 3300035115 | Bacteria | 14297 |
| 280 | Ga0373960_0000074 | 3300035121 | Bacteria | 14453 |
| 281 | Ga0373943_0006992 | 3300035170 | Bacteria | 5063 |
| 282 | Ga0373946_0015547 | 3300035171 | Bacteria | 2888 |
| 283 | Ga0373946_0022181 | 3300035171 | Bacteria | 2469 |
| 284 | Ga0373955_0012864 | 3300035172 | Bacteria | 4034 |
| 285 | Ga0373955_0207648 | 3300035172 | Bacteria | 1167 |
| 286 | Ga0373942_0001075 | 3300035207 | Bacteria | 7330 |
| 287 | Ga0373962_0000481 | 3300035242 | Bacteria | 8833 |
| 288 | Ga0373931_0005467 | 3300035691 | Bacteria | 5881 |
| 289 | Ga0373931_0160372 | 3300035691 | Bacteria | 1318 |
| 290 | Ga0373937_0004641 | 3300036401 | Bacteria | 11666 |
| 291 | Ga0373937_0096240 | 3300036401 | Bacteria | 2746 |
| 292 | Ga0373937_0291070 | 3300036401 | Bacteria | 1543 |
| 293 | Ga0373937_0541319 | 3300036401 | Bacteria | 1106 |
| 294 | Ga0316584_0003899 | 3300036712 | Bacteria | 9795 |
| 295 | Ga0373925_0001019 | 3300037068 | Bacteria | 25348 |
| 296 | Ga0373925_0015408 | 3300037068 | Bacteria | 5527 |
| 297 | Ga0373925_0152778 | 3300037068 | Bacteria | 1814 |
| 298 | Ga0436364_1192133 | 3300037853 | Bacteria | 2975 |
| 299 | Ga0400483_265560 | 3300039062 | Bacteria | 9326 |
| 300 | Ga0439446_0001704 | 3300042156 | Bacteria | 5096 |
| 301 | Ga0439435_0015513 | 3300042436 | Bacteria | 1898 |
| 302 | Ga0439460_0064620 | 3300042461 | Bacteria | 1123 |
| 303 | Ga0451576_0034359 | 3300045051 | Bacteria | 5385 |
| 304 | Ga0451576_0574793 | 3300045051 | Bacteria | 1184 |
| 305 | Ga0466967_0132299 | 3300045976 | Bacteria | 2317 |
| 306 | Ga0495629_0130665 | 3300046459 | Bacteria | 1749 |
| 307 | Ga0495651_0124970 | 3300046462 | Bacteria | 1885 |
| 308 | Ga0495608_0018934 | 3300046511 | Bacteria | 4745 |
| 309 | Ga0495608_0095035 | 3300046511 | Bacteria | 1926 |
| 310 | Ga0495628_0019609 | 3300046516 | Bacteria | 5587 |
| 311 | Ga0495628_0129182 | 3300046516 | Bacteria | 1934 |
| 312 | Ga0495630_0027255 | 3300046517 | Bacteria | 4236 |
| 313 | Ga0495652_0098550 | 3300046529 | Bacteria | 2376 |
| 314 | Ga0495586_0115844 | 3300046535 | Bacteria | 1494 |
| 315 | Ga0495645_0001183 | 3300046543 | Bacteria | 17811 |
| 316 | Ga0495645_0027038 | 3300046543 | Bacteria | 4167 |
| 317 | Ga0495633_0040626 | 3300046558 | Bacteria | 2215 |
| 318 | Ga0495647_0086139 | 3300046681 | Bacteria | 1281 |
| 319 | Ga0495658_0080451 | 3300046683 | Bacteria | 1911 |
| 320 | Ga0495658_0151810 | 3300046683 | Bacteria | 1423 |
| 321 | Ga0495669_0003123 | 3300046684 | Bacteria | 6815 |
| 322 | Ga0495613_0000819 | 3300046689 | Bacteria | 24089 |
| 323 | Ga0495600_0097837 | 3300046809 | Bacteria | 1913 |
| 324 | Ga0495581_0083253 | 3300047315 | Bacteria | 1853 |
| 325 | Ga0495604_0093513 | 3300047317 | Bacteria | 2224 |
| 326 | Ga0495674_0029578 | 3300047319 | Bacteria | 4987 |
| 327 | Ga0495674_0172425 | 3300047319 | Bacteria | 1804 |
| 328 | Ga0495684_0000235 | 3300047471 | Bacteria | 43518 |
| 329 | Ga0496100_0442520 | 3300048903 | Bacteria | 995 |
| 330 | Ga0496102_0536868 | 3300048905 | Bacteria | 1092 |
| 331 | Ga0496104_0042217 | 3300048907 | Bacteria | 4279 |
| 332 | Ga0496108_0122160 | 3300048911 | Bacteria | 2234 |
| 333 | Ga0496109_0195592 | 3300048912 | Bacteria | 1900 |
| 334 | Ga0496109_0449245 | 3300048912 | Bacteria | 1218 |
| 335 | Ga0496110_0031725 | 3300048913 | Bacteria | 4561 |
| 336 | Ga0496112_0021001 | 3300048915 | Bacteria | 6201 |
| 337 | Ga0496112_0327583 | 3300048915 | Bacteria | 1476 |
| 338 | Ga0496113_0035011 | 3300048916 | Bacteria | 3669 |
| 339 | Ga0496115_0190953 | 3300048918 | Bacteria | 1692 |
| 340 | Ga0501034_0008745 | 3300049571 | Bacteria | 10659 |
| 341 | Ga0501034_0043603 | 3300049571 | Bacteria | 4539 |
| 342 | Ga0501034_0087025 | 3300049571 | Bacteria | 3125 |
| 343 | Ga0501034_0400451 | 3300049571 | Bacteria | 1295 |
| 344 | Ga0501036_0241731 | 3300049572 | Bacteria | 1514 |
| 345 | Ga0501047_0362140 | 3300049581 | Bacteria | 1286 |
| 346 | Ga0501048_0086670 | 3300049582 | Bacteria | 2209 |
| 347 | Ga0501048_0297419 | 3300049582 | Bacteria | 1148 |
| 348 | Ga0501067_0081173 | 3300049583 | Bacteria | 1798 |
| 349 | Ga0501071_0189065 | 3300049587 | Bacteria | 1544 |
| 350 | Ga0501072_0059945 | 3300049588 | Bacteria | 3001 |
| 351 | Ga0501073_0233992 | 3300049589 | Bacteria | 1269 |
| 352 | Ga0501074_0154330 | 3300049590 | Bacteria | 1641 |
| 353 | Ga0501076_0140707 | 3300049592 | Bacteria | 1960 |
| 354 | Ga0501076_0147146 | 3300049592 | Bacteria | 1916 |
| 355 | Ga0501079_0046559 | 3300049741 | Bacteria | 3347 |
| 356 | Ga0501080_0342393 | 3300049742 | Bacteria | 1351 |
| 357 | Ga0501044_0003092 | 3300049823 | Bacteria | 18842 |
| 358 | Ga0501045_0275930 | 3300049824 | Bacteria | 1251 |
| 359 | Ga0501045_0341123 | 3300049824 | Bacteria | 1115 |
| 360 | nmdc:mga00v17_14485_c1 | 3300050491 | Bacteria | 4402 |
| 361 | nmdc:mga0k408_43884_c1 | 3300050493 | Bacteria | 2578 |
| 362 | nmdc:mga05p37_17597_c1 | 3300050507 | Bacteria | 8626 |
| 363 | nmdc:mga05p37_19883_c1 | 3300050507 | Bacteria | 8122 |
| 364 | nmdc:mga05p37_209159_c1 | 3300050507 | Bacteria | 2359 |
| 365 | nmdc:mga05p37_26387_c1 | 3300050507 | Bacteria | 7065 |
| 366 | nmdc:mga05p37_37131_c1 | 3300050507 | Bacteria | 5976 |
| 367 | nmdc:mga05p37_402068_c1 | 3300050507 | Bacteria | 1599 |
| 368 | nmdc:mga09592_251445_c1 | 3300050508 | Bacteria | 1532 |
| 369 | nmdc:mga09592_93072_c1 | 3300050508 | Bacteria | 2577 |
| 370 | nmdc:mga0qj67_351199_c1 | 3300050509 | Bacteria | 1192 |
| 371 | nmdc:mga0qj67_7086_c1 | 3300050509 | Bacteria | 8270 |
| 372 | nmdc:mga06r32_28104_c1 | 3300050510 | Bacteria | 5260 |
| 373 | nmdc:mga08y16_3_c1 | 3300050511 | Bacteria | 936907 |
| 374 | nmdc:mga08y16_435304_c1 | 3300050511 | Bacteria | 1339 |
| 375 | nmdc:mga08y16_8464_c1 | 3300050511 | Bacteria | 10772 |
| 376 | nmdc:mga0n895_10_c1 | 3300050512 | Bacteria | 115544 |
| 377 | nmdc:mga0n895_205817_c1 | 3300050512 | Bacteria | 1998 |
| 378 | nmdc:mga0n895_429752_c1 | 3300050512 | Bacteria | 1335 |
| 379 | nmdc:mga0n895_62441_c1 | 3300050512 | Bacteria | 3682 |
| 380 | nmdc:mga0rr50_20_c1 | 3300050513 | Bacteria | 140799 |
| 381 | nmdc:mga0rr50_3040_c1 | 3300050513 | Bacteria | 9597 |
| 382 | nmdc:mga0rr50_494698_c1 | 3300050513 | Bacteria | 1039 |
| 383 | nmdc:mga08x19_20176_c1 | 3300050514 | Bacteria | 4103 |
| 384 | nmdc:mga08x19_2537_c1 | 3300050514 | Bacteria | 11101 |
| 385 | nmdc:mga08x19_43868_c1 | 3300050514 | Bacteria | 2853 |
| 386 | Ga0495601_0154434 | 3300053077 | Bacteria | 1499 |
| 387 | Ga0495595_0084765 | 3300053084 | Bacteria | 1514 |
| 388 | Ga0495619_0012750 | 3300053085 | Bacteria | 5291 |
| 389 | Ga0495619_0049036 | 3300053085 | Bacteria | 2783 |
| 390 | Ga0495619_0049604 | 3300053085 | Bacteria | 2769 |
| 391 | Ga0500555_000258 | 3300053103 | Bacteria | 23303 |
| 392 | Ga0500616_0001849 | 3300053153 | Bacteria | 19174 |
| 393 | Ga0500645_000060 | 3300053730 | Bacteria | 89018 |
| 394 | Ga0501084_0011682 | 3300054114 | Bacteria | 7271 |
| 395 | Ga0501084_0153141 | 3300054114 | Bacteria | 1944 |
| 396 | Ga0501084_0378643 | 3300054114 | Bacteria | 1196 |
| 397 | Ga0590071_000380 | 3300059421 | Bacteria | 13035 |
| 398 | Ga0590071_000890 | 3300059421 | Bacteria | 8300 |
| 399 | Ga0590074_002618 | 3300059423 | Bacteria | 2953 |
| 400 | Ga0590075_000108 | 3300059424 | Bacteria | 21310 |
| 401 | Ga0590075_001091 | 3300059424 | Bacteria | 7004 |
| 402 | Ga0590075_019483 | 3300059424 | Bacteria | 1684 |
| 403 | Ga0590077_000670 | 3300059426 | Bacteria | 9109 |
| 404 | Ga0501082_0390654 | 3300060353 | Bacteria | 1214 |
| 405 | Ga0530510_0098374 | 3300061734 | Bacteria | 2139 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050513 | nmdc:mga0rr50_494698_c1 | nmdc:mga0rr50_494698_c1_115_1011 | 291 |
| 2 | 3300025917 | Ga0207660_10089048 | Ga0207660_100890482 | 296 |
| 3 | 3300059421 | Ga0590071_000380 | Ga0590071_000380_3706_4785 | 314 |
| 4 | 3300048903 | Ga0496100_0442520 | Ga0496100_0442520_20_973 | 317 |
| 5 | 3300059424 | Ga0590075_000108 | Ga0590075_000108_10881_11960 | 317 |
| 6 | 3300009147 | Ga0114129_10162243 | Ga0114129_101622433 | 319 |
| 7 | 3300050507 | nmdc:mga05p37_209159_c1 | nmdc:mga05p37_209159_c1_426_1523 | 324 |
| 8 | 3300049588 | Ga0501072_0059945 | Ga0501072_0059945_38_1030 | 329 |
| 9 | 3300006914 | Ga0075436_100019911 | Ga0075436_1000199111 | 333 |
| 10 | 3300050512 | nmdc:mga0n895_205817_c1 | nmdc:mga0n895_205817_c1_230_1309 | 333 |
| 11 | 3300050514 | nmdc:mga08x19_20176_c1 | nmdc:mga08x19_20176_c1_1370_2449 | 333 |
| 12 | 3300009147 | Ga0114129_10017888 | Ga0114129_100178883 | 334 |
| 13 | 3300050507 | nmdc:mga05p37_37131_c1 | nmdc:mga05p37_37131_c1_2685_3689 | 334 |
| 14 | 3300048905 | Ga0496102_0536868 | Ga0496102_0536868_14_1057 | 338 |
| 15 | 3300005842 | Ga0068858_100183756 | Ga0068858_1001837562 | 343 |
| 16 | 3300005290 | Ga0065712_10079104 | Ga0065712_100791043 | 345 |
| 17 | 3300005293 | Ga0065715_10001286 | Ga0065715_100012864 | 345 |
| 18 | 3300005406 | Ga0070703_10011410 | Ga0070703_100114102 | 345 |
| 19 | 3300005444 | Ga0070694_100157009 | Ga0070694_1001570092 | 345 |
| 20 | 3300005545 | Ga0070695_100019492 | Ga0070695_1000194922 | 345 |
| 21 | 3300005545 | Ga0070695_100092752 | Ga0070695_1000927522 | 345 |
| 22 | 3300005617 | Ga0068859_100005205 | Ga0068859_10000520512 | 345 |
| 23 | 3300005844 | Ga0068862_100031431 | Ga0068862_1000314313 | 345 |
| 24 | 3300006931 | Ga0097620_100005205 | Ga0097620_1000052053 | 345 |
| 25 | 3300014325 | Ga0163163_10103148 | Ga0163163_101031483 | 345 |
| 26 | 3300025922 | Ga0207646_10040481 | Ga0207646_100404813 | 345 |
| 27 | 3300042461 | Ga0439460_0064620 | Ga0439460_0064620_13_1059 | 345 |
| 28 | 3300005295 | Ga0065707_10000894 | Ga0065707_100008947 | 346 |
| 29 | 3300005356 | Ga0070674_100312922 | Ga0070674_1003129221 | 346 |
| 30 | 3300009553 | Ga0105249_10173335 | Ga0105249_101733352 | 346 |
| 31 | 3300025923 | Ga0207681_10031342 | Ga0207681_100313424 | 346 |
| 32 | 3300025937 | Ga0207669_10026594 | Ga0207669_100265943 | 346 |
| 33 | 3300028380 | Ga0268265_10028654 | Ga0268265_100286542 | 346 |
| 34 | 3300042436 | Ga0439435_0015513 | Ga0439435_0015513_269_1333 | 346 |
| 35 | 3300049572 | Ga0501036_0241731 | Ga0501036_0241731_393_1454 | 346 |
| 36 | 3300049582 | Ga0501048_0086670 | Ga0501048_0086670_114_1175 | 346 |
| 37 | 3300049824 | Ga0501045_0275930 | Ga0501045_0275930_57_1118 | 346 |
| 38 | 3300005548 | Ga0070665_100240161 | Ga0070665_1002401612 | 347 |
| 39 | 3300006844 | Ga0075428_100000003 | Ga0075428_100000003110 | 347 |
| 40 | 3300007076 | Ga0075435_100097189 | Ga0075435_1000971893 | 347 |
| 41 | 3300009094 | Ga0111539_10000001 | Ga0111539_10000001369 | 347 |
| 42 | 3300009147 | Ga0114129_10708285 | Ga0114129_107082851 | 347 |
| 43 | 3300011119 | Ga0105246_10203556 | Ga0105246_102035561 | 347 |
| 44 | 3300014969 | Ga0157376_10419356 | Ga0157376_104193561 | 347 |
| 45 | 3300025315 | Ga0207697_10000133 | Ga0207697_100001335 | 347 |
| 46 | 3300027907 | Ga0207428_10000002 | Ga0207428_10000002380 | 347 |
| 47 | 3300048912 | Ga0496109_0449245 | Ga0496109_0449245_53_1096 | 347 |
| 48 | 3300050511 | nmdc:mga08y16_3_c1 | nmdc:mga08y16_3_c1_399643_400707 | 347 |
| 49 | 3300049582 | Ga0501048_0297419 | Ga0501048_0297419_70_1119 | 348 |
| 50 | 3300049741 | Ga0501079_0046559 | Ga0501079_0046559_116_1165 | 348 |
| 51 | 3300049742 | Ga0501080_0342393 | Ga0501080_0342393_267_1316 | 348 |
| 52 | 3300061734 | Ga0530510_0098374 | Ga0530510_0098374_167_1216 | 348 |
| 53 | 3300005445 | Ga0070708_100100113 | Ga0070708_1001001132 | 349 |
| 54 | 3300005518 | Ga0070699_100010933 | Ga0070699_1000109335 | 349 |
| 55 | 3300006914 | Ga0075436_100105265 | Ga0075436_1001052651 | 349 |
| 56 | 3300005290 | Ga0065712_10070358 | Ga0065712_100703583 | 350 |
| 57 | 3300005536 | Ga0070697_100338804 | Ga0070697_1003388041 | 350 |
| 58 | 3300005564 | Ga0070664_100210663 | Ga0070664_1002106632 | 350 |
| 59 | 3300005841 | Ga0068863_100079945 | Ga0068863_1000799452 | 350 |
| 60 | 3300005842 | Ga0068858_100014454 | Ga0068858_1000144545 | 350 |
| 61 | 3300006051 | Ga0075364_10008651 | Ga0075364_100086512 | 350 |
| 62 | 3300006177 | Ga0075362_10000445 | Ga0075362_1000044510 | 350 |
| 63 | 3300006178 | Ga0075367_10032474 | Ga0075367_100324742 | 350 |
| 64 | 3300006195 | Ga0075366_10023604 | Ga0075366_100236043 | 350 |
| 65 | 3300009147 | Ga0114129_10137725 | Ga0114129_101377253 | 350 |
| 66 | 3300009177 | Ga0105248_10004072 | Ga0105248_100040729 | 350 |
| 67 | 3300014325 | Ga0163163_10047087 | Ga0163163_100470873 | 350 |
| 68 | 3300025941 | Ga0207711_10012222 | Ga0207711_100122225 | 350 |
| 69 | 3300025945 | Ga0207679_10177947 | Ga0207679_101779472 | 350 |
| 70 | 3300026035 | Ga0207703_10031898 | Ga0207703_100318983 | 350 |
| 71 | 3300026088 | Ga0207641_10138977 | Ga0207641_101389773 | 350 |
| 72 | 3300026095 | Ga0207676_10031967 | Ga0207676_100319671 | 350 |
| 73 | 3300026121 | Ga0207683_10257826 | Ga0207683_102578262 | 350 |
| 74 | 3300035172 | Ga0373955_0207648 | Ga0373955_0207648_105_1157 | 350 |
| 75 | 3300037068 | Ga0373925_0001019 | Ga0373925_0001019_12799_13851 | 350 |
| 76 | 3300047319 | Ga0495674_0172425 | Ga0495674_0172425_484_1536 | 350 |
| 77 | 3300048907 | Ga0496104_0042217 | Ga0496104_0042217_2071_3123 | 350 |
| 78 | 3300048911 | Ga0496108_0122160 | Ga0496108_0122160_618_1670 | 350 |
| 79 | 3300048915 | Ga0496112_0021001 | Ga0496112_0021001_1321_2373 | 350 |
| 80 | 3300048916 | Ga0496113_0035011 | Ga0496113_0035011_720_1772 | 350 |
| 81 | 3300049571 | Ga0501034_0043603 | Ga0501034_0043603_1872_2924 | 350 |
| 82 | 3300049581 | Ga0501047_0362140 | Ga0501047_0362140_108_1160 | 350 |
| 83 | 3300049590 | Ga0501074_0154330 | Ga0501074_0154330_177_1229 | 350 |
| 84 | 3300050491 | nmdc:mga00v17_14485_c1 | nmdc:mga00v17_14485_c1_992_2044 | 350 |
| 85 | 3300050493 | nmdc:mga0k408_43884_c1 | nmdc:mga0k408_43884_c1_49_1101 | 350 |
| 86 | 3300005331 | Ga0070670_100088070 | Ga0070670_1000880702 | 351 |
| 87 | 3300005338 | Ga0068868_100010052 | Ga0068868_1000100525 | 351 |
| 88 | 3300005354 | Ga0070675_100200671 | Ga0070675_1002006711 | 351 |
| 89 | 3300005459 | Ga0068867_100017251 | Ga0068867_1000172511 | 351 |
| 90 | 3300005548 | Ga0070665_100391514 | Ga0070665_1003915142 | 351 |
| 91 | 3300005549 | Ga0070704_100016250 | Ga0070704_1000162504 | 351 |
| 92 | 3300005564 | Ga0070664_100199561 | Ga0070664_1001995612 | 351 |
| 93 | 3300005618 | Ga0068864_100190706 | Ga0068864_1001907061 | 351 |
| 94 | 3300005841 | Ga0068863_100163940 | Ga0068863_1001639401 | 351 |
| 95 | 3300005842 | Ga0068858_100030096 | Ga0068858_1000300964 | 351 |
| 96 | 3300005937 | Ga0081455_10001424 | Ga0081455_1000142424 | 351 |
| 97 | 3300006237 | Ga0097621_100003820 | Ga0097621_1000038202 | 351 |
| 98 | 3300006358 | Ga0068871_100002214 | Ga0068871_1000022142 | 351 |
| 99 | 3300006847 | Ga0075431_100125314 | Ga0075431_1001253141 | 351 |
| 100 | 3300006847 | Ga0075431_100431852 | Ga0075431_1004318521 | 351 |
| 101 | 3300006881 | Ga0068865_100013554 | Ga0068865_1000135541 | 351 |
| 102 | 3300006881 | Ga0068865_100025255 | Ga0068865_1000252552 | 351 |
| 103 | 3300009098 | Ga0105245_10007987 | Ga0105245_100079876 | 351 |
| 104 | 3300009098 | Ga0105245_10008450 | Ga0105245_100084508 | 351 |
| 105 | 3300009147 | Ga0114129_10083177 | Ga0114129_100831772 | 351 |
| 106 | 3300009176 | Ga0105242_10006725 | Ga0105242_100067252 | 351 |
| 107 | 3300009176 | Ga0105242_10059142 | Ga0105242_100591422 | 351 |
| 108 | 3300011119 | Ga0105246_10251732 | Ga0105246_102517322 | 351 |
| 109 | 3300013296 | Ga0157374_10022651 | Ga0157374_100226515 | 351 |
| 110 | 3300014969 | Ga0157376_10004230 | Ga0157376_100042302 | 351 |
| 111 | 3300014969 | Ga0157376_10024342 | Ga0157376_100243422 | 351 |
| 112 | 3300014969 | Ga0157376_10499348 | Ga0157376_104993481 | 351 |
| 113 | 3300025926 | Ga0207659_10214608 | Ga0207659_102146082 | 351 |
| 114 | 3300025927 | Ga0207687_10040001 | Ga0207687_100400012 | 351 |
| 115 | 3300025927 | Ga0207687_10070759 | Ga0207687_100707593 | 351 |
| 116 | 3300025934 | Ga0207686_10004325 | Ga0207686_100043252 | 351 |
| 117 | 3300025934 | Ga0207686_10035326 | Ga0207686_100353262 | 351 |
| 118 | 3300025938 | Ga0207704_10022742 | Ga0207704_100227423 | 351 |
| 119 | 3300025938 | Ga0207704_10036796 | Ga0207704_100367961 | 351 |
| 120 | 3300025941 | Ga0207711_10397808 | Ga0207711_103978081 | 351 |
| 121 | 3300026023 | Ga0207677_10047894 | Ga0207677_100478943 | 351 |
| 122 | 3300026035 | Ga0207703_10036547 | Ga0207703_100365473 | 351 |
| 123 | 3300026089 | Ga0207648_10060287 | Ga0207648_100602871 | 351 |
| 124 | 3300026121 | Ga0207683_10332410 | Ga0207683_103324101 | 351 |
| 125 | 3300028379 | Ga0268266_10016404 | Ga0268266_100164042 | 351 |
| 126 | 3300031548 | Ga0307408_100025461 | Ga0307408_1000254612 | 351 |
| 127 | 3300031824 | Ga0307413_10017060 | Ga0307413_100170602 | 351 |
| 128 | 3300031852 | Ga0307410_10056305 | Ga0307410_100563052 | 351 |
| 129 | 3300031901 | Ga0307406_10132633 | Ga0307406_101326332 | 351 |
| 130 | 3300031903 | Ga0307407_10081850 | Ga0307407_100818502 | 351 |
| 131 | 3300031995 | Ga0307409_100039038 | Ga0307409_1000390382 | 351 |
| 132 | 3300031995 | Ga0307409_100117280 | Ga0307409_1001172802 | 351 |
| 133 | 3300032002 | Ga0307416_100299036 | Ga0307416_1002990361 | 351 |
| 134 | 3300032005 | Ga0307411_10006596 | Ga0307411_100065963 | 351 |
| 135 | 3300032126 | Ga0307415_100131409 | Ga0307415_1001314092 | 351 |
| 136 | 3300036401 | Ga0373937_0004641 | Ga0373937_0004641_10412_11467 | 351 |
| 137 | 3300036401 | Ga0373937_0096240 | Ga0373937_0096240_1548_2603 | 351 |
| 138 | 3300045976 | Ga0466967_0132299 | Ga0466967_0132299_1199_2254 | 351 |
| 139 | 3300046511 | Ga0495608_0095035 | Ga0495608_0095035_560_1615 | 351 |
| 140 | 3300046516 | Ga0495628_0129182 | Ga0495628_0129182_410_1465 | 351 |
| 141 | 3300046535 | Ga0495586_0115844 | Ga0495586_0115844_22_1077 | 351 |
| 142 | 3300046543 | Ga0495645_0001183 | Ga0495645_0001183_14003_15058 | 351 |
| 143 | 3300046809 | Ga0495600_0097837 | Ga0495600_0097837_74_1129 | 351 |
| 144 | 3300048918 | Ga0496115_0190953 | Ga0496115_0190953_522_1577 | 351 |
| 145 | 3300049592 | Ga0501076_0147146 | Ga0501076_0147146_674_1735 | 351 |
| 146 | 3300049824 | Ga0501045_0341123 | Ga0501045_0341123_19_1080 | 351 |
| 147 | 3300050507 | nmdc:mga05p37_17597_c1 | nmdc:mga05p37_17597_c1_2715_3770 | 351 |
| 148 | 3300053077 | Ga0495601_0154434 | Ga0495601_0154434_265_1320 | 351 |
| 149 | 3300053084 | Ga0495595_0084765 | Ga0495595_0084765_135_1190 | 351 |
| 150 | 3300053085 | Ga0495619_0049036 | Ga0495619_0049036_840_1895 | 351 |
| 151 | 3300053085 | Ga0495619_0049604 | Ga0495619_0049604_980_2035 | 351 |
| 152 | 3300054114 | Ga0501084_0378643 | Ga0501084_0378643_22_1083 | 351 |
| 153 | 3300059421 | Ga0590071_000890 | Ga0590071_000890_4538_5605 | 351 |
| 154 | 3300059423 | Ga0590074_002618 | Ga0590074_002618_772_1839 | 351 |
| 155 | 3300059424 | Ga0590075_001091 | Ga0590075_001091_1216_2283 | 351 |
| 156 | 3300059426 | Ga0590077_000670 | Ga0590077_000670_1850_2917 | 351 |
| 157 | iso_pu_bacteria | 2883354860 | 2883357695 | 351 |
| 158 | 3300005353 | Ga0070669_100018395 | Ga0070669_1000183952 | 352 |
| 159 | 3300005364 | Ga0070673_100041662 | Ga0070673_1000416623 | 352 |
| 160 | 3300005365 | Ga0070688_100151084 | Ga0070688_1001510842 | 352 |
| 161 | 3300005367 | Ga0070667_100197496 | Ga0070667_1001974961 | 352 |
| 162 | 3300005441 | Ga0070700_100005546 | Ga0070700_1000055465 | 352 |
| 163 | 3300005444 | Ga0070694_100042609 | Ga0070694_1000426092 | 352 |
| 164 | 3300005459 | Ga0068867_100100108 | Ga0068867_1001001081 | 352 |
| 165 | 3300005471 | Ga0070698_100038364 | Ga0070698_1000383643 | 352 |
| 166 | 3300005536 | Ga0070697_100039212 | Ga0070697_1000392122 | 352 |
| 167 | 3300005544 | Ga0070686_100091951 | Ga0070686_1000919512 | 352 |
| 168 | 3300005545 | Ga0070695_100065980 | Ga0070695_1000659802 | 352 |
| 169 | 3300005546 | Ga0070696_100031530 | Ga0070696_1000315301 | 352 |
| 170 | 3300005548 | Ga0070665_100254608 | Ga0070665_1002546081 | 352 |
| 171 | 3300005549 | Ga0070704_100051184 | Ga0070704_1000511842 | 352 |
| 172 | 3300005615 | Ga0070702_100012265 | Ga0070702_1000122654 | 352 |
| 173 | 3300005719 | Ga0068861_100001513 | Ga0068861_1000015136 | 352 |
| 174 | 3300005844 | Ga0068862_100040347 | Ga0068862_1000403473 | 352 |
| 175 | 3300006028 | Ga0070717_10009835 | Ga0070717_100098358 | 352 |
| 176 | 3300006844 | Ga0075428_100001453 | Ga0075428_10000145315 | 352 |
| 177 | 3300006844 | Ga0075428_100042177 | Ga0075428_1000421774 | 352 |
| 178 | 3300006847 | Ga0075431_100000913 | Ga0075431_10000091322 | 352 |
| 179 | 3300006880 | Ga0075429_100154847 | Ga0075429_1001548472 | 352 |
| 180 | 3300006880 | Ga0075429_100281416 | Ga0075429_1002814161 | 352 |
| 181 | 3300009094 | Ga0111539_10198244 | Ga0111539_101982442 | 352 |
| 182 | 3300009094 | Ga0111539_10238577 | Ga0111539_102385772 | 352 |
| 183 | 3300009147 | Ga0114129_10035504 | Ga0114129_100355049 | 352 |
| 184 | 3300013306 | Ga0163162_10574109 | Ga0163162_105741091 | 352 |
| 185 | 3300025907 | Ga0207645_10005463 | Ga0207645_100054632 | 352 |
| 186 | 3300025907 | Ga0207645_10162030 | Ga0207645_101620301 | 352 |
| 187 | 3300025910 | Ga0207684_10005761 | Ga0207684_100057614 | 352 |
| 188 | 3300025922 | Ga0207646_10035057 | Ga0207646_100350573 | 352 |
| 189 | 3300025933 | Ga0207706_10157387 | Ga0207706_101573872 | 352 |
| 190 | 3300025935 | Ga0207709_10130094 | Ga0207709_101300942 | 352 |
| 191 | 3300025937 | Ga0207669_10155885 | Ga0207669_101558852 | 352 |
| 192 | 3300025939 | Ga0207665_10033197 | Ga0207665_100331974 | 352 |
| 193 | 3300025940 | Ga0207691_10029931 | Ga0207691_100299314 | 352 |
| 194 | 3300025941 | Ga0207711_10074643 | Ga0207711_100746433 | 352 |
| 195 | 3300025942 | Ga0207689_10265752 | Ga0207689_102657522 | 352 |
| 196 | 3300025960 | Ga0207651_10227373 | Ga0207651_102273732 | 352 |
| 197 | 3300025981 | Ga0207640_10032547 | Ga0207640_100325473 | 352 |
| 198 | 3300026075 | Ga0207708_10011490 | Ga0207708_100114905 | 352 |
| 199 | 3300026075 | Ga0207708_10025351 | Ga0207708_100253514 | 352 |
| 200 | 3300026089 | Ga0207648_10004435 | Ga0207648_100044356 | 352 |
| 201 | 3300026118 | Ga0207675_100002149 | Ga0207675_10000214916 | 352 |
| 202 | 3300026118 | Ga0207675_100156851 | Ga0207675_1001568512 | 352 |
| 203 | 3300028381 | Ga0268264_10167829 | Ga0268264_101678292 | 352 |
| 204 | 3300031548 | Ga0307408_100235284 | Ga0307408_1002352841 | 352 |
| 205 | 3300031824 | Ga0307413_10057271 | Ga0307413_100572712 | 352 |
| 206 | 3300031852 | Ga0307410_10054059 | Ga0307410_100540592 | 352 |
| 207 | 3300031852 | Ga0307410_10092760 | Ga0307410_100927602 | 352 |
| 208 | 3300031901 | Ga0307406_10220503 | Ga0307406_102205032 | 352 |
| 209 | 3300031903 | Ga0307407_10028265 | Ga0307407_100282651 | 352 |
| 210 | 3300031903 | Ga0307407_10100044 | Ga0307407_101000441 | 352 |
| 211 | 3300031995 | Ga0307409_100029557 | Ga0307409_1000295571 | 352 |
| 212 | 3300032002 | Ga0307416_100219413 | Ga0307416_1002194132 | 352 |
| 213 | 3300032002 | Ga0307416_100650339 | Ga0307416_1006503391 | 352 |
| 214 | 3300032005 | Ga0307411_10093514 | Ga0307411_100935142 | 352 |
| 215 | 3300032005 | Ga0307411_10093755 | Ga0307411_100937552 | 352 |
| 216 | 3300032137 | Ga0316585_10022885 | Ga0316585_100228851 | 352 |
| 217 | 3300036712 | Ga0316584_0003899 | Ga0316584_0003899_7500_8567 | 352 |
| 218 | 3300037853 | Ga0436364_1192133 | Ga0436364_1192133_203_1282 | 352 |
| 219 | 3300045051 | Ga0451576_0574793 | Ga0451576_0574793_39_1103 | 352 |
| 220 | 3300046558 | Ga0495633_0040626 | Ga0495633_0040626_114_1199 | 352 |
| 221 | 3300049571 | Ga0501034_0087025 | Ga0501034_0087025_514_1578 | 352 |
| 222 | 3300049583 | Ga0501067_0081173 | Ga0501067_0081173_417_1475 | 352 |
| 223 | 3300050507 | nmdc:mga05p37_26387_c1 | nmdc:mga05p37_26387_c1_877_1941 | 352 |
| 224 | 3300050507 | nmdc:mga05p37_402068_c1 | nmdc:mga05p37_402068_c1_189_1280 | 352 |
| 225 | 3300050508 | nmdc:mga09592_251445_c1 | nmdc:mga09592_251445_c1_181_1239 | 352 |
| 226 | 3300050508 | nmdc:mga09592_93072_c1 | nmdc:mga09592_93072_c1_881_1945 | 352 |
| 227 | 3300050509 | nmdc:mga0qj67_351199_c1 | nmdc:mga0qj67_351199_c1_64_1128 | 352 |
| 228 | 3300050510 | nmdc:mga06r32_28104_c1 | nmdc:mga06r32_28104_c1_2149_3213 | 352 |
| 229 | 3300050511 | nmdc:mga08y16_435304_c1 | nmdc:mga08y16_435304_c1_158_1222 | 352 |
| 230 | 3300050511 | nmdc:mga08y16_8464_c1 | nmdc:mga08y16_8464_c1_9270_10331 | 352 |
| 231 | 3300050512 | nmdc:mga0n895_62441_c1 | nmdc:mga0n895_62441_c1_1442_2500 | 352 |
| 232 | 3300059424 | Ga0590075_019483 | Ga0590075_019483_220_1299 | 352 |
| 233 | 3300005336 | Ga0070680_100024169 | Ga0070680_1000241693 | 353 |
| 234 | 3300005366 | Ga0070659_100067025 | Ga0070659_1000670252 | 353 |
| 235 | 3300005436 | Ga0070713_100003083 | Ga0070713_1000030836 | 353 |
| 236 | 3300005439 | Ga0070711_100043021 | Ga0070711_1000430212 | 353 |
| 237 | 3300005439 | Ga0070711_100060435 | Ga0070711_1000604351 | 353 |
| 238 | 3300005530 | Ga0070679_100031022 | Ga0070679_1000310223 | 353 |
| 239 | 3300005530 | Ga0070679_100041246 | Ga0070679_1000412462 | 353 |
| 240 | 3300005563 | Ga0068855_100030220 | Ga0068855_1000302203 | 353 |
| 241 | 3300006237 | Ga0097621_100079361 | Ga0097621_1000793612 | 353 |
| 242 | 3300006358 | Ga0068871_100000783 | Ga0068871_1000007834 | 353 |
| 243 | 3300006846 | Ga0075430_100004088 | Ga0075430_10000408810 | 353 |
| 244 | 3300006871 | Ga0075434_100076267 | Ga0075434_1000762673 | 353 |
| 245 | 3300007076 | Ga0075435_100004177 | Ga0075435_1000041776 | 353 |
| 246 | 3300007076 | Ga0075435_100026553 | Ga0075435_1000265534 | 353 |
| 247 | 3300009093 | Ga0105240_10152563 | Ga0105240_101525632 | 353 |
| 248 | 3300009147 | Ga0114129_10017643 | Ga0114129_100176439 | 353 |
| 249 | 3300009147 | Ga0114129_10078160 | Ga0114129_100781602 | 353 |
| 250 | 3300013296 | Ga0157374_10114787 | Ga0157374_101147872 | 353 |
| 251 | 3300025912 | Ga0207707_10003425 | Ga0207707_100034252 | 353 |
| 252 | 3300025912 | Ga0207707_10217513 | Ga0207707_102175132 | 353 |
| 253 | 3300025913 | Ga0207695_10421356 | Ga0207695_104213561 | 353 |
| 254 | 3300025916 | Ga0207663_10148086 | Ga0207663_101480861 | 353 |
| 255 | 3300025917 | Ga0207660_10057710 | Ga0207660_100577103 | 353 |
| 256 | 3300025919 | Ga0207657_10002155 | Ga0207657_100021556 | 353 |
| 257 | 3300025921 | Ga0207652_10023460 | Ga0207652_100234603 | 353 |
| 258 | 3300025921 | Ga0207652_10029873 | Ga0207652_100298733 | 353 |
| 259 | 3300025928 | Ga0207700_10002471 | Ga0207700_100024718 | 353 |
| 260 | 3300025929 | Ga0207664_10043699 | Ga0207664_100436992 | 353 |
| 261 | 3300025941 | Ga0207711_10240355 | Ga0207711_102403551 | 353 |
| 262 | 3300025949 | Ga0207667_10073149 | Ga0207667_100731492 | 353 |
| 263 | 3300025972 | Ga0207668_10079795 | Ga0207668_100797952 | 353 |
| 264 | 3300034816 | Ga0373930_0000408 | Ga0373930_0000408_1957_3018 | 353 |
| 265 | 3300034820 | Ga0373959_0001589 | Ga0373959_0001589_396_1457 | 353 |
| 266 | 3300034957 | Ga0373938_0003042 | Ga0373938_0003042_194_1255 | 353 |
| 267 | 3300035084 | Ga0373928_0001787 | Ga0373928_0001787_13_1074 | 353 |
| 268 | 3300035085 | Ga0373929_0000136 | Ga0373929_0000136_1236_2297 | 353 |
| 269 | 3300035088 | Ga0373940_0036521 | Ga0373940_0036521_41_1102 | 353 |
| 270 | 3300035090 | Ga0373949_0000556 | Ga0373949_0000556_1015_2076 | 353 |
| 271 | 3300035091 | Ga0373951_0000414 | Ga0373951_0000414_5723_6784 | 353 |
| 272 | 3300035092 | Ga0373952_0000552 | Ga0373952_0000552_477_1538 | 353 |
| 273 | 3300035111 | Ga0373923_0007753 | Ga0373923_0007753_1739_2800 | 353 |
| 274 | 3300035112 | Ga0373932_0001178 | Ga0373932_0001178_3405_4466 | 353 |
| 275 | 3300035114 | Ga0373939_0001051 | Ga0373939_0001051_3211_4272 | 353 |
| 276 | 3300035115 | Ga0373941_0000101 | Ga0373941_0000101_9333_10394 | 353 |
| 277 | 3300035121 | Ga0373960_0000074 | Ga0373960_0000074_10037_11098 | 353 |
| 278 | 3300035171 | Ga0373946_0022181 | Ga0373946_0022181_75_1136 | 353 |
| 279 | 3300035207 | Ga0373942_0001075 | Ga0373942_0001075_3265_4326 | 353 |
| 280 | 3300035242 | Ga0373962_0000481 | Ga0373962_0000481_4338_5399 | 353 |
| 281 | 3300035691 | Ga0373931_0005467 | Ga0373931_0005467_4793_5854 | 353 |
| 282 | 3300036401 | Ga0373937_0291070 | Ga0373937_0291070_225_1286 | 353 |
| 283 | 3300036401 | Ga0373937_0541319 | Ga0373937_0541319_15_1076 | 353 |
| 284 | 3300037068 | Ga0373925_0152778 | Ga0373925_0152778_718_1779 | 353 |
| 285 | 3300045051 | Ga0451576_0034359 | Ga0451576_0034359_752_1813 | 353 |
| 286 | 3300046462 | Ga0495651_0124970 | Ga0495651_0124970_214_1275 | 353 |
| 287 | 3300046511 | Ga0495608_0018934 | Ga0495608_0018934_1493_2554 | 353 |
| 288 | 3300046516 | Ga0495628_0019609 | Ga0495628_0019609_2107_3168 | 353 |
| 289 | 3300046517 | Ga0495630_0027255 | Ga0495630_0027255_2948_4009 | 353 |
| 290 | 3300046529 | Ga0495652_0098550 | Ga0495652_0098550_992_2053 | 353 |
| 291 | 3300046543 | Ga0495645_0027038 | Ga0495645_0027038_1179_2240 | 353 |
| 292 | 3300046683 | Ga0495658_0080451 | Ga0495658_0080451_805_1866 | 353 |
| 293 | 3300046684 | Ga0495669_0003123 | Ga0495669_0003123_4515_5576 | 353 |
| 294 | 3300046689 | Ga0495613_0000819 | Ga0495613_0000819_18465_19526 | 353 |
| 295 | 3300047315 | Ga0495581_0083253 | Ga0495581_0083253_20_1081 | 353 |
| 296 | 3300047317 | Ga0495604_0093513 | Ga0495604_0093513_168_1229 | 353 |
| 297 | 3300047319 | Ga0495674_0029578 | Ga0495674_0029578_2674_3735 | 353 |
| 298 | 3300047471 | Ga0495684_0000235 | Ga0495684_0000235_37210_38271 | 353 |
| 299 | 3300050509 | nmdc:mga0qj67_7086_c1 | nmdc:mga0qj67_7086_c1_6138_7211 | 353 |
| 300 | 3300050512 | nmdc:mga0n895_429752_c1 | nmdc:mga0n895_429752_c1_74_1153 | 353 |
| 301 | 3300050513 | nmdc:mga0rr50_3040_c1 | nmdc:mga0rr50_3040_c1_217_1278 | 353 |
| 302 | 3300053085 | Ga0495619_0012750 | Ga0495619_0012750_1068_2129 | 353 |
| 303 | 3300054114 | Ga0501084_0153141 | Ga0501084_0153141_10_1071 | 353 |
| 304 | 3300005295 | Ga0065707_10139475 | Ga0065707_101394752 | 354 |
| 305 | 3300005331 | Ga0070670_100144624 | Ga0070670_1001446242 | 354 |
| 306 | 3300005347 | Ga0070668_100172302 | Ga0070668_1001723021 | 354 |
| 307 | 3300005353 | Ga0070669_100102603 | Ga0070669_1001026032 | 354 |
| 308 | 3300005353 | Ga0070669_100113772 | Ga0070669_1001137721 | 354 |
| 309 | 3300005354 | Ga0070675_100261034 | Ga0070675_1002610342 | 354 |
| 310 | 3300005356 | Ga0070674_100007855 | Ga0070674_1000078556 | 354 |
| 311 | 3300005364 | Ga0070673_100072485 | Ga0070673_1000724853 | 354 |
| 312 | 3300005365 | Ga0070688_100012507 | Ga0070688_1000125073 | 354 |
| 313 | 3300005543 | Ga0070672_100034136 | Ga0070672_1000341363 | 354 |
| 314 | 3300005548 | Ga0070665_100068411 | Ga0070665_1000684112 | 354 |
| 315 | 3300005617 | Ga0068859_100195728 | Ga0068859_1001957282 | 354 |
| 316 | 3300005718 | Ga0068866_10142717 | Ga0068866_101427172 | 354 |
| 317 | 3300005719 | Ga0068861_100170835 | Ga0068861_1001708351 | 354 |
| 318 | 3300006881 | Ga0068865_100273660 | Ga0068865_1002736601 | 354 |
| 319 | 3300006931 | Ga0097620_100195742 | Ga0097620_1001957422 | 354 |
| 320 | 3300009093 | Ga0105240_10038337 | Ga0105240_100383371 | 354 |
| 321 | 3300009147 | Ga0114129_10065667 | Ga0114129_100656673 | 354 |
| 322 | 3300009148 | Ga0105243_10043479 | Ga0105243_100434792 | 354 |
| 323 | 3300025893 | Ga0207682_10025974 | Ga0207682_100259742 | 354 |
| 324 | 3300025924 | Ga0207694_10250510 | Ga0207694_102505101 | 354 |
| 325 | 3300025925 | Ga0207650_10094649 | Ga0207650_100946492 | 354 |
| 326 | 3300025926 | Ga0207659_10049735 | Ga0207659_100497351 | 354 |
| 327 | 3300025931 | Ga0207644_10200026 | Ga0207644_102000262 | 354 |
| 328 | 3300025931 | Ga0207644_10375369 | Ga0207644_103753691 | 354 |
| 329 | 3300025938 | Ga0207704_10126068 | Ga0207704_101260682 | 354 |
| 330 | 3300025941 | Ga0207711_10151587 | Ga0207711_101515872 | 354 |
| 331 | 3300025960 | Ga0207651_10010138 | Ga0207651_100101382 | 354 |
| 332 | 3300025961 | Ga0207712_10085088 | Ga0207712_100850882 | 354 |
| 333 | 3300026075 | Ga0207708_10340193 | Ga0207708_103401931 | 354 |
| 334 | 3300026118 | Ga0207675_100032309 | Ga0207675_1000323093 | 354 |
| 335 | 3300026121 | Ga0207683_10005688 | Ga0207683_100056889 | 354 |
| 336 | 3300028380 | Ga0268265_10200341 | Ga0268265_102003413 | 354 |
| 337 | 3300035170 | Ga0373943_0006992 | Ga0373943_0006992_3642_4706 | 354 |
| 338 | 3300035172 | Ga0373955_0012864 | Ga0373955_0012864_2835_3899 | 354 |
| 339 | 3300035691 | Ga0373931_0160372 | Ga0373931_0160372_157_1221 | 354 |
| 340 | 3300037068 | Ga0373925_0015408 | Ga0373925_0015408_949_2013 | 354 |
| 341 | 3300046681 | Ga0495647_0086139 | Ga0495647_0086139_135_1199 | 354 |
| 342 | 3300049571 | Ga0501034_0008745 | Ga0501034_0008745_6982_8046 | 354 |
| 343 | 3300049571 | Ga0501034_0400451 | Ga0501034_0400451_199_1266 | 354 |
| 344 | 3300049823 | Ga0501044_0003092 | Ga0501044_0003092_1130_2194 | 354 |
| 345 | 3300050507 | nmdc:mga05p37_19883_c1 | nmdc:mga05p37_19883_c1_486_1553 | 354 |
| 346 | 3300060353 | Ga0501082_0390654 | Ga0501082_0390654_80_1147 | 354 |
| 347 | 3300005331 | Ga0070670_100084745 | Ga0070670_1000847452 | 355 |
| 348 | 3300005364 | Ga0070673_100035710 | Ga0070673_1000357102 | 355 |
| 349 | 3300005459 | Ga0068867_100075302 | Ga0068867_1000753023 | 355 |
| 350 | 3300005467 | Ga0070706_100262354 | Ga0070706_1002623542 | 355 |
| 351 | 3300005468 | Ga0070707_100012798 | Ga0070707_1000127982 | 355 |
| 352 | 3300005471 | Ga0070698_100041328 | Ga0070698_1000413282 | 355 |
| 353 | 3300005518 | Ga0070699_100002075 | Ga0070699_10000207513 | 355 |
| 354 | 3300005536 | Ga0070697_100010004 | Ga0070697_1000100042 | 355 |
| 355 | 3300005548 | Ga0070665_100008321 | Ga0070665_1000083218 | 355 |
| 356 | 3300006237 | Ga0097621_100029383 | Ga0097621_1000293833 | 355 |
| 357 | 3300006237 | Ga0097621_100043790 | Ga0097621_1000437903 | 355 |
| 358 | 3300006358 | Ga0068871_100041050 | Ga0068871_1000410502 | 355 |
| 359 | 3300009176 | Ga0105242_10012615 | Ga0105242_100126152 | 355 |
| 360 | 3300009551 | Ga0105238_10273392 | Ga0105238_102733921 | 355 |
| 361 | 3300013308 | Ga0157375_10231152 | Ga0157375_102311522 | 355 |
| 362 | 3300014325 | Ga0163163_10020580 | Ga0163163_100205802 | 355 |
| 363 | 3300025899 | Ga0207642_10038537 | Ga0207642_100385372 | 355 |
| 364 | 3300025910 | Ga0207684_10002038 | Ga0207684_100020387 | 355 |
| 365 | 3300025912 | Ga0207707_10256134 | Ga0207707_102561341 | 355 |
| 366 | 3300025917 | Ga0207660_10018548 | Ga0207660_100185486 | 355 |
| 367 | 3300025922 | Ga0207646_10000810 | Ga0207646_100008106 | 355 |
| 368 | 3300025925 | Ga0207650_10085091 | Ga0207650_100850912 | 355 |
| 369 | 3300025934 | Ga0207686_10105538 | Ga0207686_101055382 | 355 |
| 370 | 3300025938 | Ga0207704_10110860 | Ga0207704_101108602 | 355 |
| 371 | 3300025941 | Ga0207711_10044590 | Ga0207711_100445903 | 355 |
| 372 | 3300025942 | Ga0207689_10036500 | Ga0207689_100365002 | 355 |
| 373 | 3300025945 | Ga0207679_10332049 | Ga0207679_103320492 | 355 |
| 374 | 3300026089 | Ga0207648_10013380 | Ga0207648_100133803 | 355 |
| 375 | 3300028381 | Ga0268264_10291863 | Ga0268264_102918631 | 355 |
| 376 | 3300035171 | Ga0373946_0015547 | Ga0373946_0015547_1534_2601 | 355 |
| 377 | 3300039062 | Ga0400483_265560 | Ga0400483_265560_3369_4436 | 355 |
| 378 | 3300042156 | Ga0439446_0001704 | Ga0439446_0001704_2794_3873 | 355 |
| 379 | 3300048915 | Ga0496112_0327583 | Ga0496112_0327583_241_1308 | 355 |
| 380 | 3300049587 | Ga0501071_0189065 | Ga0501071_0189065_39_1112 | 355 |
| 381 | 3300049589 | Ga0501073_0233992 | Ga0501073_0233992_36_1103 | 355 |
| 382 | 3300049592 | Ga0501076_0140707 | Ga0501076_0140707_175_1248 | 355 |
| 383 | 3300053103 | Ga0500555_000258 | Ga0500555_000258_21262_22347 | 355 |
| 384 | 3300053153 | Ga0500616_0001849 | Ga0500616_0001849_2891_3976 | 355 |
| 385 | 3300053730 | Ga0500645_000060 | Ga0500645_000060_57265_58350 | 355 |
| 386 | 3300054114 | Ga0501084_0011682 | Ga0501084_0011682_3079_4152 | 355 |
| 387 | 3300046459 | Ga0495629_0130665 | Ga0495629_0130665_363_1478 | 357 |
| 388 | 3300046683 | Ga0495658_0151810 | Ga0495658_0151810_154_1269 | 357 |
| 389 | 3300014326 | Ga0157380_10106166 | Ga0157380_101061662 | 358 |
| 390 | 3300005458 | Ga0070681_10009756 | Ga0070681_100097562 | 359 |
| 391 | 3300006914 | Ga0075436_100003144 | Ga0075436_1000031441 | 359 |
| 392 | 3300007076 | Ga0075435_100003305 | Ga0075435_1000033051 | 359 |
| 393 | 3300050512 | nmdc:mga0n895_10_c1 | nmdc:mga0n895_10_c1_88130_89230 | 359 |
| 394 | 3300050513 | nmdc:mga0rr50_20_c1 | nmdc:mga0rr50_20_c1_139561_140661 | 359 |
| 395 | 3300050514 | nmdc:mga08x19_2537_c1 | nmdc:mga08x19_2537_c1_139_1239 | 359 |
| 396 | 3300002459 | JGI24751J29686_10009533 | JGI24751J29686_100095332 | 361 |
| 397 | 3300005290 | Ga0065712_10070543 | Ga0065712_100705435 | 361 |
| 398 | 3300005293 | Ga0065715_10177011 | Ga0065715_101770112 | 361 |
| 399 | 3300005617 | Ga0068859_100350496 | Ga0068859_1003504962 | 361 |
| 400 | 3300005843 | Ga0068860_100183405 | Ga0068860_1001834052 | 361 |
| 401 | 3300006931 | Ga0097620_100350471 | Ga0097620_1003504712 | 361 |
| 402 | 3300025972 | Ga0207668_10234014 | Ga0207668_102340142 | 361 |
| 403 | 3300028381 | Ga0268264_10253169 | Ga0268264_102531692 | 361 |
| 404 | 3300048912 | Ga0496109_0195592 | Ga0496109_0195592_569_1654 | 361 |
| 405 | 3300048913 | Ga0496110_0031725 | Ga0496110_0031725_1639_2724 | 361 |
| 406 | 3300050514 | nmdc:mga08x19_43868_c1 | nmdc:mga08x19_43868_c1_668_1780 | 361 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fmx-assembly1.cif.gz_X | crystal structure of tartrate dehydrogenase from pseudomonas putida complexed with nadh | 0.9533 | 13 | 360 |
| 2g4o-assembly1.cif.gz_A | anomalous substructure of 3-isopropylmalate dehydrogenase | 0.9384 | 13 | 361 |
| 2g4o-assembly1.cif.gz_A | anomalous substructure of 3-isopropylmalate dehydrogenase | 0.933 | 13 | 361 |
| 6lky-assembly1.cif.gz_B | crystal structure of isocitrate dehydrogenase from methylococcus capsulatus | 0.9297 | 13 | 360 |
| 6xxy-assembly1.cif.gz_B | crystal structure of haemophilus influenzae 3-isopropylmalate dehydrogenase in complex with o-isobutenyl oxalylhydroxamate. | 0.9245 | 11 | 361 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76251_1_360_3.40.718.10 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.964 | 11 | 360 | 3.40.718.10 |
| 1w0dB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9425 | 13 | 361 | 3.40.718.10 |
| 1w0dB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9371 | 13 | 361 | 3.40.718.10 |
| af_P76251_1_360_3.40.718.10 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9353 | 11 | 360 | 3.40.718.10 |
| 5hn5A00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9264 | 13 | 360 | 3.40.718.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382X5Y5-F1-model_v4 | Isopropylmalate dehydrogenase-like domain-containing protein | 0.9765 | 12 | 109 |
|
| AF-A0A3B9S1N1-F1-model_v4 | Tartrate dehydrogenase | 0.975 | 11 | 181 |
|
| AF-A0A7Z9UXS5-F1-model_v4 | Tartrate dehydrogenase | 0.9748 | 10 | 107 |
|
| AF-A0A3D5FWU8-F1-model_v4 | deleted | 0.9724 | 12 | 110 |
|
| AF-A0A3N5YZP0-F1-model_v4 | D-malate dehydrogenase (decarboxylating) (EC 1.1.1.83) | 0.972 | 26 | 360 |
GO:0000287
GO:0046553 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar