F436186

General Info

Members Datasets Scaffolds Average Seq Length
406 235 405 266

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10007260|Ga0114129_100072604
Length 298
Sequence VGTTPKARLIRRFHDCQTSAETLQSNLDGIEPTCKENTMTTVEADRALKAKHRALWASGDYPAVAAELIAALGPELVRAIGVKSGDRVLDVAAGSGNAAIPAAAAGGIVTASDLTPELFDAGRQIAAERGVELEWVEADAEAMPFADNSFDAVISCVGVMFAPHHQAAADELVRVVRTGGTIGLINWTPEGLIGNLLATMKPYALWGNEDHVRQLFGERVTGLTARRQTVRMDHCADPLEFREYWKRNYGPTIAAYRFNQDQPERVAALDRDFLAFLTESQRGDGWDAEYLLVTATKR

Samples

Sample ID Description Type Environment
1 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
171 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
172 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
175 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
176 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
177 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
178 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
179 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
180 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
181 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
182 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
233 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
234 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.25
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.67
Nodule 0
Rhizoplane 9.11
Rhizosphere 83.74
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1006224 3300001977 Bacteria 1853
2 JGI24738J21930_10012369 3300002075 Bacteria 1865
3 JGI24034J26672_10001829 3300002239 Bacteria 2866
4 JGI24742J22300_10008545 3300002244 Bacteria 1689
5 Ga0006562J51391_1052019 3300003578 Bacteria 2390
6 Ga0070676_10185450 3300005328 Bacteria 1355
7 Ga0070683_100211459 3300005329 Bacteria 1842
8 Ga0068869_100034883 3300005334 Bacteria 3562
9 Ga0068869_100095016 3300005334 Bacteria 2248
10 Ga0068869_100347479 3300005334 Bacteria 1208
11 Ga0070666_10005662 3300005335 Bacteria 7669
12 Ga0070680_100244133 3300005336 Bacteria 1518
13 Ga0070680_100419797 3300005336 Bacteria 1141
14 Ga0070682_100038847 3300005337 Bacteria 2921
15 Ga0070682_100153915 3300005337 Bacteria 1581
16 Ga0068868_100000265 3300005338 Bacteria 35343
17 Ga0068868_100011680 3300005338 Bacteria 6396
18 Ga0068868_100131678 3300005338 Bacteria 2047
19 Ga0070660_100134844 3300005339 Bacteria 1978
20 Ga0070689_100059988 3300005340 Bacteria 2957
21 Ga0070689_100209558 3300005340 Bacteria 1594
22 Ga0070691_10004731 3300005341 Bacteria 6194
23 Ga0070691_10092072 3300005341 Bacteria 1496
24 Ga0070687_100143129 3300005343 Bacteria 1395
25 Ga0070687_100321932 3300005343 Bacteria 988
26 Ga0070661_100037253 3300005344 Bacteria 3537
27 Ga0070661_100073718 3300005344 Bacteria 2513
28 Ga0070692_10014647 3300005345 Bacteria 3690
29 Ga0070668_100000135 3300005347 Bacteria 46315
30 Ga0070668_100001311 3300005347 Bacteria 17811
31 Ga0070668_100006216 3300005347 Bacteria 8847
32 Ga0070668_100025280 3300005347 Bacteria 4501
33 Ga0070668_100282013 3300005347 Bacteria 1388
34 Ga0070669_100016940 3300005353 Bacteria 5203
35 Ga0070675_100589565 3300005354 Bacteria 1008
36 Ga0070674_100002076 3300005356 Bacteria 10971
37 Ga0070674_100035308 3300005356 Bacteria 3347
38 Ga0070673_100112499 3300005364 Bacteria 2260
39 Ga0070659_100055325 3300005366 Bacteria 3126
40 Ga0070659_100061127 3300005366 Bacteria 2977
41 Ga0070659_100102175 3300005366 Bacteria 2308
42 Ga0070667_100000598 3300005367 Bacteria 35201
43 Ga0070667_100057982 3300005367 Bacteria 3274
44 Ga0070709_10008111 3300005434 Bacteria 5764
45 Ga0070709_10244956 3300005434 Bacteria 1289
46 Ga0070714_100069130 3300005435 Bacteria 3049
47 Ga0070710_10000363 3300005437 Bacteria 21338
48 Ga0070710_10002347 3300005437 Bacteria 8956
49 Ga0070701_10001855 3300005438 Bacteria 8014
50 Ga0070711_100000211 3300005439 Bacteria 30817
51 Ga0070711_100002072 3300005439 Bacteria 11319
52 Ga0070705_100059622 3300005440 Bacteria 2260
53 Ga0070700_100002877 3300005441 Bacteria 8844
54 Ga0070700_100066027 3300005441 Bacteria 2295
55 Ga0070700_100072524 3300005441 Bacteria 2201
56 Ga0070694_100118845 3300005444 Bacteria 1894
57 Ga0070663_100002830 3300005455 Bacteria 9854
58 Ga0070663_100005482 3300005455 Bacteria 7542
59 Ga0070663_100026072 3300005455 Bacteria 3955
60 Ga0070663_100468546 3300005455 Bacteria 1041
61 Ga0070678_100013469 3300005456 Bacteria 5128
62 Ga0070678_100024907 3300005456 Bacteria 4015
63 Ga0070662_100082120 3300005457 Bacteria 2402
64 Ga0070662_100146829 3300005457 Bacteria 1832
65 Ga0068867_100001676 3300005459 Bacteria 15435
66 Ga0068867_100137036 3300005459 Bacteria 1909
67 Ga0068853_100011257 3300005539 Bacteria 7261
68 Ga0070672_100069501 3300005543 Bacteria 2796
69 Ga0070686_100110360 3300005544 Bacteria 1873
70 Ga0070695_100005767 3300005545 Bacteria 7295
71 Ga0070696_100008236 3300005546 Bacteria 6977
72 Ga0070696_100064708 3300005546 Bacteria 2562
73 Ga0070693_100045307 3300005547 Bacteria 2492
74 Ga0070665_100050768 3300005548 Bacteria 4163
75 Ga0070665_100187800 3300005548 Bacteria 2067
76 Ga0070704_100002418 3300005549 Bacteria 10482
77 Ga0070704_100029570 3300005549 Bacteria 3660
78 Ga0068855_100083338 3300005563 Bacteria 3704
79 Ga0070664_100038748 3300005564 Bacteria 4013
80 Ga0068857_100251477 3300005577 Bacteria 1620
81 Ga0068854_100000759 3300005578 Bacteria 19146
82 Ga0068854_100103921 3300005578 Bacteria 2133
83 Ga0068856_100255571 3300005614 Bacteria 1767
84 Ga0070702_100001149 3300005615 Bacteria 10647
85 Ga0070702_100024059 3300005615 Bacteria 3244
86 Ga0068852_100022727 3300005616 Bacteria 5034
87 Ga0068852_100182574 3300005616 Bacteria 1974
88 Ga0068852_100867396 3300005616 Bacteria 919
89 Ga0068859_100000995 3300005617 Bacteria 29017
90 Ga0068859_100097166 3300005617 Bacteria 2998
91 Ga0068859_100206503 3300005617 Bacteria 2049
92 Ga0068864_100115086 3300005618 Bacteria 2398
93 Ga0068864_100361477 3300005618 Bacteria 1372
94 Ga0068864_100393159 3300005618 Bacteria 1316
95 Ga0068866_10000103 3300005718 Bacteria 36199
96 Ga0068866_10034986 3300005718 Bacteria 2450
97 Ga0068861_100000166 3300005719 Bacteria 34780
98 Ga0068861_100086783 3300005719 Bacteria 2461
99 Ga0068861_100133546 3300005719 Bacteria 2017
100 Ga0068861_100297011 3300005719 Bacteria 1397
101 Ga0068861_100443067 3300005719 Bacteria 1162
102 Ga0068858_100007032 3300005842 Bacteria 10932
103 Ga0068858_100016466 3300005842 Bacteria 6941
104 Ga0068860_100005999 3300005843 Bacteria 12227
105 Ga0068860_100816144 3300005843 Bacteria 946
106 Ga0068862_100002488 3300005844 Bacteria 16304
107 Ga0068862_100063572 3300005844 Bacteria 3176
108 Ga0081455_10034137 3300005937 Bacteria 4561
109 Ga0075365_10057609 3300006038 Bacteria 2585
110 Ga0075363_100003724 3300006048 Bacteria 6556
111 Ga0075363_100005658 3300006048 Bacteria 5593
112 Ga0075364_10003110 3300006051 Bacteria 9390
113 Ga0070715_10001324 3300006163 Bacteria 7141
114 Ga0070716_100001550 3300006173 Bacteria 10312
115 Ga0070716_100003938 3300006173 Bacteria 7045
116 Ga0070712_100000214 3300006175 Bacteria 32534
117 Ga0075362_10041675 3300006177 Bacteria 2026
118 Ga0075367_10136294 3300006178 Bacteria 1519
119 Ga0097621_100035884 3300006237 Bacteria 3963
120 Ga0097621_100069391 3300006237 Bacteria 2910
121 Ga0075370_10003127 3300006353 Bacteria 7816
122 Ga0075370_10003922 3300006353 Bacteria 7142
123 Ga0075370_10006480 3300006353 Bacteria 5892
124 Ga0075370_10056944 3300006353 Bacteria 2221
125 Ga0075370_10058905 3300006353 Bacteria 2185
126 Ga0068871_100108713 3300006358 Bacteria 2331
127 Ga0075428_100002717 3300006844 Bacteria 19259
128 Ga0075429_100325062 3300006880 Bacteria 1346
129 Ga0068865_100000672 3300006881 Bacteria 19284
130 Ga0068865_100118213 3300006881 Bacteria 1966
131 Ga0075436_100070836 3300006914 Bacteria 2410
132 Ga0097620_100000995 3300006931 Bacteria 29017
133 Ga0097620_100097172 3300006931 Bacteria 2998
134 Ga0097620_100206506 3300006931 Bacteria 2049
135 Ga0105245_10019369 3300009098 Bacteria 5959
136 Ga0105245_10133820 3300009098 Bacteria 2328
137 Ga0105245_10241776 3300009098 Bacteria 1750
138 Ga0105247_10000279 3300009101 Bacteria 46962
139 Ga0105247_10005951 3300009101 Bacteria 7605
140 Ga0114129_10007260 3300009147 Bacteria 15775
141 Ga0105243_10002691 3300009148 Bacteria 14766
142 Ga0105243_10007046 3300009148 Bacteria 8650
143 Ga0105243_10025148 3300009148 Bacteria 4547
144 Ga0105243_10131536 3300009148 Bacteria 2123
145 Ga0105243_10311154 3300009148 Bacteria 1431
146 Ga0105241_10123340 3300009174 Bacteria 2089
147 Ga0105242_10000551 3300009176 Bacteria 29661
148 Ga0105242_10087347 3300009176 Bacteria 2618
149 Ga0105242_10214387 3300009176 Bacteria 1717
150 Ga0105248_10017005 3300009177 Bacteria 8010
151 Ga0105237_10049408 3300009545 Bacteria 4228
152 Ga0105237_10102736 3300009545 Bacteria 2850
153 Ga0105238_10519097 3300009551 Bacteria 1194
154 Ga0105238_10522953 3300009551 Bacteria 1189
155 Ga0105249_10002292 3300009553 Bacteria 16622
156 Ga0105239_10004339 3300010375 Bacteria 16991
157 Ga0105239_10062682 3300010375 Bacteria 4081
158 Ga0105246_10009201 3300011119 Bacteria 6082
159 Ga0157371_10066988 3300013102 Bacteria 2542
160 Ga0157374_10008517 3300013296 Bacteria 8774
161 Ga0157374_10090885 3300013296 Bacteria 2911
162 Ga0157378_10000675 3300013297 Bacteria 32100
163 Ga0163162_10007269 3300013306 Bacteria 10756
164 Ga0163162_10155899 3300013306 Bacteria 2403
165 Ga0163162_10343467 3300013306 Bacteria 1625
166 Ga0157372_10015788 3300013307 Bacteria 8101
167 Ga0157372_10141641 3300013307 Bacteria 2771
168 Ga0157375_10002974 3300013308 Bacteria 14731
169 Ga0157375_10206026 3300013308 Bacteria 2123
170 Ga0163163_10035304 3300014325 Bacteria 4849
171 Ga0163163_10296155 3300014325 Bacteria 1670
172 Ga0157380_10003537 3300014326 Bacteria 10740
173 Ga0157380_10011514 3300014326 Bacteria 6393
174 Ga0157380_10074657 3300014326 Bacteria 2753
175 Ga0157380_10570466 3300014326 Bacteria 1114
176 Ga0157379_10000781 3300014968 Bacteria 25849
177 Ga0157379_10021168 3300014968 Bacteria 5755
178 Ga0157376_10056195 3300014969 Bacteria 3287
179 Ga0157376_10313825 3300014969 Bacteria 1488
180 Ga0163161_10001407 3300017792 Bacteria 17777
181 Ga0163161_10031233 3300017792 Bacteria 3794
182 Ga0207692_10000585 3300025898 Bacteria 12924
183 Ga0207692_10045352 3300025898 Bacteria 2198
184 Ga0207710_10004251 3300025900 Bacteria 6279
185 Ga0207710_10011537 3300025900 Bacteria 3719
186 Ga0207688_10000373 3300025901 Bacteria 20896
187 Ga0207688_10000462 3300025901 Bacteria 19372
188 Ga0207688_10006156 3300025901 Bacteria 6530
189 Ga0207647_10007841 3300025904 Bacteria 7683
190 Ga0207685_10001136 3300025905 Bacteria 5313
191 Ga0207685_10013669 3300025905 Bacteria 2518
192 Ga0207699_10017258 3300025906 Bacteria 3794
193 Ga0207645_10006630 3300025907 Bacteria 8273
194 Ga0207645_10030420 3300025907 Bacteria 3478
195 Ga0207705_10317265 3300025909 Bacteria 1197
196 Ga0207671_10294918 3300025914 Bacteria 1281
197 Ga0207693_10000320 3300025915 Bacteria 44589
198 Ga0207693_10001428 3300025915 Bacteria 21168
199 Ga0207663_10010055 3300025916 Bacteria 5017
200 Ga0207663_10022458 3300025916 Bacteria 3606
201 Ga0207662_10039946 3300025918 Bacteria 2755
202 Ga0207662_10080467 3300025918 Bacteria 1987
203 Ga0207662_10161626 3300025918 Bacteria 1431
204 Ga0207657_10016654 3300025919 Bacteria 7083
205 Ga0207657_10110623 3300025919 Bacteria 2269
206 Ga0207657_10148861 3300025919 Bacteria 1908
207 Ga0207657_10339029 3300025919 Bacteria 1187
208 Ga0207649_10042695 3300025920 Bacteria 2767
209 Ga0207681_10041172 3300025923 Bacteria 3079
210 Ga0207681_10043852 3300025923 Bacteria 2995
211 Ga0207650_10228079 3300025925 Bacteria 1501
212 Ga0207687_10046601 3300025927 Bacteria 3002
213 Ga0207687_10067202 3300025927 Bacteria 2549
214 Ga0207664_10088133 3300025929 Bacteria 2539
215 Ga0207690_10633015 3300025932 Bacteria 875
216 Ga0207706_10002248 3300025933 Bacteria 18846
217 Ga0207706_10018768 3300025933 Bacteria 6221
218 Ga0207706_10141237 3300025933 Bacteria 2119
219 Ga0207686_10004043 3300025934 Bacteria 7871
220 Ga0207709_10000847 3300025935 Bacteria 23436
221 Ga0207709_10005111 3300025935 Bacteria 7487
222 Ga0207709_10041139 3300025935 Bacteria 2772
223 Ga0207709_10493010 3300025935 Bacteria 955
224 Ga0207669_10000415 3300025937 Bacteria 18644
225 Ga0207704_10001734 3300025938 Bacteria 9768
226 Ga0207704_10145272 3300025938 Bacteria 1665
227 Ga0207665_10004881 3300025939 Bacteria 8932
228 Ga0207665_10011581 3300025939 Bacteria 5794
229 Ga0207691_10060056 3300025940 Bacteria 3456
230 Ga0207691_10094757 3300025940 Bacteria 2671
231 Ga0207711_10025825 3300025941 Bacteria 4926
232 Ga0207689_10013030 3300025942 Bacteria 7101
233 Ga0207689_10039005 3300025942 Bacteria 3933
234 Ga0207661_10025346 3300025944 Bacteria 4505
235 Ga0207679_10408654 3300025945 Bacteria 1195
236 Ga0207667_10283732 3300025949 Bacteria 1692
237 Ga0207712_10011563 3300025961 Bacteria 5627
238 Ga0207712_10043739 3300025961 Bacteria 3091
239 Ga0207668_10001507 3300025972 Bacteria 13605
240 Ga0207668_10066434 3300025972 Bacteria 2556
241 Ga0207668_10194091 3300025972 Bacteria 1612
242 Ga0207640_10104352 3300025981 Bacteria 1995
243 Ga0207658_10008270 3300025986 Bacteria 7087
244 Ga0207677_10001154 3300026023 Bacteria 14427
245 Ga0207677_10527602 3300026023 Bacteria 1025
246 Ga0207703_10054377 3300026035 Bacteria 3255
247 Ga0207703_10091869 3300026035 Bacteria 2554
248 Ga0207703_10297715 3300026035 Bacteria 1470
249 Ga0207639_10085012 3300026041 Bacteria 2515
250 Ga0207678_10005497 3300026067 Bacteria 11325
251 Ga0207678_10113249 3300026067 Bacteria 2314
252 Ga0207708_10006801 3300026075 Bacteria 8458
253 Ga0207708_10021675 3300026075 Bacteria 4846
254 Ga0207708_10091546 3300026075 Bacteria 2345
255 Ga0207702_10250253 3300026078 Bacteria 1664
256 Ga0207641_10192383 3300026088 Bacteria 1876
257 Ga0207648_10000451 3300026089 Bacteria 45574
258 Ga0207648_10062672 3300026089 Bacteria 3241
259 Ga0207676_10175007 3300026095 Bacteria 1873
260 Ga0207676_10340958 3300026095 Bacteria 1383
261 Ga0207674_10030169 3300026116 Bacteria 5704
262 Ga0207674_10161084 3300026116 Bacteria 2198
263 Ga0207675_100000675 3300026118 Bacteria 33655
264 Ga0207675_100065912 3300026118 Bacteria 3384
265 Ga0207675_100177904 3300026118 Bacteria 2036
266 Ga0207683_10000665 3300026121 Bacteria 31567
267 Ga0207698_10136542 3300026142 Bacteria 2105
268 Ga0268266_10097528 3300028379 Bacteria 2585
269 Ga0268266_10127164 3300028379 Bacteria 2275
270 Ga0268265_10023821 3300028380 Bacteria 4321
271 Ga0268265_10048416 3300028380 Bacteria 3191
272 Ga0268265_10119488 3300028380 Bacteria 2168
273 Ga0268264_10009940 3300028381 Bacteria 7877
274 Ga0307513_10023143 3300031456 Bacteria 7269
275 Ga0307408_100048510 3300031548 Bacteria 3046
276 Ga0307408_100065338 3300031548 Bacteria 2668
277 Ga0307405_10335492 3300031731 Bacteria 1160
278 Ga0307413_10030548 3300031824 Bacteria 3028
279 Ga0307410_10034455 3300031852 Bacteria 3279
280 Ga0307410_10044113 3300031852 Bacteria 2960
281 Ga0307410_10049601 3300031852 Bacteria 2819
282 Ga0307410_10128250 3300031852 Bacteria 1860
283 Ga0307406_10069778 3300031901 Bacteria 2299
284 Ga0307406_10100195 3300031901 Bacteria 1971
285 Ga0307406_10493489 3300031901 Bacteria 991
286 Ga0307407_10039888 3300031903 Bacteria 2614
287 Ga0307407_10041410 3300031903 Bacteria 2576
288 Ga0307412_10178084 3300031911 Bacteria 1596
289 Ga0307412_10248343 3300031911 Bacteria 1380
290 Ga0307409_100017338 3300031995 Bacteria 4796
291 Ga0307409_100195846 3300031995 Bacteria 1803
292 Ga0307409_100224233 3300031995 Bacteria 1699
293 Ga0307409_100398604 3300031995 Bacteria 1314
294 Ga0307416_100089182 3300032002 Bacteria 2639
295 Ga0307416_100093365 3300032002 Bacteria 2592
296 Ga0307416_100388083 3300032002 Bacteria 1429
297 Ga0307411_10058779 3300032005 Bacteria 2546
298 Ga0307415_100012645 3300032126 Bacteria 4889
299 Ga0373959_0020844 3300034820 Bacteria 1254
300 Ga0373932_0056957 3300035112 Bacteria 1177
301 Ga0373931_0036071 3300035691 Bacteria 2575
302 Ga0395898_0079283 3300037466 Bacteria 3168
303 Ga0395905_0545297 3300037471 Bacteria 1061
304 Ga0395901_0033764 3300038443 Bacteria 5283
305 Ga0395901_0268350 3300038443 Bacteria 1775
306 Ga0439436_0001328 3300041404 Bacteria 7100
307 Ga0439436_0002318 3300041404 Bacteria 5706
308 Ga0439439_0004162 3300041406 Bacteria 3240
309 Ga0439466_0004145 3300041411 Bacteria 5600
310 Ga0439465_0000232 3300041413 Bacteria 15118
311 Ga0439433_0001248 3300041999 Bacteria 5245
312 Ga0439433_0004257 3300041999 Bacteria 3075
313 Ga0439442_011160 3300042002 Bacteria 1826
314 Ga0439449_0012247 3300042007 Bacteria 3223
315 Ga0439457_000494 3300042014 Bacteria 11413
316 Ga0439462_0015694 3300042015 Bacteria 1953
317 Ga0450920_002837 3300042122 Bacteria 2978
318 Ga0450907_009900 3300042146 Bacteria 1580
319 Ga0439434_0018523 3300042435 Bacteria 2085
320 Ga0450918_007770 3300042531 Bacteria 1890
321 Ga0466972_0045486 3300044658 Bacteria 2127
322 Ga0466965_0006924 3300044683 Bacteria 5187
323 Ga0466963_0049092 3300044694 Bacteria 2790
324 Ga0466968_0035061 3300044735 Bacteria 2098
325 Ga0466970_0002435 3300044765 Bacteria 8991
326 Ga0466957_0005197 3300044842 Bacteria 7280
327 Ga0466958_0015523 3300045836 Bacteria 4366
328 Ga0466967_0099958 3300045976 Bacteria 2650
329 Ga0466967_0186015 3300045976 Bacteria 1961
330 Ga0466967_0380737 3300045976 Bacteria 1370
331 Ga0495653_0153238 3300046463 Bacteria 1608
332 Ga0495680_0102246 3300047322 Bacteria 2134
333 Ga0496100_0003360 3300048903 Bacteria 8330
334 Ga0496101_0003844 3300048904 Bacteria 9389
335 Ga0496101_0029499 3300048904 Bacteria 3837
336 Ga0496101_0172589 3300048904 Bacteria 1662
337 Ga0496102_0034243 3300048905 Bacteria 4567
338 Ga0496102_0034939 3300048905 Bacteria 4524
339 Ga0496103_0000325 3300048906 Bacteria 43734
340 Ga0496103_0078879 3300048906 Bacteria 2068
341 Ga0496104_0010014 3300048907 Bacteria 8461
342 Ga0496104_0049970 3300048907 Bacteria 3945
343 Ga0496104_0082036 3300048907 Bacteria 3075
344 Ga0496104_0568820 3300048907 Bacteria 1044
345 Ga0496105_0009916 3300048908 Bacteria 7471
346 Ga0496105_0095135 3300048908 Bacteria 2460
347 Ga0496105_0099961 3300048908 Bacteria 2396
348 Ga0496106_0001168 3300048909 Bacteria 19521
349 Ga0496107_0015680 3300048910 Bacteria 5312
350 Ga0496107_0039223 3300048910 Bacteria 3397
351 Ga0496107_0081152 3300048910 Bacteria 2365
352 Ga0496108_0000188 3300048911 Bacteria 57492
353 Ga0496108_0109096 3300048911 Bacteria 2365
354 Ga0496108_0327042 3300048911 Bacteria 1337
355 Ga0496108_0665284 3300048911 Bacteria 905
356 Ga0496109_0009871 3300048912 Bacteria 8149
357 Ga0496110_0136722 3300048913 Bacteria 2215
358 Ga0496110_0143836 3300048913 Bacteria 2156
359 Ga0496112_0009288 3300048915 Bacteria 8842
360 Ga0496112_0309114 3300048915 Bacteria 1526
361 Ga0496113_0012496 3300048916 Bacteria 5709
362 Ga0496113_0320814 3300048916 Bacteria 1242
363 Ga0496113_0368515 3300048916 Bacteria 1153
364 Ga0496114_0001466 3300048917 Bacteria 17949
365 Ga0496114_0003882 3300048917 Bacteria 11521
366 Ga0496114_0270479 3300048917 Bacteria 1497
367 Ga0496114_0304080 3300048917 Bacteria 1408
368 Ga0496114_0323410 3300048917 Bacteria 1363
369 Ga0496115_0002019 3300048918 Bacteria 14508
370 Ga0496122_0000620 3300048925 Bacteria 72751
371 Ga0496123_0000142 3300048926 Bacteria 146932
372 Ga0496124_0000461 3300048927 Bacteria 70566
373 Ga0501039_0114912 3300049575 Bacteria 2106
374 Ga0501040_0025827 3300049576 Bacteria 3951
375 Ga0501041_0022971 3300049577 Bacteria 3737
376 Ga0501042_0006982 3300049578 Bacteria 7370
377 Ga0501042_0053691 3300049578 Bacteria 2875
378 Ga0501048_0020440 3300049582 Bacteria 4852
379 Ga0501069_0031213 3300049585 Bacteria 2929
380 Ga0501071_0005281 3300049587 Bacteria 8285
381 Ga0501071_0058946 3300049587 Bacteria 2777
382 Ga0501072_0054054 3300049588 Bacteria 3163
383 Ga0501072_0160762 3300049588 Bacteria 1792
384 Ga0501074_0117858 3300049590 Bacteria 1899
385 Ga0501075_0026830 3300049591 Bacteria 4243
386 Ga0501035_0032895 3300049822 Bacteria 4716
387 Ga0501045_0075361 3300049824 Bacteria 2485
388 nmdc:mga03683_3606_c1 3300050489 Bacteria 5023
389 nmdc:mga03n38_114085_c1 3300050490 Bacteria 1320
390 nmdc:mga03n38_9745_c1 3300050490 Bacteria 3505
391 nmdc:mga0yw44_157753_c1 3300050492 Bacteria 1484
392 nmdc:mga0yw44_159049_c1 3300050492 Bacteria 1478
393 nmdc:mga07m45_126704_c1 3300050496 Bacteria 1477
394 nmdc:mga07m45_25860_c2 3300050496 Bacteria 2013
395 nmdc:mga07m45_27240_c1 3300050496 Bacteria 3147
396 nmdc:mga05p37_15076_c1 3300050507 Bacteria 9280
397 nmdc:mga09592_294774_c1 3300050508 Bacteria 1406
398 nmdc:mga06r32_5161_c1 3300050510 Bacteria 11734
399 nmdc:mga08y16_95453_c1 3300050511 Bacteria 3097
400 nmdc:mga0rr50_224749_c1 3300050513 Bacteria 1551
401 nmdc:mga0sz30_189652_c1 3300050516 Bacteria 912
402 Ga0500644_0000400 3300053088 Bacteria 20643
403 Ga0500616_0002550 3300053153 Bacteria 15012
404 Ga0500616_0003900 3300053153 Bacteria 10973
405 Ga0501082_0132969 3300060353 Bacteria 2158

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100048510 Ga0307408_1000485102 226
2 3300031852 Ga0307410_10034455 Ga0307410_100344551 226
3 3300031903 Ga0307407_10039888 Ga0307407_100398882 226
4 3300031995 Ga0307409_100224233 Ga0307409_1002242332 226
5 3300032002 Ga0307416_100093365 Ga0307416_1000933654 226
6 3300041404 Ga0439436_0002318 Ga0439436_0002318_4694_5539 226
7 3300041999 Ga0439433_0004257 Ga0439433_0004257_892_1740 226
8 3300031548 Ga0307408_100065338 Ga0307408_1000653382 227
9 3300031911 Ga0307412_10178084 Ga0307412_101780841 227
10 3300009148 Ga0105243_10311154 Ga0105243_103111541 231
11 3300050496 nmdc:mga07m45_126704_c1 nmdc:mga07m45_126704_c1_662_1429 231
12 3300042122 Ga0450920_002837 Ga0450920_002837_337_1182 232
13 3300042531 Ga0450918_007770 Ga0450918_007770_587_1432 232
14 3300048925 Ga0496122_0000620 Ga0496122_0000620_37627_38493 233
15 3300048926 Ga0496123_0000142 Ga0496123_0000142_24282_25148 233
16 3300048927 Ga0496124_0000461 Ga0496124_0000461_9004_9870 233
17 3300006914 Ga0075436_100070836 Ga0075436_1000708362 234
18 3300048911 Ga0496108_0665284 Ga0496108_0665284_120_887 237
19 3300005577 Ga0068857_100251477 Ga0068857_1002514772 242
20 3300005618 Ga0068864_100361477 Ga0068864_1003614772 242
21 3300006353 Ga0075370_10058905 Ga0075370_100589052 242
22 3300014325 Ga0163163_10035304 Ga0163163_100353042 242
23 3300025944 Ga0207661_10025346 Ga0207661_100253463 242
24 3300026095 Ga0207676_10340958 Ga0207676_103409582 242
25 3300026116 Ga0207674_10030169 Ga0207674_100301693 242
26 3300031852 Ga0307410_10128250 Ga0307410_101282502 243
27 3300048911 Ga0496108_0109096 Ga0496108_0109096_705_1559 243
28 3300048915 Ga0496112_0309114 Ga0496112_0309114_444_1265 243
29 3300005344 Ga0070661_100037253 Ga0070661_1000372533 244
30 3300025920 Ga0207649_10042695 Ga0207649_100426952 244
31 3300038443 Ga0395901_0268350 Ga0395901_0268350_851_1696 244
32 3300048907 Ga0496104_0082036 Ga0496104_0082036_1816_2673 244
33 3300048908 Ga0496105_0095135 Ga0496105_0095135_233_1090 244
34 3300048917 Ga0496114_0003882 Ga0496114_0003882_10203_11060 244
35 3300049578 Ga0501042_0053691 Ga0501042_0053691_953_1801 244
36 3300003578 Ga0006562J51391_1052019 Ga0006562J51391_10520192 245
37 3300006038 Ga0075365_10057609 Ga0075365_100576092 245
38 3300009148 Ga0105243_10007046 Ga0105243_1000704610 245
39 3300025935 Ga0207709_10000847 Ga0207709_1000084719 245
40 3300025935 Ga0207709_10493010 Ga0207709_104930101 245
41 3300048907 Ga0496104_0010014 Ga0496104_0010014_2717_3553 245
42 3300048908 Ga0496105_0009916 Ga0496105_0009916_2589_3425 245
43 3300048910 Ga0496107_0039223 Ga0496107_0039223_329_1165 245
44 3300048913 Ga0496110_0143836 Ga0496110_0143836_1266_2123 245
45 3300048916 Ga0496113_0320814 Ga0496113_0320814_157_1014 245
46 3300049575 Ga0501039_0114912 Ga0501039_0114912_830_1657 245
47 3300049576 Ga0501040_0025827 Ga0501040_0025827_904_1731 245
48 3300049577 Ga0501041_0022971 Ga0501041_0022971_1546_2373 245
49 3300049578 Ga0501042_0006982 Ga0501042_0006982_2968_3795 245
50 3300049582 Ga0501048_0020440 Ga0501048_0020440_1034_1861 245
51 3300049585 Ga0501069_0031213 Ga0501069_0031213_1534_2361 245
52 3300049587 Ga0501071_0005281 Ga0501071_0005281_6433_7260 245
53 3300049588 Ga0501072_0054054 Ga0501072_0054054_888_1715 245
54 3300049588 Ga0501072_0160762 Ga0501072_0160762_727_1557 245
55 3300049590 Ga0501074_0117858 Ga0501074_0117858_746_1573 245
56 3300049591 Ga0501075_0026830 Ga0501075_0026830_3051_3878 245
57 3300049822 Ga0501035_0032895 Ga0501035_0032895_3160_3987 245
58 3300049824 Ga0501045_0075361 Ga0501045_0075361_682_1509 245
59 3300050492 nmdc:mga0yw44_157753_c1 nmdc:mga0yw44_157753_c1_201_1019 245
60 3300053153 Ga0500616_0003900 Ga0500616_0003900_5533_6360 245
61 3300060353 Ga0501082_0132969 Ga0501082_0132969_1180_2007 245
62 3300005329 Ga0070683_100211459 Ga0070683_1002114591 246
63 3300005334 Ga0068869_100095016 Ga0068869_1000950162 246
64 3300005338 Ga0068868_100011680 Ga0068868_1000116803 246
65 3300005340 Ga0070689_100209558 Ga0070689_1002095581 246
66 3300005343 Ga0070687_100143129 Ga0070687_1001431292 246
67 3300005344 Ga0070661_100073718 Ga0070661_1000737183 246
68 3300005347 Ga0070668_100006216 Ga0070668_1000062168 246
69 3300005366 Ga0070659_100055325 Ga0070659_1000553252 246
70 3300005441 Ga0070700_100072524 Ga0070700_1000725242 246
71 3300005455 Ga0070663_100002830 Ga0070663_1000028308 246
72 3300005457 Ga0070662_100082120 Ga0070662_1000821202 246
73 3300005563 Ga0068855_100083338 Ga0068855_1000833382 246
74 3300005564 Ga0070664_100038748 Ga0070664_1000387482 246
75 3300005617 Ga0068859_100206503 Ga0068859_1002065031 246
76 3300005618 Ga0068864_100393159 Ga0068864_1003931591 246
77 3300005719 Ga0068861_100086783 Ga0068861_1000867833 246
78 3300005719 Ga0068861_100297011 Ga0068861_1002970112 246
79 3300005719 Ga0068861_100443067 Ga0068861_1004430671 246
80 3300005844 Ga0068862_100063572 Ga0068862_1000635722 246
81 3300006353 Ga0075370_10006480 Ga0075370_100064805 246
82 3300006931 Ga0097620_100206506 Ga0097620_1002065061 246
83 3300009098 Ga0105245_10241776 Ga0105245_102417762 246
84 3300009148 Ga0105243_10025148 Ga0105243_100251482 246
85 3300009176 Ga0105242_10214387 Ga0105242_102143872 246
86 3300009551 Ga0105238_10519097 Ga0105238_105190971 246
87 3300013102 Ga0157371_10066988 Ga0157371_100669881 246
88 3300013307 Ga0157372_10141641 Ga0157372_101416412 246
89 3300014326 Ga0157380_10074657 Ga0157380_100746572 246
90 3300025901 Ga0207688_10006156 Ga0207688_100061561 246
91 3300025909 Ga0207705_10317265 Ga0207705_103172652 246
92 3300025914 Ga0207671_10294918 Ga0207671_102949181 246
93 3300025918 Ga0207662_10080467 Ga0207662_100804672 246
94 3300025918 Ga0207662_10161626 Ga0207662_101616262 246
95 3300025919 Ga0207657_10016654 Ga0207657_100166546 246
96 3300025923 Ga0207681_10041172 Ga0207681_100411722 246
97 3300025925 Ga0207650_10228079 Ga0207650_102280791 246
98 3300025927 Ga0207687_10067202 Ga0207687_100672022 246
99 3300025933 Ga0207706_10141237 Ga0207706_101412372 246
100 3300025942 Ga0207689_10039005 Ga0207689_100390052 246
101 3300025949 Ga0207667_10283732 Ga0207667_102837322 246
102 3300025961 Ga0207712_10043739 Ga0207712_100437393 246
103 3300025981 Ga0207640_10104352 Ga0207640_101043522 246
104 3300026035 Ga0207703_10091869 Ga0207703_100918692 246
105 3300026041 Ga0207639_10085012 Ga0207639_100850123 246
106 3300026067 Ga0207678_10005497 Ga0207678_1000549710 246
107 3300026075 Ga0207708_10021675 Ga0207708_100216755 246
108 3300026075 Ga0207708_10091546 Ga0207708_100915462 246
109 3300026078 Ga0207702_10250253 Ga0207702_102502531 246
110 3300026095 Ga0207676_10175007 Ga0207676_101750072 246
111 3300026116 Ga0207674_10161084 Ga0207674_101610842 246
112 3300026118 Ga0207675_100065912 Ga0207675_1000659123 246
113 3300026142 Ga0207698_10136542 Ga0207698_101365422 246
114 3300028379 Ga0268266_10127164 Ga0268266_101271642 246
115 3300028380 Ga0268265_10048416 Ga0268265_100484164 246
116 3300031852 Ga0307410_10044113 Ga0307410_100441132 246
117 3300031995 Ga0307409_100398604 Ga0307409_1003986041 246
118 3300048916 Ga0496113_0368515 Ga0496113_0368515_32_862 246
119 3300049587 Ga0501071_0058946 Ga0501071_0058946_304_1152 246
120 3300050511 nmdc:mga08y16_95453_c1 nmdc:mga08y16_95453_c1_1955_2785 246
121 3300006844 Ga0075428_100002717 Ga0075428_1000027174 247
122 3300006880 Ga0075429_100325062 Ga0075429_1003250621 247
123 3300009147 Ga0114129_10007260 Ga0114129_100072604 247
124 3300050507 nmdc:mga05p37_15076_c1 nmdc:mga05p37_15076_c1_6493_7422 247
125 3300050508 nmdc:mga09592_294774_c1 nmdc:mga09592_294774_c1_328_1257 247
126 3300053088 Ga0500644_0000400 Ga0500644_0000400_10251_11087 247
127 3300005337 Ga0070682_100038847 Ga0070682_1000388471 248
128 3300005434 Ga0070709_10244956 Ga0070709_102449561 248
129 3300005616 Ga0068852_100867396 Ga0068852_1008673961 248
130 3300025919 Ga0207657_10110623 Ga0207657_101106233 248
131 3300025945 Ga0207679_10408654 Ga0207679_104086542 248
132 3300031824 Ga0307413_10030548 Ga0307413_100305482 248
133 3300031852 Ga0307410_10049601 Ga0307410_100496012 248
134 3300031901 Ga0307406_10100195 Ga0307406_101001953 248
135 3300031903 Ga0307407_10041410 Ga0307407_100414103 248
136 3300031995 Ga0307409_100195846 Ga0307409_1001958462 248
137 3300032002 Ga0307416_100089182 Ga0307416_1000891823 248
138 3300032126 Ga0307415_100012645 Ga0307415_1000126451 248
139 3300037466 Ga0395898_0079283 Ga0395898_0079283_950_1798 248
140 3300037471 Ga0395905_0545297 Ga0395905_0545297_115_963 248
141 3300038443 Ga0395901_0033764 Ga0395901_0033764_2405_3253 248
142 3300045976 Ga0466967_0099958 Ga0466967_0099958_863_1699 248
143 3300048911 Ga0496108_0327042 Ga0496108_0327042_283_1119 248
144 3300048917 Ga0496114_0323410 Ga0496114_0323410_265_1104 248
145 3300013308 Ga0157375_10206026 Ga0157375_102060262 249
146 3300045976 Ga0466967_0380737 Ga0466967_0380737_475_1332 249
147 3300046463 Ga0495653_0153238 Ga0495653_0153238_68_907 249
148 3300047322 Ga0495680_0102246 Ga0495680_0102246_548_1387 249
149 3300053153 Ga0500616_0002550 Ga0500616_0002550_159_998 249
150 iso_pu_bacteria 2643221715 2644637337 249
151 3300002239 JGI24034J26672_10001829 JGI24034J26672_100018292 250
152 3300002244 JGI24742J22300_10008545 JGI24742J22300_100085452 250
153 3300005334 Ga0068869_100347479 Ga0068869_1003474791 250
154 3300005335 Ga0070666_10005662 Ga0070666_100056623 250
155 3300005336 Ga0070680_100419797 Ga0070680_1004197971 250
156 3300005337 Ga0070682_100153915 Ga0070682_1001539151 250
157 3300005338 Ga0068868_100000265 Ga0068868_10000026524 250
158 3300005341 Ga0070691_10004731 Ga0070691_100047314 250
159 3300005347 Ga0070668_100001311 Ga0070668_1000013117 250
160 3300005353 Ga0070669_100016940 Ga0070669_1000169403 250
161 3300005356 Ga0070674_100002076 Ga0070674_1000020762 250
162 3300005366 Ga0070659_100102175 Ga0070659_1001021751 250
163 3300005367 Ga0070667_100000598 Ga0070667_10000059822 250
164 3300005437 Ga0070710_10000363 Ga0070710_100003637 250
165 3300005438 Ga0070701_10001855 Ga0070701_100018553 250
166 3300005439 Ga0070711_100000211 Ga0070711_1000002115 250
167 3300005441 Ga0070700_100002877 Ga0070700_1000028773 250
168 3300005455 Ga0070663_100005482 Ga0070663_1000054823 250
169 3300005456 Ga0070678_100013469 Ga0070678_1000134692 250
170 3300005459 Ga0068867_100001676 Ga0068867_10000167611 250
171 3300005539 Ga0068853_100011257 Ga0068853_1000112575 250
172 3300005543 Ga0070672_100069501 Ga0070672_1000695011 250
173 3300005545 Ga0070695_100005767 Ga0070695_1000057673 250
174 3300005546 Ga0070696_100008236 Ga0070696_1000082363 250
175 3300005548 Ga0070665_100050768 Ga0070665_1000507683 250
176 3300005549 Ga0070704_100002418 Ga0070704_1000024183 250
177 3300005578 Ga0068854_100000759 Ga0068854_1000007593 250
178 3300005615 Ga0070702_100001149 Ga0070702_1000011492 250
179 3300005617 Ga0068859_100000995 Ga0068859_1000009954 250
180 3300005718 Ga0068866_10000103 Ga0068866_1000010320 250
181 3300005719 Ga0068861_100000166 Ga0068861_1000001667 250
182 3300005842 Ga0068858_100007032 Ga0068858_1000070327 250
183 3300005843 Ga0068860_100005999 Ga0068860_1000059992 250
184 3300005844 Ga0068862_100002488 Ga0068862_1000024889 250
185 3300005937 Ga0081455_10034137 Ga0081455_100341372 250
186 3300006163 Ga0070715_10001324 Ga0070715_100013242 250
187 3300006173 Ga0070716_100001550 Ga0070716_1000015504 250
188 3300006175 Ga0070712_100000214 Ga0070712_10000021411 250
189 3300006237 Ga0097621_100069391 Ga0097621_1000693912 250
190 3300006358 Ga0068871_100108713 Ga0068871_1001087132 250
191 3300006881 Ga0068865_100000672 Ga0068865_1000006722 250
192 3300006931 Ga0097620_100000995 Ga0097620_10000099521 250
193 3300009098 Ga0105245_10019369 Ga0105245_100193694 250
194 3300009101 Ga0105247_10000279 Ga0105247_1000027919 250
195 3300009148 Ga0105243_10002691 Ga0105243_100026919 250
196 3300009176 Ga0105242_10000551 Ga0105242_1000055121 250
197 3300009177 Ga0105248_10017005 Ga0105248_100170053 250
198 3300009545 Ga0105237_10049408 Ga0105237_100494082 250
199 3300009553 Ga0105249_10002292 Ga0105249_100022927 250
200 3300010375 Ga0105239_10004339 Ga0105239_1000433913 250
201 3300013296 Ga0157374_10008517 Ga0157374_100085173 250
202 3300013297 Ga0157378_10000675 Ga0157378_1000067510 250
203 3300013306 Ga0163162_10007269 Ga0163162_100072693 250
204 3300013307 Ga0157372_10015788 Ga0157372_100157884 250
205 3300013308 Ga0157375_10002974 Ga0157375_100029747 250
206 3300014326 Ga0157380_10003537 Ga0157380_100035374 250
207 3300014968 Ga0157379_10000781 Ga0157379_1000078117 250
208 3300014969 Ga0157376_10313825 Ga0157376_103138251 250
209 3300017792 Ga0163161_10001407 Ga0163161_1000140715 250
210 3300025898 Ga0207692_10000585 Ga0207692_100005853 250
211 3300025900 Ga0207710_10004251 Ga0207710_100042512 250
212 3300025901 Ga0207688_10000462 Ga0207688_1000046214 250
213 3300025905 Ga0207685_10001136 Ga0207685_100011362 250
214 3300025907 Ga0207645_10006630 Ga0207645_100066303 250
215 3300025915 Ga0207693_10000320 Ga0207693_1000032025 250
216 3300025916 Ga0207663_10010055 Ga0207663_100100552 250
217 3300025919 Ga0207657_10339029 Ga0207657_103390291 250
218 3300025923 Ga0207681_10043852 Ga0207681_100438522 250
219 3300025933 Ga0207706_10002248 Ga0207706_1000224813 250
220 3300025934 Ga0207686_10004043 Ga0207686_100040434 250
221 3300025935 Ga0207709_10005111 Ga0207709_100051112 250
222 3300025937 Ga0207669_10000415 Ga0207669_100004152 250
223 3300025938 Ga0207704_10001734 Ga0207704_100017344 250
224 3300025939 Ga0207665_10004881 Ga0207665_100048813 250
225 3300025940 Ga0207691_10060056 Ga0207691_100600563 250
226 3300025941 Ga0207711_10025825 Ga0207711_100258253 250
227 3300025961 Ga0207712_10011563 Ga0207712_100115632 250
228 3300025972 Ga0207668_10066434 Ga0207668_100664341 250
229 3300025986 Ga0207658_10008270 Ga0207658_100082704 250
230 3300026023 Ga0207677_10001154 Ga0207677_1000115410 250
231 3300026035 Ga0207703_10054377 Ga0207703_100543772 250
232 3300026089 Ga0207648_10000451 Ga0207648_1000045127 250
233 3300026118 Ga0207675_100000675 Ga0207675_1000006757 250
234 3300026121 Ga0207683_10000665 Ga0207683_1000066514 250
235 3300028379 Ga0268266_10097528 Ga0268266_100975282 250
236 3300028380 Ga0268265_10023821 Ga0268265_100238212 250
237 3300028381 Ga0268264_10009940 Ga0268264_100099405 250
238 3300032002 Ga0307416_100388083 Ga0307416_1003880832 250
239 3300034820 Ga0373959_0020844 Ga0373959_0020844_49_936 250
240 3300035112 Ga0373932_0056957 Ga0373932_0056957_117_1004 250
241 3300041404 Ga0439436_0001328 Ga0439436_0001328_3719_4564 250
242 3300041406 Ga0439439_0004162 Ga0439439_0004162_293_1138 250
243 3300041999 Ga0439433_0001248 Ga0439433_0001248_2446_3291 250
244 3300042007 Ga0439449_0012247 Ga0439449_0012247_1908_2753 250
245 3300042014 Ga0439457_000494 Ga0439457_000494_8564_9409 250
246 3300042015 Ga0439462_0015694 Ga0439462_0015694_586_1431 250
247 3300042146 Ga0450907_009900 Ga0450907_009900_402_1247 250
248 3300048903 Ga0496100_0003360 Ga0496100_0003360_3147_4034 250
249 3300048904 Ga0496101_0003844 Ga0496101_0003844_3475_4362 250
250 3300048905 Ga0496102_0034243 Ga0496102_0034243_3648_4535 250
251 3300048906 Ga0496103_0000325 Ga0496103_0000325_25831_26727 250
252 3300048909 Ga0496106_0001168 Ga0496106_0001168_15964_16851 250
253 3300048910 Ga0496107_0015680 Ga0496107_0015680_3392_4279 250
254 3300048917 Ga0496114_0001466 Ga0496114_0001466_8274_9161 250
255 3300048918 Ga0496115_0002019 Ga0496115_0002019_11881_12768 250
256 3300005616 Ga0068852_100182574 Ga0068852_1001825742 251
257 3300044658 Ga0466972_0045486 Ga0466972_0045486_277_1104 251
258 3300044683 Ga0466965_0006924 Ga0466965_0006924_2631_3458 251
259 3300044694 Ga0466963_0049092 Ga0466963_0049092_1951_2778 251
260 3300044735 Ga0466968_0035061 Ga0466968_0035061_1162_1989 251
261 3300044765 Ga0466970_0002435 Ga0466970_0002435_5533_6360 251
262 3300044842 Ga0466957_0005197 Ga0466957_0005197_3226_4053 251
263 3300045836 Ga0466958_0015523 Ga0466958_0015523_1022_1849 251
264 3300031456 Ga0307513_10023143 Ga0307513_100231433 252
265 3300031731 Ga0307405_10335492 Ga0307405_103354921 252
266 3300031901 Ga0307406_10069778 Ga0307406_100697784 252
267 3300031911 Ga0307412_10248343 Ga0307412_102483432 252
268 3300031995 Ga0307409_100017338 Ga0307409_1000173386 252
269 3300032005 Ga0307411_10058779 Ga0307411_100587792 252
270 3300045976 Ga0466967_0186015 Ga0466967_0186015_458_1324 252
271 3300050510 nmdc:mga06r32_5161_c1 nmdc:mga06r32_5161_c1_436_1257 252
272 3300005347 Ga0070668_100282013 Ga0070668_1002820132 253
273 3300005455 Ga0070663_100468546 Ga0070663_1004685461 253
274 3300005618 Ga0068864_100115086 Ga0068864_1001150862 253
275 3300006178 Ga0075367_10136294 Ga0075367_101362942 253
276 3300006353 Ga0075370_10003922 Ga0075370_100039222 253
277 3300006353 Ga0075370_10056944 Ga0075370_100569442 253
278 3300031901 Ga0307406_10493489 Ga0307406_104934891 253
279 3300048904 Ga0496101_0029499 Ga0496101_0029499_1873_2703 253
280 3300048905 Ga0496102_0034939 Ga0496102_0034939_2867_3697 253
281 3300048907 Ga0496104_0568820 Ga0496104_0568820_169_999 253
282 3300048917 Ga0496114_0270479 Ga0496114_0270479_172_1002 253
283 3300050513 nmdc:mga0rr50_224749_c1 nmdc:mga0rr50_224749_c1_191_1024 253
284 3300050516 nmdc:mga0sz30_189652_c1 nmdc:mga0sz30_189652_c1_22_852 253
285 3300005338 Ga0068868_100131678 Ga0068868_1001316781 256
286 3300006048 Ga0075363_100003724 Ga0075363_1000037244 256
287 3300006177 Ga0075362_10041675 Ga0075362_100416752 256
288 3300041411 Ga0439466_0004145 Ga0439466_0004145_1457_2281 256
289 3300041413 Ga0439465_0000232 Ga0439465_0000232_14206_15030 256
290 3300042002 Ga0439442_011160 Ga0439442_011160_714_1538 256
291 3300042435 Ga0439434_0018523 Ga0439434_0018523_536_1360 256
292 3300050489 nmdc:mga03683_3606_c1 nmdc:mga03683_3606_c1_3329_4156 256
293 3300050490 nmdc:mga03n38_114085_c1 nmdc:mga03n38_114085_c1_378_1205 256
294 3300050492 nmdc:mga0yw44_159049_c1 nmdc:mga0yw44_159049_c1_103_930 256
295 3300050496 nmdc:mga07m45_25860_c2 nmdc:mga07m45_25860_c2_944_1771 256
296 3300006048 Ga0075363_100005658 Ga0075363_1000056582 257
297 3300006051 Ga0075364_10003110 Ga0075364_100031108 257
298 3300006353 Ga0075370_10003127 Ga0075370_100031277 257
299 3300013306 Ga0163162_10155899 Ga0163162_101558992 257
300 3300014326 Ga0157380_10570466 Ga0157380_105704661 257
301 3300025972 Ga0207668_10194091 Ga0207668_101940911 257
302 3300050490 nmdc:mga03n38_9745_c1 nmdc:mga03n38_9745_c1_2009_2845 257
303 3300050496 nmdc:mga07m45_27240_c1 nmdc:mga07m45_27240_c1_876_1712 257
304 3300001977 JGI24746J21847_1006224 JGI24746J21847_10062241 258
305 3300002075 JGI24738J21930_10012369 JGI24738J21930_100123692 258
306 3300005328 Ga0070676_10185450 Ga0070676_101854502 258
307 3300005334 Ga0068869_100034883 Ga0068869_1000348832 258
308 3300005336 Ga0070680_100244133 Ga0070680_1002441332 258
309 3300005339 Ga0070660_100134844 Ga0070660_1001348441 258
310 3300005340 Ga0070689_100059988 Ga0070689_1000599883 258
311 3300005341 Ga0070691_10092072 Ga0070691_100920721 258
312 3300005343 Ga0070687_100321932 Ga0070687_1003219321 258
313 3300005345 Ga0070692_10014647 Ga0070692_100146472 258
314 3300005347 Ga0070668_100000135 Ga0070668_10000013526 258
315 3300005347 Ga0070668_100025280 Ga0070668_1000252803 258
316 3300005354 Ga0070675_100589565 Ga0070675_1005895651 258
317 3300005356 Ga0070674_100035308 Ga0070674_1000353083 258
318 3300005364 Ga0070673_100112499 Ga0070673_1001124991 258
319 3300005366 Ga0070659_100061127 Ga0070659_1000611271 258
320 3300005367 Ga0070667_100057982 Ga0070667_1000579823 258
321 3300005434 Ga0070709_10008111 Ga0070709_100081113 258
322 3300005435 Ga0070714_100069130 Ga0070714_1000691303 258
323 3300005437 Ga0070710_10002347 Ga0070710_100023473 258
324 3300005439 Ga0070711_100002072 Ga0070711_1000020726 258
325 3300005440 Ga0070705_100059622 Ga0070705_1000596221 258
326 3300005441 Ga0070700_100066027 Ga0070700_1000660272 258
327 3300005444 Ga0070694_100118845 Ga0070694_1001188452 258
328 3300005455 Ga0070663_100026072 Ga0070663_1000260723 258
329 3300005456 Ga0070678_100024907 Ga0070678_1000249074 258
330 3300005457 Ga0070662_100146829 Ga0070662_1001468292 258
331 3300005459 Ga0068867_100137036 Ga0068867_1001370362 258
332 3300005544 Ga0070686_100110360 Ga0070686_1001103602 258
333 3300005546 Ga0070696_100064708 Ga0070696_1000647081 258
334 3300005547 Ga0070693_100045307 Ga0070693_1000453073 258
335 3300005548 Ga0070665_100187800 Ga0070665_1001878003 258
336 3300005549 Ga0070704_100029570 Ga0070704_1000295701 258
337 3300005578 Ga0068854_100103921 Ga0068854_1001039212 258
338 3300005614 Ga0068856_100255571 Ga0068856_1002555712 258
339 3300005615 Ga0070702_100024059 Ga0070702_1000240591 258
340 3300005616 Ga0068852_100022727 Ga0068852_1000227273 258
341 3300005617 Ga0068859_100097166 Ga0068859_1000971663 258
342 3300005718 Ga0068866_10034986 Ga0068866_100349862 258
343 3300005719 Ga0068861_100133546 Ga0068861_1001335462 258
344 3300005842 Ga0068858_100016466 Ga0068858_1000164664 258
345 3300005843 Ga0068860_100816144 Ga0068860_1008161442 258
346 3300006173 Ga0070716_100003938 Ga0070716_1000039384 258
347 3300006237 Ga0097621_100035884 Ga0097621_1000358843 258
348 3300006881 Ga0068865_100118213 Ga0068865_1001182131 258
349 3300006931 Ga0097620_100097172 Ga0097620_1000971723 258
350 3300009098 Ga0105245_10133820 Ga0105245_101338203 258
351 3300009101 Ga0105247_10005951 Ga0105247_100059513 258
352 3300009148 Ga0105243_10131536 Ga0105243_101315361 258
353 3300009174 Ga0105241_10123340 Ga0105241_101233402 258
354 3300009176 Ga0105242_10087347 Ga0105242_100873472 258
355 3300009545 Ga0105237_10102736 Ga0105237_101027362 258
356 3300009551 Ga0105238_10522953 Ga0105238_105229532 258
357 3300010375 Ga0105239_10062682 Ga0105239_100626822 258
358 3300011119 Ga0105246_10009201 Ga0105246_100092012 258
359 3300013296 Ga0157374_10090885 Ga0157374_100908852 258
360 3300013306 Ga0163162_10343467 Ga0163162_103434672 258
361 3300014325 Ga0163163_10296155 Ga0163163_102961552 258
362 3300014326 Ga0157380_10011514 Ga0157380_100115146 258
363 3300014968 Ga0157379_10021168 Ga0157379_100211683 258
364 3300014969 Ga0157376_10056195 Ga0157376_100561954 258
365 3300017792 Ga0163161_10031233 Ga0163161_100312332 258
366 3300025898 Ga0207692_10045352 Ga0207692_100453523 258
367 3300025900 Ga0207710_10011537 Ga0207710_100115373 258
368 3300025901 Ga0207688_10000373 Ga0207688_100003735 258
369 3300025904 Ga0207647_10007841 Ga0207647_100078413 258
370 3300025905 Ga0207685_10013669 Ga0207685_100136693 258
371 3300025906 Ga0207699_10017258 Ga0207699_100172583 258
372 3300025907 Ga0207645_10030420 Ga0207645_100304204 258
373 3300025915 Ga0207693_10001428 Ga0207693_1000142811 258
374 3300025916 Ga0207663_10022458 Ga0207663_100224581 258
375 3300025918 Ga0207662_10039946 Ga0207662_100399461 258
376 3300025919 Ga0207657_10148861 Ga0207657_101488611 258
377 3300025927 Ga0207687_10046601 Ga0207687_100466012 258
378 3300025929 Ga0207664_10088133 Ga0207664_100881333 258
379 3300025932 Ga0207690_10633015 Ga0207690_106330151 258
380 3300025933 Ga0207706_10018768 Ga0207706_100187683 258
381 3300025935 Ga0207709_10041139 Ga0207709_100411392 258
382 3300025938 Ga0207704_10145272 Ga0207704_101452721 258
383 3300025939 Ga0207665_10011581 Ga0207665_100115812 258
384 3300025940 Ga0207691_10094757 Ga0207691_100947574 258
385 3300025942 Ga0207689_10013030 Ga0207689_100130304 258
386 3300025972 Ga0207668_10001507 Ga0207668_100015075 258
387 3300026023 Ga0207677_10527602 Ga0207677_105276021 258
388 3300026035 Ga0207703_10297715 Ga0207703_102977151 258
389 3300026067 Ga0207678_10113249 Ga0207678_101132492 258
390 3300026075 Ga0207708_10006801 Ga0207708_100068013 258
391 3300026088 Ga0207641_10192383 Ga0207641_101923831 258
392 3300026089 Ga0207648_10062672 Ga0207648_100626723 258
393 3300026118 Ga0207675_100177904 Ga0207675_1001779042 258
394 3300028380 Ga0268265_10119488 Ga0268265_101194883 258
395 3300035691 Ga0373931_0036071 Ga0373931_0036071_1009_1839 258
396 3300048904 Ga0496101_0172589 Ga0496101_0172589_78_908 258
397 3300048906 Ga0496103_0078879 Ga0496103_0078879_916_1746 258
398 3300048907 Ga0496104_0049970 Ga0496104_0049970_190_1020 258
399 3300048908 Ga0496105_0099961 Ga0496105_0099961_1145_1975 258
400 3300048910 Ga0496107_0081152 Ga0496107_0081152_924_1754 258
401 3300048911 Ga0496108_0000188 Ga0496108_0000188_13465_14295 258
402 3300048912 Ga0496109_0009871 Ga0496109_0009871_7275_8105 258
403 3300048913 Ga0496110_0136722 Ga0496110_0136722_757_1587 258
404 3300048915 Ga0496112_0009288 Ga0496112_0009288_2550_3380 258
405 3300048916 Ga0496113_0012496 Ga0496113_0012496_4800_5630 258
406 3300048917 Ga0496114_0304080 Ga0496114_0304080_564_1394 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

89

184

0.98

PF13649

Methyltransf_25

Methyltransferase domain

88

180

0.93

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

74

209

0.9

PF08242

Methyltransf_12

Methyltransferase domain

89

182

0.9

PF13847

Methyltransf_31

Methyltransferase domain

82

220

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cjt-assembly4.cif.gz_G ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.857 23 134
3cjt-assembly8.cif.gz_O ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.857 23 134
2nxj-assembly2.cif.gz_B t.thermophilus ribosomal protein l11 methyltransferase (prma) in space group p 21 21 2 0.8565 23 134
3cjr-assembly1.cif.gz_A ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11 (k39a) and inhibitor sinefungin. 0.8557 23 134
3cjq-assembly2.cif.gz_D ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 in space group p212121 0.8513 23 134
ID Description Score Start End Superfamily
af_Q553T0_166_421_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9333 31 137 3.40.50.150
af_O74198_45_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9269 31 137 3.40.50.150
af_A0A0N7KI91_1_189_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9154 24 133 3.40.50.150
af_A0A1D6FP61_65_209_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9136 33 83 3.40.50.150
af_I1L8V0_149_258_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8951 92 134 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7W0GKN9-F1-model_v4 Methyltransferase domain-containing protein 0.9303 72 256 GO:0008757
GO:0032259
AF-A0A6G9Y7I9-F1-model_v4 Methyltransferase domain-containing protein 0.9292 16 257 GO:0008168
GO:0032259
AF-A0A7W0PXW5-F1-model_v4 Methyltransferase domain-containing protein 0.9225 34 133 GO:0008757
GO:0032259
AF-X1H6Z5-F1-model_v4 Methyltransferase domain-containing protein 0.9193 32 91
AF-A0A3N1CP95-F1-model_v4 Methyltransferase family protein 0.9155 19 134 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
87.04 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map