F436186
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 406 | 235 | 405 | 266 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10007260|Ga0114129_100072604 |
| Length | 298 |
| Sequence | VGTTPKARLIRRFHDCQTSAETLQSNLDGIEPTCKENTMTTVEADRALKAKHRALWASGDYPAVAAELIAALGPELVRAIGVKSGDRVLDVAAGSGNAAIPAAAAGGIVTASDLTPELFDAGRQIAAERGVELEWVEADAEAMPFADNSFDAVISCVGVMFAPHHQAAADELVRVVRTGGTIGLINWTPEGLIGNLLATMKPYALWGNEDHVRQLFGERVTGLTARRQTVRMDHCADPLEFREYWKRNYGPTIAAYRFNQDQPERVAALDRDFLAFLTESQRGDGWDAEYLLVTATKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 156 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 157 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 158 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 159 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 163 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 164 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 168 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 171 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 172 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 173 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 174 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 175 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 176 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 177 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 178 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 179 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 180 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 181 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 182 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 183 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 184 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 185 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 186 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 187 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 188 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 189 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 190 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 191 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 196 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 197 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 198 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 199 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 200 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 201 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 204 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 205 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 206 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 207 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 208 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 209 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 210 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 211 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 224 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 225 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 226 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 227 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 233 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 234 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 235 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.51 |
| Metatranscriptomes | 0.25 |
| Isolates | 0.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.67 |
| Nodule | 0 |
| Rhizoplane | 9.11 |
| Rhizosphere | 83.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1006224 | 3300001977 | Bacteria | 1853 |
| 2 | JGI24738J21930_10012369 | 3300002075 | Bacteria | 1865 |
| 3 | JGI24034J26672_10001829 | 3300002239 | Bacteria | 2866 |
| 4 | JGI24742J22300_10008545 | 3300002244 | Bacteria | 1689 |
| 5 | Ga0006562J51391_1052019 | 3300003578 | Bacteria | 2390 |
| 6 | Ga0070676_10185450 | 3300005328 | Bacteria | 1355 |
| 7 | Ga0070683_100211459 | 3300005329 | Bacteria | 1842 |
| 8 | Ga0068869_100034883 | 3300005334 | Bacteria | 3562 |
| 9 | Ga0068869_100095016 | 3300005334 | Bacteria | 2248 |
| 10 | Ga0068869_100347479 | 3300005334 | Bacteria | 1208 |
| 11 | Ga0070666_10005662 | 3300005335 | Bacteria | 7669 |
| 12 | Ga0070680_100244133 | 3300005336 | Bacteria | 1518 |
| 13 | Ga0070680_100419797 | 3300005336 | Bacteria | 1141 |
| 14 | Ga0070682_100038847 | 3300005337 | Bacteria | 2921 |
| 15 | Ga0070682_100153915 | 3300005337 | Bacteria | 1581 |
| 16 | Ga0068868_100000265 | 3300005338 | Bacteria | 35343 |
| 17 | Ga0068868_100011680 | 3300005338 | Bacteria | 6396 |
| 18 | Ga0068868_100131678 | 3300005338 | Bacteria | 2047 |
| 19 | Ga0070660_100134844 | 3300005339 | Bacteria | 1978 |
| 20 | Ga0070689_100059988 | 3300005340 | Bacteria | 2957 |
| 21 | Ga0070689_100209558 | 3300005340 | Bacteria | 1594 |
| 22 | Ga0070691_10004731 | 3300005341 | Bacteria | 6194 |
| 23 | Ga0070691_10092072 | 3300005341 | Bacteria | 1496 |
| 24 | Ga0070687_100143129 | 3300005343 | Bacteria | 1395 |
| 25 | Ga0070687_100321932 | 3300005343 | Bacteria | 988 |
| 26 | Ga0070661_100037253 | 3300005344 | Bacteria | 3537 |
| 27 | Ga0070661_100073718 | 3300005344 | Bacteria | 2513 |
| 28 | Ga0070692_10014647 | 3300005345 | Bacteria | 3690 |
| 29 | Ga0070668_100000135 | 3300005347 | Bacteria | 46315 |
| 30 | Ga0070668_100001311 | 3300005347 | Bacteria | 17811 |
| 31 | Ga0070668_100006216 | 3300005347 | Bacteria | 8847 |
| 32 | Ga0070668_100025280 | 3300005347 | Bacteria | 4501 |
| 33 | Ga0070668_100282013 | 3300005347 | Bacteria | 1388 |
| 34 | Ga0070669_100016940 | 3300005353 | Bacteria | 5203 |
| 35 | Ga0070675_100589565 | 3300005354 | Bacteria | 1008 |
| 36 | Ga0070674_100002076 | 3300005356 | Bacteria | 10971 |
| 37 | Ga0070674_100035308 | 3300005356 | Bacteria | 3347 |
| 38 | Ga0070673_100112499 | 3300005364 | Bacteria | 2260 |
| 39 | Ga0070659_100055325 | 3300005366 | Bacteria | 3126 |
| 40 | Ga0070659_100061127 | 3300005366 | Bacteria | 2977 |
| 41 | Ga0070659_100102175 | 3300005366 | Bacteria | 2308 |
| 42 | Ga0070667_100000598 | 3300005367 | Bacteria | 35201 |
| 43 | Ga0070667_100057982 | 3300005367 | Bacteria | 3274 |
| 44 | Ga0070709_10008111 | 3300005434 | Bacteria | 5764 |
| 45 | Ga0070709_10244956 | 3300005434 | Bacteria | 1289 |
| 46 | Ga0070714_100069130 | 3300005435 | Bacteria | 3049 |
| 47 | Ga0070710_10000363 | 3300005437 | Bacteria | 21338 |
| 48 | Ga0070710_10002347 | 3300005437 | Bacteria | 8956 |
| 49 | Ga0070701_10001855 | 3300005438 | Bacteria | 8014 |
| 50 | Ga0070711_100000211 | 3300005439 | Bacteria | 30817 |
| 51 | Ga0070711_100002072 | 3300005439 | Bacteria | 11319 |
| 52 | Ga0070705_100059622 | 3300005440 | Bacteria | 2260 |
| 53 | Ga0070700_100002877 | 3300005441 | Bacteria | 8844 |
| 54 | Ga0070700_100066027 | 3300005441 | Bacteria | 2295 |
| 55 | Ga0070700_100072524 | 3300005441 | Bacteria | 2201 |
| 56 | Ga0070694_100118845 | 3300005444 | Bacteria | 1894 |
| 57 | Ga0070663_100002830 | 3300005455 | Bacteria | 9854 |
| 58 | Ga0070663_100005482 | 3300005455 | Bacteria | 7542 |
| 59 | Ga0070663_100026072 | 3300005455 | Bacteria | 3955 |
| 60 | Ga0070663_100468546 | 3300005455 | Bacteria | 1041 |
| 61 | Ga0070678_100013469 | 3300005456 | Bacteria | 5128 |
| 62 | Ga0070678_100024907 | 3300005456 | Bacteria | 4015 |
| 63 | Ga0070662_100082120 | 3300005457 | Bacteria | 2402 |
| 64 | Ga0070662_100146829 | 3300005457 | Bacteria | 1832 |
| 65 | Ga0068867_100001676 | 3300005459 | Bacteria | 15435 |
| 66 | Ga0068867_100137036 | 3300005459 | Bacteria | 1909 |
| 67 | Ga0068853_100011257 | 3300005539 | Bacteria | 7261 |
| 68 | Ga0070672_100069501 | 3300005543 | Bacteria | 2796 |
| 69 | Ga0070686_100110360 | 3300005544 | Bacteria | 1873 |
| 70 | Ga0070695_100005767 | 3300005545 | Bacteria | 7295 |
| 71 | Ga0070696_100008236 | 3300005546 | Bacteria | 6977 |
| 72 | Ga0070696_100064708 | 3300005546 | Bacteria | 2562 |
| 73 | Ga0070693_100045307 | 3300005547 | Bacteria | 2492 |
| 74 | Ga0070665_100050768 | 3300005548 | Bacteria | 4163 |
| 75 | Ga0070665_100187800 | 3300005548 | Bacteria | 2067 |
| 76 | Ga0070704_100002418 | 3300005549 | Bacteria | 10482 |
| 77 | Ga0070704_100029570 | 3300005549 | Bacteria | 3660 |
| 78 | Ga0068855_100083338 | 3300005563 | Bacteria | 3704 |
| 79 | Ga0070664_100038748 | 3300005564 | Bacteria | 4013 |
| 80 | Ga0068857_100251477 | 3300005577 | Bacteria | 1620 |
| 81 | Ga0068854_100000759 | 3300005578 | Bacteria | 19146 |
| 82 | Ga0068854_100103921 | 3300005578 | Bacteria | 2133 |
| 83 | Ga0068856_100255571 | 3300005614 | Bacteria | 1767 |
| 84 | Ga0070702_100001149 | 3300005615 | Bacteria | 10647 |
| 85 | Ga0070702_100024059 | 3300005615 | Bacteria | 3244 |
| 86 | Ga0068852_100022727 | 3300005616 | Bacteria | 5034 |
| 87 | Ga0068852_100182574 | 3300005616 | Bacteria | 1974 |
| 88 | Ga0068852_100867396 | 3300005616 | Bacteria | 919 |
| 89 | Ga0068859_100000995 | 3300005617 | Bacteria | 29017 |
| 90 | Ga0068859_100097166 | 3300005617 | Bacteria | 2998 |
| 91 | Ga0068859_100206503 | 3300005617 | Bacteria | 2049 |
| 92 | Ga0068864_100115086 | 3300005618 | Bacteria | 2398 |
| 93 | Ga0068864_100361477 | 3300005618 | Bacteria | 1372 |
| 94 | Ga0068864_100393159 | 3300005618 | Bacteria | 1316 |
| 95 | Ga0068866_10000103 | 3300005718 | Bacteria | 36199 |
| 96 | Ga0068866_10034986 | 3300005718 | Bacteria | 2450 |
| 97 | Ga0068861_100000166 | 3300005719 | Bacteria | 34780 |
| 98 | Ga0068861_100086783 | 3300005719 | Bacteria | 2461 |
| 99 | Ga0068861_100133546 | 3300005719 | Bacteria | 2017 |
| 100 | Ga0068861_100297011 | 3300005719 | Bacteria | 1397 |
| 101 | Ga0068861_100443067 | 3300005719 | Bacteria | 1162 |
| 102 | Ga0068858_100007032 | 3300005842 | Bacteria | 10932 |
| 103 | Ga0068858_100016466 | 3300005842 | Bacteria | 6941 |
| 104 | Ga0068860_100005999 | 3300005843 | Bacteria | 12227 |
| 105 | Ga0068860_100816144 | 3300005843 | Bacteria | 946 |
| 106 | Ga0068862_100002488 | 3300005844 | Bacteria | 16304 |
| 107 | Ga0068862_100063572 | 3300005844 | Bacteria | 3176 |
| 108 | Ga0081455_10034137 | 3300005937 | Bacteria | 4561 |
| 109 | Ga0075365_10057609 | 3300006038 | Bacteria | 2585 |
| 110 | Ga0075363_100003724 | 3300006048 | Bacteria | 6556 |
| 111 | Ga0075363_100005658 | 3300006048 | Bacteria | 5593 |
| 112 | Ga0075364_10003110 | 3300006051 | Bacteria | 9390 |
| 113 | Ga0070715_10001324 | 3300006163 | Bacteria | 7141 |
| 114 | Ga0070716_100001550 | 3300006173 | Bacteria | 10312 |
| 115 | Ga0070716_100003938 | 3300006173 | Bacteria | 7045 |
| 116 | Ga0070712_100000214 | 3300006175 | Bacteria | 32534 |
| 117 | Ga0075362_10041675 | 3300006177 | Bacteria | 2026 |
| 118 | Ga0075367_10136294 | 3300006178 | Bacteria | 1519 |
| 119 | Ga0097621_100035884 | 3300006237 | Bacteria | 3963 |
| 120 | Ga0097621_100069391 | 3300006237 | Bacteria | 2910 |
| 121 | Ga0075370_10003127 | 3300006353 | Bacteria | 7816 |
| 122 | Ga0075370_10003922 | 3300006353 | Bacteria | 7142 |
| 123 | Ga0075370_10006480 | 3300006353 | Bacteria | 5892 |
| 124 | Ga0075370_10056944 | 3300006353 | Bacteria | 2221 |
| 125 | Ga0075370_10058905 | 3300006353 | Bacteria | 2185 |
| 126 | Ga0068871_100108713 | 3300006358 | Bacteria | 2331 |
| 127 | Ga0075428_100002717 | 3300006844 | Bacteria | 19259 |
| 128 | Ga0075429_100325062 | 3300006880 | Bacteria | 1346 |
| 129 | Ga0068865_100000672 | 3300006881 | Bacteria | 19284 |
| 130 | Ga0068865_100118213 | 3300006881 | Bacteria | 1966 |
| 131 | Ga0075436_100070836 | 3300006914 | Bacteria | 2410 |
| 132 | Ga0097620_100000995 | 3300006931 | Bacteria | 29017 |
| 133 | Ga0097620_100097172 | 3300006931 | Bacteria | 2998 |
| 134 | Ga0097620_100206506 | 3300006931 | Bacteria | 2049 |
| 135 | Ga0105245_10019369 | 3300009098 | Bacteria | 5959 |
| 136 | Ga0105245_10133820 | 3300009098 | Bacteria | 2328 |
| 137 | Ga0105245_10241776 | 3300009098 | Bacteria | 1750 |
| 138 | Ga0105247_10000279 | 3300009101 | Bacteria | 46962 |
| 139 | Ga0105247_10005951 | 3300009101 | Bacteria | 7605 |
| 140 | Ga0114129_10007260 | 3300009147 | Bacteria | 15775 |
| 141 | Ga0105243_10002691 | 3300009148 | Bacteria | 14766 |
| 142 | Ga0105243_10007046 | 3300009148 | Bacteria | 8650 |
| 143 | Ga0105243_10025148 | 3300009148 | Bacteria | 4547 |
| 144 | Ga0105243_10131536 | 3300009148 | Bacteria | 2123 |
| 145 | Ga0105243_10311154 | 3300009148 | Bacteria | 1431 |
| 146 | Ga0105241_10123340 | 3300009174 | Bacteria | 2089 |
| 147 | Ga0105242_10000551 | 3300009176 | Bacteria | 29661 |
| 148 | Ga0105242_10087347 | 3300009176 | Bacteria | 2618 |
| 149 | Ga0105242_10214387 | 3300009176 | Bacteria | 1717 |
| 150 | Ga0105248_10017005 | 3300009177 | Bacteria | 8010 |
| 151 | Ga0105237_10049408 | 3300009545 | Bacteria | 4228 |
| 152 | Ga0105237_10102736 | 3300009545 | Bacteria | 2850 |
| 153 | Ga0105238_10519097 | 3300009551 | Bacteria | 1194 |
| 154 | Ga0105238_10522953 | 3300009551 | Bacteria | 1189 |
| 155 | Ga0105249_10002292 | 3300009553 | Bacteria | 16622 |
| 156 | Ga0105239_10004339 | 3300010375 | Bacteria | 16991 |
| 157 | Ga0105239_10062682 | 3300010375 | Bacteria | 4081 |
| 158 | Ga0105246_10009201 | 3300011119 | Bacteria | 6082 |
| 159 | Ga0157371_10066988 | 3300013102 | Bacteria | 2542 |
| 160 | Ga0157374_10008517 | 3300013296 | Bacteria | 8774 |
| 161 | Ga0157374_10090885 | 3300013296 | Bacteria | 2911 |
| 162 | Ga0157378_10000675 | 3300013297 | Bacteria | 32100 |
| 163 | Ga0163162_10007269 | 3300013306 | Bacteria | 10756 |
| 164 | Ga0163162_10155899 | 3300013306 | Bacteria | 2403 |
| 165 | Ga0163162_10343467 | 3300013306 | Bacteria | 1625 |
| 166 | Ga0157372_10015788 | 3300013307 | Bacteria | 8101 |
| 167 | Ga0157372_10141641 | 3300013307 | Bacteria | 2771 |
| 168 | Ga0157375_10002974 | 3300013308 | Bacteria | 14731 |
| 169 | Ga0157375_10206026 | 3300013308 | Bacteria | 2123 |
| 170 | Ga0163163_10035304 | 3300014325 | Bacteria | 4849 |
| 171 | Ga0163163_10296155 | 3300014325 | Bacteria | 1670 |
| 172 | Ga0157380_10003537 | 3300014326 | Bacteria | 10740 |
| 173 | Ga0157380_10011514 | 3300014326 | Bacteria | 6393 |
| 174 | Ga0157380_10074657 | 3300014326 | Bacteria | 2753 |
| 175 | Ga0157380_10570466 | 3300014326 | Bacteria | 1114 |
| 176 | Ga0157379_10000781 | 3300014968 | Bacteria | 25849 |
| 177 | Ga0157379_10021168 | 3300014968 | Bacteria | 5755 |
| 178 | Ga0157376_10056195 | 3300014969 | Bacteria | 3287 |
| 179 | Ga0157376_10313825 | 3300014969 | Bacteria | 1488 |
| 180 | Ga0163161_10001407 | 3300017792 | Bacteria | 17777 |
| 181 | Ga0163161_10031233 | 3300017792 | Bacteria | 3794 |
| 182 | Ga0207692_10000585 | 3300025898 | Bacteria | 12924 |
| 183 | Ga0207692_10045352 | 3300025898 | Bacteria | 2198 |
| 184 | Ga0207710_10004251 | 3300025900 | Bacteria | 6279 |
| 185 | Ga0207710_10011537 | 3300025900 | Bacteria | 3719 |
| 186 | Ga0207688_10000373 | 3300025901 | Bacteria | 20896 |
| 187 | Ga0207688_10000462 | 3300025901 | Bacteria | 19372 |
| 188 | Ga0207688_10006156 | 3300025901 | Bacteria | 6530 |
| 189 | Ga0207647_10007841 | 3300025904 | Bacteria | 7683 |
| 190 | Ga0207685_10001136 | 3300025905 | Bacteria | 5313 |
| 191 | Ga0207685_10013669 | 3300025905 | Bacteria | 2518 |
| 192 | Ga0207699_10017258 | 3300025906 | Bacteria | 3794 |
| 193 | Ga0207645_10006630 | 3300025907 | Bacteria | 8273 |
| 194 | Ga0207645_10030420 | 3300025907 | Bacteria | 3478 |
| 195 | Ga0207705_10317265 | 3300025909 | Bacteria | 1197 |
| 196 | Ga0207671_10294918 | 3300025914 | Bacteria | 1281 |
| 197 | Ga0207693_10000320 | 3300025915 | Bacteria | 44589 |
| 198 | Ga0207693_10001428 | 3300025915 | Bacteria | 21168 |
| 199 | Ga0207663_10010055 | 3300025916 | Bacteria | 5017 |
| 200 | Ga0207663_10022458 | 3300025916 | Bacteria | 3606 |
| 201 | Ga0207662_10039946 | 3300025918 | Bacteria | 2755 |
| 202 | Ga0207662_10080467 | 3300025918 | Bacteria | 1987 |
| 203 | Ga0207662_10161626 | 3300025918 | Bacteria | 1431 |
| 204 | Ga0207657_10016654 | 3300025919 | Bacteria | 7083 |
| 205 | Ga0207657_10110623 | 3300025919 | Bacteria | 2269 |
| 206 | Ga0207657_10148861 | 3300025919 | Bacteria | 1908 |
| 207 | Ga0207657_10339029 | 3300025919 | Bacteria | 1187 |
| 208 | Ga0207649_10042695 | 3300025920 | Bacteria | 2767 |
| 209 | Ga0207681_10041172 | 3300025923 | Bacteria | 3079 |
| 210 | Ga0207681_10043852 | 3300025923 | Bacteria | 2995 |
| 211 | Ga0207650_10228079 | 3300025925 | Bacteria | 1501 |
| 212 | Ga0207687_10046601 | 3300025927 | Bacteria | 3002 |
| 213 | Ga0207687_10067202 | 3300025927 | Bacteria | 2549 |
| 214 | Ga0207664_10088133 | 3300025929 | Bacteria | 2539 |
| 215 | Ga0207690_10633015 | 3300025932 | Bacteria | 875 |
| 216 | Ga0207706_10002248 | 3300025933 | Bacteria | 18846 |
| 217 | Ga0207706_10018768 | 3300025933 | Bacteria | 6221 |
| 218 | Ga0207706_10141237 | 3300025933 | Bacteria | 2119 |
| 219 | Ga0207686_10004043 | 3300025934 | Bacteria | 7871 |
| 220 | Ga0207709_10000847 | 3300025935 | Bacteria | 23436 |
| 221 | Ga0207709_10005111 | 3300025935 | Bacteria | 7487 |
| 222 | Ga0207709_10041139 | 3300025935 | Bacteria | 2772 |
| 223 | Ga0207709_10493010 | 3300025935 | Bacteria | 955 |
| 224 | Ga0207669_10000415 | 3300025937 | Bacteria | 18644 |
| 225 | Ga0207704_10001734 | 3300025938 | Bacteria | 9768 |
| 226 | Ga0207704_10145272 | 3300025938 | Bacteria | 1665 |
| 227 | Ga0207665_10004881 | 3300025939 | Bacteria | 8932 |
| 228 | Ga0207665_10011581 | 3300025939 | Bacteria | 5794 |
| 229 | Ga0207691_10060056 | 3300025940 | Bacteria | 3456 |
| 230 | Ga0207691_10094757 | 3300025940 | Bacteria | 2671 |
| 231 | Ga0207711_10025825 | 3300025941 | Bacteria | 4926 |
| 232 | Ga0207689_10013030 | 3300025942 | Bacteria | 7101 |
| 233 | Ga0207689_10039005 | 3300025942 | Bacteria | 3933 |
| 234 | Ga0207661_10025346 | 3300025944 | Bacteria | 4505 |
| 235 | Ga0207679_10408654 | 3300025945 | Bacteria | 1195 |
| 236 | Ga0207667_10283732 | 3300025949 | Bacteria | 1692 |
| 237 | Ga0207712_10011563 | 3300025961 | Bacteria | 5627 |
| 238 | Ga0207712_10043739 | 3300025961 | Bacteria | 3091 |
| 239 | Ga0207668_10001507 | 3300025972 | Bacteria | 13605 |
| 240 | Ga0207668_10066434 | 3300025972 | Bacteria | 2556 |
| 241 | Ga0207668_10194091 | 3300025972 | Bacteria | 1612 |
| 242 | Ga0207640_10104352 | 3300025981 | Bacteria | 1995 |
| 243 | Ga0207658_10008270 | 3300025986 | Bacteria | 7087 |
| 244 | Ga0207677_10001154 | 3300026023 | Bacteria | 14427 |
| 245 | Ga0207677_10527602 | 3300026023 | Bacteria | 1025 |
| 246 | Ga0207703_10054377 | 3300026035 | Bacteria | 3255 |
| 247 | Ga0207703_10091869 | 3300026035 | Bacteria | 2554 |
| 248 | Ga0207703_10297715 | 3300026035 | Bacteria | 1470 |
| 249 | Ga0207639_10085012 | 3300026041 | Bacteria | 2515 |
| 250 | Ga0207678_10005497 | 3300026067 | Bacteria | 11325 |
| 251 | Ga0207678_10113249 | 3300026067 | Bacteria | 2314 |
| 252 | Ga0207708_10006801 | 3300026075 | Bacteria | 8458 |
| 253 | Ga0207708_10021675 | 3300026075 | Bacteria | 4846 |
| 254 | Ga0207708_10091546 | 3300026075 | Bacteria | 2345 |
| 255 | Ga0207702_10250253 | 3300026078 | Bacteria | 1664 |
| 256 | Ga0207641_10192383 | 3300026088 | Bacteria | 1876 |
| 257 | Ga0207648_10000451 | 3300026089 | Bacteria | 45574 |
| 258 | Ga0207648_10062672 | 3300026089 | Bacteria | 3241 |
| 259 | Ga0207676_10175007 | 3300026095 | Bacteria | 1873 |
| 260 | Ga0207676_10340958 | 3300026095 | Bacteria | 1383 |
| 261 | Ga0207674_10030169 | 3300026116 | Bacteria | 5704 |
| 262 | Ga0207674_10161084 | 3300026116 | Bacteria | 2198 |
| 263 | Ga0207675_100000675 | 3300026118 | Bacteria | 33655 |
| 264 | Ga0207675_100065912 | 3300026118 | Bacteria | 3384 |
| 265 | Ga0207675_100177904 | 3300026118 | Bacteria | 2036 |
| 266 | Ga0207683_10000665 | 3300026121 | Bacteria | 31567 |
| 267 | Ga0207698_10136542 | 3300026142 | Bacteria | 2105 |
| 268 | Ga0268266_10097528 | 3300028379 | Bacteria | 2585 |
| 269 | Ga0268266_10127164 | 3300028379 | Bacteria | 2275 |
| 270 | Ga0268265_10023821 | 3300028380 | Bacteria | 4321 |
| 271 | Ga0268265_10048416 | 3300028380 | Bacteria | 3191 |
| 272 | Ga0268265_10119488 | 3300028380 | Bacteria | 2168 |
| 273 | Ga0268264_10009940 | 3300028381 | Bacteria | 7877 |
| 274 | Ga0307513_10023143 | 3300031456 | Bacteria | 7269 |
| 275 | Ga0307408_100048510 | 3300031548 | Bacteria | 3046 |
| 276 | Ga0307408_100065338 | 3300031548 | Bacteria | 2668 |
| 277 | Ga0307405_10335492 | 3300031731 | Bacteria | 1160 |
| 278 | Ga0307413_10030548 | 3300031824 | Bacteria | 3028 |
| 279 | Ga0307410_10034455 | 3300031852 | Bacteria | 3279 |
| 280 | Ga0307410_10044113 | 3300031852 | Bacteria | 2960 |
| 281 | Ga0307410_10049601 | 3300031852 | Bacteria | 2819 |
| 282 | Ga0307410_10128250 | 3300031852 | Bacteria | 1860 |
| 283 | Ga0307406_10069778 | 3300031901 | Bacteria | 2299 |
| 284 | Ga0307406_10100195 | 3300031901 | Bacteria | 1971 |
| 285 | Ga0307406_10493489 | 3300031901 | Bacteria | 991 |
| 286 | Ga0307407_10039888 | 3300031903 | Bacteria | 2614 |
| 287 | Ga0307407_10041410 | 3300031903 | Bacteria | 2576 |
| 288 | Ga0307412_10178084 | 3300031911 | Bacteria | 1596 |
| 289 | Ga0307412_10248343 | 3300031911 | Bacteria | 1380 |
| 290 | Ga0307409_100017338 | 3300031995 | Bacteria | 4796 |
| 291 | Ga0307409_100195846 | 3300031995 | Bacteria | 1803 |
| 292 | Ga0307409_100224233 | 3300031995 | Bacteria | 1699 |
| 293 | Ga0307409_100398604 | 3300031995 | Bacteria | 1314 |
| 294 | Ga0307416_100089182 | 3300032002 | Bacteria | 2639 |
| 295 | Ga0307416_100093365 | 3300032002 | Bacteria | 2592 |
| 296 | Ga0307416_100388083 | 3300032002 | Bacteria | 1429 |
| 297 | Ga0307411_10058779 | 3300032005 | Bacteria | 2546 |
| 298 | Ga0307415_100012645 | 3300032126 | Bacteria | 4889 |
| 299 | Ga0373959_0020844 | 3300034820 | Bacteria | 1254 |
| 300 | Ga0373932_0056957 | 3300035112 | Bacteria | 1177 |
| 301 | Ga0373931_0036071 | 3300035691 | Bacteria | 2575 |
| 302 | Ga0395898_0079283 | 3300037466 | Bacteria | 3168 |
| 303 | Ga0395905_0545297 | 3300037471 | Bacteria | 1061 |
| 304 | Ga0395901_0033764 | 3300038443 | Bacteria | 5283 |
| 305 | Ga0395901_0268350 | 3300038443 | Bacteria | 1775 |
| 306 | Ga0439436_0001328 | 3300041404 | Bacteria | 7100 |
| 307 | Ga0439436_0002318 | 3300041404 | Bacteria | 5706 |
| 308 | Ga0439439_0004162 | 3300041406 | Bacteria | 3240 |
| 309 | Ga0439466_0004145 | 3300041411 | Bacteria | 5600 |
| 310 | Ga0439465_0000232 | 3300041413 | Bacteria | 15118 |
| 311 | Ga0439433_0001248 | 3300041999 | Bacteria | 5245 |
| 312 | Ga0439433_0004257 | 3300041999 | Bacteria | 3075 |
| 313 | Ga0439442_011160 | 3300042002 | Bacteria | 1826 |
| 314 | Ga0439449_0012247 | 3300042007 | Bacteria | 3223 |
| 315 | Ga0439457_000494 | 3300042014 | Bacteria | 11413 |
| 316 | Ga0439462_0015694 | 3300042015 | Bacteria | 1953 |
| 317 | Ga0450920_002837 | 3300042122 | Bacteria | 2978 |
| 318 | Ga0450907_009900 | 3300042146 | Bacteria | 1580 |
| 319 | Ga0439434_0018523 | 3300042435 | Bacteria | 2085 |
| 320 | Ga0450918_007770 | 3300042531 | Bacteria | 1890 |
| 321 | Ga0466972_0045486 | 3300044658 | Bacteria | 2127 |
| 322 | Ga0466965_0006924 | 3300044683 | Bacteria | 5187 |
| 323 | Ga0466963_0049092 | 3300044694 | Bacteria | 2790 |
| 324 | Ga0466968_0035061 | 3300044735 | Bacteria | 2098 |
| 325 | Ga0466970_0002435 | 3300044765 | Bacteria | 8991 |
| 326 | Ga0466957_0005197 | 3300044842 | Bacteria | 7280 |
| 327 | Ga0466958_0015523 | 3300045836 | Bacteria | 4366 |
| 328 | Ga0466967_0099958 | 3300045976 | Bacteria | 2650 |
| 329 | Ga0466967_0186015 | 3300045976 | Bacteria | 1961 |
| 330 | Ga0466967_0380737 | 3300045976 | Bacteria | 1370 |
| 331 | Ga0495653_0153238 | 3300046463 | Bacteria | 1608 |
| 332 | Ga0495680_0102246 | 3300047322 | Bacteria | 2134 |
| 333 | Ga0496100_0003360 | 3300048903 | Bacteria | 8330 |
| 334 | Ga0496101_0003844 | 3300048904 | Bacteria | 9389 |
| 335 | Ga0496101_0029499 | 3300048904 | Bacteria | 3837 |
| 336 | Ga0496101_0172589 | 3300048904 | Bacteria | 1662 |
| 337 | Ga0496102_0034243 | 3300048905 | Bacteria | 4567 |
| 338 | Ga0496102_0034939 | 3300048905 | Bacteria | 4524 |
| 339 | Ga0496103_0000325 | 3300048906 | Bacteria | 43734 |
| 340 | Ga0496103_0078879 | 3300048906 | Bacteria | 2068 |
| 341 | Ga0496104_0010014 | 3300048907 | Bacteria | 8461 |
| 342 | Ga0496104_0049970 | 3300048907 | Bacteria | 3945 |
| 343 | Ga0496104_0082036 | 3300048907 | Bacteria | 3075 |
| 344 | Ga0496104_0568820 | 3300048907 | Bacteria | 1044 |
| 345 | Ga0496105_0009916 | 3300048908 | Bacteria | 7471 |
| 346 | Ga0496105_0095135 | 3300048908 | Bacteria | 2460 |
| 347 | Ga0496105_0099961 | 3300048908 | Bacteria | 2396 |
| 348 | Ga0496106_0001168 | 3300048909 | Bacteria | 19521 |
| 349 | Ga0496107_0015680 | 3300048910 | Bacteria | 5312 |
| 350 | Ga0496107_0039223 | 3300048910 | Bacteria | 3397 |
| 351 | Ga0496107_0081152 | 3300048910 | Bacteria | 2365 |
| 352 | Ga0496108_0000188 | 3300048911 | Bacteria | 57492 |
| 353 | Ga0496108_0109096 | 3300048911 | Bacteria | 2365 |
| 354 | Ga0496108_0327042 | 3300048911 | Bacteria | 1337 |
| 355 | Ga0496108_0665284 | 3300048911 | Bacteria | 905 |
| 356 | Ga0496109_0009871 | 3300048912 | Bacteria | 8149 |
| 357 | Ga0496110_0136722 | 3300048913 | Bacteria | 2215 |
| 358 | Ga0496110_0143836 | 3300048913 | Bacteria | 2156 |
| 359 | Ga0496112_0009288 | 3300048915 | Bacteria | 8842 |
| 360 | Ga0496112_0309114 | 3300048915 | Bacteria | 1526 |
| 361 | Ga0496113_0012496 | 3300048916 | Bacteria | 5709 |
| 362 | Ga0496113_0320814 | 3300048916 | Bacteria | 1242 |
| 363 | Ga0496113_0368515 | 3300048916 | Bacteria | 1153 |
| 364 | Ga0496114_0001466 | 3300048917 | Bacteria | 17949 |
| 365 | Ga0496114_0003882 | 3300048917 | Bacteria | 11521 |
| 366 | Ga0496114_0270479 | 3300048917 | Bacteria | 1497 |
| 367 | Ga0496114_0304080 | 3300048917 | Bacteria | 1408 |
| 368 | Ga0496114_0323410 | 3300048917 | Bacteria | 1363 |
| 369 | Ga0496115_0002019 | 3300048918 | Bacteria | 14508 |
| 370 | Ga0496122_0000620 | 3300048925 | Bacteria | 72751 |
| 371 | Ga0496123_0000142 | 3300048926 | Bacteria | 146932 |
| 372 | Ga0496124_0000461 | 3300048927 | Bacteria | 70566 |
| 373 | Ga0501039_0114912 | 3300049575 | Bacteria | 2106 |
| 374 | Ga0501040_0025827 | 3300049576 | Bacteria | 3951 |
| 375 | Ga0501041_0022971 | 3300049577 | Bacteria | 3737 |
| 376 | Ga0501042_0006982 | 3300049578 | Bacteria | 7370 |
| 377 | Ga0501042_0053691 | 3300049578 | Bacteria | 2875 |
| 378 | Ga0501048_0020440 | 3300049582 | Bacteria | 4852 |
| 379 | Ga0501069_0031213 | 3300049585 | Bacteria | 2929 |
| 380 | Ga0501071_0005281 | 3300049587 | Bacteria | 8285 |
| 381 | Ga0501071_0058946 | 3300049587 | Bacteria | 2777 |
| 382 | Ga0501072_0054054 | 3300049588 | Bacteria | 3163 |
| 383 | Ga0501072_0160762 | 3300049588 | Bacteria | 1792 |
| 384 | Ga0501074_0117858 | 3300049590 | Bacteria | 1899 |
| 385 | Ga0501075_0026830 | 3300049591 | Bacteria | 4243 |
| 386 | Ga0501035_0032895 | 3300049822 | Bacteria | 4716 |
| 387 | Ga0501045_0075361 | 3300049824 | Bacteria | 2485 |
| 388 | nmdc:mga03683_3606_c1 | 3300050489 | Bacteria | 5023 |
| 389 | nmdc:mga03n38_114085_c1 | 3300050490 | Bacteria | 1320 |
| 390 | nmdc:mga03n38_9745_c1 | 3300050490 | Bacteria | 3505 |
| 391 | nmdc:mga0yw44_157753_c1 | 3300050492 | Bacteria | 1484 |
| 392 | nmdc:mga0yw44_159049_c1 | 3300050492 | Bacteria | 1478 |
| 393 | nmdc:mga07m45_126704_c1 | 3300050496 | Bacteria | 1477 |
| 394 | nmdc:mga07m45_25860_c2 | 3300050496 | Bacteria | 2013 |
| 395 | nmdc:mga07m45_27240_c1 | 3300050496 | Bacteria | 3147 |
| 396 | nmdc:mga05p37_15076_c1 | 3300050507 | Bacteria | 9280 |
| 397 | nmdc:mga09592_294774_c1 | 3300050508 | Bacteria | 1406 |
| 398 | nmdc:mga06r32_5161_c1 | 3300050510 | Bacteria | 11734 |
| 399 | nmdc:mga08y16_95453_c1 | 3300050511 | Bacteria | 3097 |
| 400 | nmdc:mga0rr50_224749_c1 | 3300050513 | Bacteria | 1551 |
| 401 | nmdc:mga0sz30_189652_c1 | 3300050516 | Bacteria | 912 |
| 402 | Ga0500644_0000400 | 3300053088 | Bacteria | 20643 |
| 403 | Ga0500616_0002550 | 3300053153 | Bacteria | 15012 |
| 404 | Ga0500616_0003900 | 3300053153 | Bacteria | 10973 |
| 405 | Ga0501082_0132969 | 3300060353 | Bacteria | 2158 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031548 | Ga0307408_100048510 | Ga0307408_1000485102 | 226 |
| 2 | 3300031852 | Ga0307410_10034455 | Ga0307410_100344551 | 226 |
| 3 | 3300031903 | Ga0307407_10039888 | Ga0307407_100398882 | 226 |
| 4 | 3300031995 | Ga0307409_100224233 | Ga0307409_1002242332 | 226 |
| 5 | 3300032002 | Ga0307416_100093365 | Ga0307416_1000933654 | 226 |
| 6 | 3300041404 | Ga0439436_0002318 | Ga0439436_0002318_4694_5539 | 226 |
| 7 | 3300041999 | Ga0439433_0004257 | Ga0439433_0004257_892_1740 | 226 |
| 8 | 3300031548 | Ga0307408_100065338 | Ga0307408_1000653382 | 227 |
| 9 | 3300031911 | Ga0307412_10178084 | Ga0307412_101780841 | 227 |
| 10 | 3300009148 | Ga0105243_10311154 | Ga0105243_103111541 | 231 |
| 11 | 3300050496 | nmdc:mga07m45_126704_c1 | nmdc:mga07m45_126704_c1_662_1429 | 231 |
| 12 | 3300042122 | Ga0450920_002837 | Ga0450920_002837_337_1182 | 232 |
| 13 | 3300042531 | Ga0450918_007770 | Ga0450918_007770_587_1432 | 232 |
| 14 | 3300048925 | Ga0496122_0000620 | Ga0496122_0000620_37627_38493 | 233 |
| 15 | 3300048926 | Ga0496123_0000142 | Ga0496123_0000142_24282_25148 | 233 |
| 16 | 3300048927 | Ga0496124_0000461 | Ga0496124_0000461_9004_9870 | 233 |
| 17 | 3300006914 | Ga0075436_100070836 | Ga0075436_1000708362 | 234 |
| 18 | 3300048911 | Ga0496108_0665284 | Ga0496108_0665284_120_887 | 237 |
| 19 | 3300005577 | Ga0068857_100251477 | Ga0068857_1002514772 | 242 |
| 20 | 3300005618 | Ga0068864_100361477 | Ga0068864_1003614772 | 242 |
| 21 | 3300006353 | Ga0075370_10058905 | Ga0075370_100589052 | 242 |
| 22 | 3300014325 | Ga0163163_10035304 | Ga0163163_100353042 | 242 |
| 23 | 3300025944 | Ga0207661_10025346 | Ga0207661_100253463 | 242 |
| 24 | 3300026095 | Ga0207676_10340958 | Ga0207676_103409582 | 242 |
| 25 | 3300026116 | Ga0207674_10030169 | Ga0207674_100301693 | 242 |
| 26 | 3300031852 | Ga0307410_10128250 | Ga0307410_101282502 | 243 |
| 27 | 3300048911 | Ga0496108_0109096 | Ga0496108_0109096_705_1559 | 243 |
| 28 | 3300048915 | Ga0496112_0309114 | Ga0496112_0309114_444_1265 | 243 |
| 29 | 3300005344 | Ga0070661_100037253 | Ga0070661_1000372533 | 244 |
| 30 | 3300025920 | Ga0207649_10042695 | Ga0207649_100426952 | 244 |
| 31 | 3300038443 | Ga0395901_0268350 | Ga0395901_0268350_851_1696 | 244 |
| 32 | 3300048907 | Ga0496104_0082036 | Ga0496104_0082036_1816_2673 | 244 |
| 33 | 3300048908 | Ga0496105_0095135 | Ga0496105_0095135_233_1090 | 244 |
| 34 | 3300048917 | Ga0496114_0003882 | Ga0496114_0003882_10203_11060 | 244 |
| 35 | 3300049578 | Ga0501042_0053691 | Ga0501042_0053691_953_1801 | 244 |
| 36 | 3300003578 | Ga0006562J51391_1052019 | Ga0006562J51391_10520192 | 245 |
| 37 | 3300006038 | Ga0075365_10057609 | Ga0075365_100576092 | 245 |
| 38 | 3300009148 | Ga0105243_10007046 | Ga0105243_1000704610 | 245 |
| 39 | 3300025935 | Ga0207709_10000847 | Ga0207709_1000084719 | 245 |
| 40 | 3300025935 | Ga0207709_10493010 | Ga0207709_104930101 | 245 |
| 41 | 3300048907 | Ga0496104_0010014 | Ga0496104_0010014_2717_3553 | 245 |
| 42 | 3300048908 | Ga0496105_0009916 | Ga0496105_0009916_2589_3425 | 245 |
| 43 | 3300048910 | Ga0496107_0039223 | Ga0496107_0039223_329_1165 | 245 |
| 44 | 3300048913 | Ga0496110_0143836 | Ga0496110_0143836_1266_2123 | 245 |
| 45 | 3300048916 | Ga0496113_0320814 | Ga0496113_0320814_157_1014 | 245 |
| 46 | 3300049575 | Ga0501039_0114912 | Ga0501039_0114912_830_1657 | 245 |
| 47 | 3300049576 | Ga0501040_0025827 | Ga0501040_0025827_904_1731 | 245 |
| 48 | 3300049577 | Ga0501041_0022971 | Ga0501041_0022971_1546_2373 | 245 |
| 49 | 3300049578 | Ga0501042_0006982 | Ga0501042_0006982_2968_3795 | 245 |
| 50 | 3300049582 | Ga0501048_0020440 | Ga0501048_0020440_1034_1861 | 245 |
| 51 | 3300049585 | Ga0501069_0031213 | Ga0501069_0031213_1534_2361 | 245 |
| 52 | 3300049587 | Ga0501071_0005281 | Ga0501071_0005281_6433_7260 | 245 |
| 53 | 3300049588 | Ga0501072_0054054 | Ga0501072_0054054_888_1715 | 245 |
| 54 | 3300049588 | Ga0501072_0160762 | Ga0501072_0160762_727_1557 | 245 |
| 55 | 3300049590 | Ga0501074_0117858 | Ga0501074_0117858_746_1573 | 245 |
| 56 | 3300049591 | Ga0501075_0026830 | Ga0501075_0026830_3051_3878 | 245 |
| 57 | 3300049822 | Ga0501035_0032895 | Ga0501035_0032895_3160_3987 | 245 |
| 58 | 3300049824 | Ga0501045_0075361 | Ga0501045_0075361_682_1509 | 245 |
| 59 | 3300050492 | nmdc:mga0yw44_157753_c1 | nmdc:mga0yw44_157753_c1_201_1019 | 245 |
| 60 | 3300053153 | Ga0500616_0003900 | Ga0500616_0003900_5533_6360 | 245 |
| 61 | 3300060353 | Ga0501082_0132969 | Ga0501082_0132969_1180_2007 | 245 |
| 62 | 3300005329 | Ga0070683_100211459 | Ga0070683_1002114591 | 246 |
| 63 | 3300005334 | Ga0068869_100095016 | Ga0068869_1000950162 | 246 |
| 64 | 3300005338 | Ga0068868_100011680 | Ga0068868_1000116803 | 246 |
| 65 | 3300005340 | Ga0070689_100209558 | Ga0070689_1002095581 | 246 |
| 66 | 3300005343 | Ga0070687_100143129 | Ga0070687_1001431292 | 246 |
| 67 | 3300005344 | Ga0070661_100073718 | Ga0070661_1000737183 | 246 |
| 68 | 3300005347 | Ga0070668_100006216 | Ga0070668_1000062168 | 246 |
| 69 | 3300005366 | Ga0070659_100055325 | Ga0070659_1000553252 | 246 |
| 70 | 3300005441 | Ga0070700_100072524 | Ga0070700_1000725242 | 246 |
| 71 | 3300005455 | Ga0070663_100002830 | Ga0070663_1000028308 | 246 |
| 72 | 3300005457 | Ga0070662_100082120 | Ga0070662_1000821202 | 246 |
| 73 | 3300005563 | Ga0068855_100083338 | Ga0068855_1000833382 | 246 |
| 74 | 3300005564 | Ga0070664_100038748 | Ga0070664_1000387482 | 246 |
| 75 | 3300005617 | Ga0068859_100206503 | Ga0068859_1002065031 | 246 |
| 76 | 3300005618 | Ga0068864_100393159 | Ga0068864_1003931591 | 246 |
| 77 | 3300005719 | Ga0068861_100086783 | Ga0068861_1000867833 | 246 |
| 78 | 3300005719 | Ga0068861_100297011 | Ga0068861_1002970112 | 246 |
| 79 | 3300005719 | Ga0068861_100443067 | Ga0068861_1004430671 | 246 |
| 80 | 3300005844 | Ga0068862_100063572 | Ga0068862_1000635722 | 246 |
| 81 | 3300006353 | Ga0075370_10006480 | Ga0075370_100064805 | 246 |
| 82 | 3300006931 | Ga0097620_100206506 | Ga0097620_1002065061 | 246 |
| 83 | 3300009098 | Ga0105245_10241776 | Ga0105245_102417762 | 246 |
| 84 | 3300009148 | Ga0105243_10025148 | Ga0105243_100251482 | 246 |
| 85 | 3300009176 | Ga0105242_10214387 | Ga0105242_102143872 | 246 |
| 86 | 3300009551 | Ga0105238_10519097 | Ga0105238_105190971 | 246 |
| 87 | 3300013102 | Ga0157371_10066988 | Ga0157371_100669881 | 246 |
| 88 | 3300013307 | Ga0157372_10141641 | Ga0157372_101416412 | 246 |
| 89 | 3300014326 | Ga0157380_10074657 | Ga0157380_100746572 | 246 |
| 90 | 3300025901 | Ga0207688_10006156 | Ga0207688_100061561 | 246 |
| 91 | 3300025909 | Ga0207705_10317265 | Ga0207705_103172652 | 246 |
| 92 | 3300025914 | Ga0207671_10294918 | Ga0207671_102949181 | 246 |
| 93 | 3300025918 | Ga0207662_10080467 | Ga0207662_100804672 | 246 |
| 94 | 3300025918 | Ga0207662_10161626 | Ga0207662_101616262 | 246 |
| 95 | 3300025919 | Ga0207657_10016654 | Ga0207657_100166546 | 246 |
| 96 | 3300025923 | Ga0207681_10041172 | Ga0207681_100411722 | 246 |
| 97 | 3300025925 | Ga0207650_10228079 | Ga0207650_102280791 | 246 |
| 98 | 3300025927 | Ga0207687_10067202 | Ga0207687_100672022 | 246 |
| 99 | 3300025933 | Ga0207706_10141237 | Ga0207706_101412372 | 246 |
| 100 | 3300025942 | Ga0207689_10039005 | Ga0207689_100390052 | 246 |
| 101 | 3300025949 | Ga0207667_10283732 | Ga0207667_102837322 | 246 |
| 102 | 3300025961 | Ga0207712_10043739 | Ga0207712_100437393 | 246 |
| 103 | 3300025981 | Ga0207640_10104352 | Ga0207640_101043522 | 246 |
| 104 | 3300026035 | Ga0207703_10091869 | Ga0207703_100918692 | 246 |
| 105 | 3300026041 | Ga0207639_10085012 | Ga0207639_100850123 | 246 |
| 106 | 3300026067 | Ga0207678_10005497 | Ga0207678_1000549710 | 246 |
| 107 | 3300026075 | Ga0207708_10021675 | Ga0207708_100216755 | 246 |
| 108 | 3300026075 | Ga0207708_10091546 | Ga0207708_100915462 | 246 |
| 109 | 3300026078 | Ga0207702_10250253 | Ga0207702_102502531 | 246 |
| 110 | 3300026095 | Ga0207676_10175007 | Ga0207676_101750072 | 246 |
| 111 | 3300026116 | Ga0207674_10161084 | Ga0207674_101610842 | 246 |
| 112 | 3300026118 | Ga0207675_100065912 | Ga0207675_1000659123 | 246 |
| 113 | 3300026142 | Ga0207698_10136542 | Ga0207698_101365422 | 246 |
| 114 | 3300028379 | Ga0268266_10127164 | Ga0268266_101271642 | 246 |
| 115 | 3300028380 | Ga0268265_10048416 | Ga0268265_100484164 | 246 |
| 116 | 3300031852 | Ga0307410_10044113 | Ga0307410_100441132 | 246 |
| 117 | 3300031995 | Ga0307409_100398604 | Ga0307409_1003986041 | 246 |
| 118 | 3300048916 | Ga0496113_0368515 | Ga0496113_0368515_32_862 | 246 |
| 119 | 3300049587 | Ga0501071_0058946 | Ga0501071_0058946_304_1152 | 246 |
| 120 | 3300050511 | nmdc:mga08y16_95453_c1 | nmdc:mga08y16_95453_c1_1955_2785 | 246 |
| 121 | 3300006844 | Ga0075428_100002717 | Ga0075428_1000027174 | 247 |
| 122 | 3300006880 | Ga0075429_100325062 | Ga0075429_1003250621 | 247 |
| 123 | 3300009147 | Ga0114129_10007260 | Ga0114129_100072604 | 247 |
| 124 | 3300050507 | nmdc:mga05p37_15076_c1 | nmdc:mga05p37_15076_c1_6493_7422 | 247 |
| 125 | 3300050508 | nmdc:mga09592_294774_c1 | nmdc:mga09592_294774_c1_328_1257 | 247 |
| 126 | 3300053088 | Ga0500644_0000400 | Ga0500644_0000400_10251_11087 | 247 |
| 127 | 3300005337 | Ga0070682_100038847 | Ga0070682_1000388471 | 248 |
| 128 | 3300005434 | Ga0070709_10244956 | Ga0070709_102449561 | 248 |
| 129 | 3300005616 | Ga0068852_100867396 | Ga0068852_1008673961 | 248 |
| 130 | 3300025919 | Ga0207657_10110623 | Ga0207657_101106233 | 248 |
| 131 | 3300025945 | Ga0207679_10408654 | Ga0207679_104086542 | 248 |
| 132 | 3300031824 | Ga0307413_10030548 | Ga0307413_100305482 | 248 |
| 133 | 3300031852 | Ga0307410_10049601 | Ga0307410_100496012 | 248 |
| 134 | 3300031901 | Ga0307406_10100195 | Ga0307406_101001953 | 248 |
| 135 | 3300031903 | Ga0307407_10041410 | Ga0307407_100414103 | 248 |
| 136 | 3300031995 | Ga0307409_100195846 | Ga0307409_1001958462 | 248 |
| 137 | 3300032002 | Ga0307416_100089182 | Ga0307416_1000891823 | 248 |
| 138 | 3300032126 | Ga0307415_100012645 | Ga0307415_1000126451 | 248 |
| 139 | 3300037466 | Ga0395898_0079283 | Ga0395898_0079283_950_1798 | 248 |
| 140 | 3300037471 | Ga0395905_0545297 | Ga0395905_0545297_115_963 | 248 |
| 141 | 3300038443 | Ga0395901_0033764 | Ga0395901_0033764_2405_3253 | 248 |
| 142 | 3300045976 | Ga0466967_0099958 | Ga0466967_0099958_863_1699 | 248 |
| 143 | 3300048911 | Ga0496108_0327042 | Ga0496108_0327042_283_1119 | 248 |
| 144 | 3300048917 | Ga0496114_0323410 | Ga0496114_0323410_265_1104 | 248 |
| 145 | 3300013308 | Ga0157375_10206026 | Ga0157375_102060262 | 249 |
| 146 | 3300045976 | Ga0466967_0380737 | Ga0466967_0380737_475_1332 | 249 |
| 147 | 3300046463 | Ga0495653_0153238 | Ga0495653_0153238_68_907 | 249 |
| 148 | 3300047322 | Ga0495680_0102246 | Ga0495680_0102246_548_1387 | 249 |
| 149 | 3300053153 | Ga0500616_0002550 | Ga0500616_0002550_159_998 | 249 |
| 150 | iso_pu_bacteria | 2643221715 | 2644637337 | 249 |
| 151 | 3300002239 | JGI24034J26672_10001829 | JGI24034J26672_100018292 | 250 |
| 152 | 3300002244 | JGI24742J22300_10008545 | JGI24742J22300_100085452 | 250 |
| 153 | 3300005334 | Ga0068869_100347479 | Ga0068869_1003474791 | 250 |
| 154 | 3300005335 | Ga0070666_10005662 | Ga0070666_100056623 | 250 |
| 155 | 3300005336 | Ga0070680_100419797 | Ga0070680_1004197971 | 250 |
| 156 | 3300005337 | Ga0070682_100153915 | Ga0070682_1001539151 | 250 |
| 157 | 3300005338 | Ga0068868_100000265 | Ga0068868_10000026524 | 250 |
| 158 | 3300005341 | Ga0070691_10004731 | Ga0070691_100047314 | 250 |
| 159 | 3300005347 | Ga0070668_100001311 | Ga0070668_1000013117 | 250 |
| 160 | 3300005353 | Ga0070669_100016940 | Ga0070669_1000169403 | 250 |
| 161 | 3300005356 | Ga0070674_100002076 | Ga0070674_1000020762 | 250 |
| 162 | 3300005366 | Ga0070659_100102175 | Ga0070659_1001021751 | 250 |
| 163 | 3300005367 | Ga0070667_100000598 | Ga0070667_10000059822 | 250 |
| 164 | 3300005437 | Ga0070710_10000363 | Ga0070710_100003637 | 250 |
| 165 | 3300005438 | Ga0070701_10001855 | Ga0070701_100018553 | 250 |
| 166 | 3300005439 | Ga0070711_100000211 | Ga0070711_1000002115 | 250 |
| 167 | 3300005441 | Ga0070700_100002877 | Ga0070700_1000028773 | 250 |
| 168 | 3300005455 | Ga0070663_100005482 | Ga0070663_1000054823 | 250 |
| 169 | 3300005456 | Ga0070678_100013469 | Ga0070678_1000134692 | 250 |
| 170 | 3300005459 | Ga0068867_100001676 | Ga0068867_10000167611 | 250 |
| 171 | 3300005539 | Ga0068853_100011257 | Ga0068853_1000112575 | 250 |
| 172 | 3300005543 | Ga0070672_100069501 | Ga0070672_1000695011 | 250 |
| 173 | 3300005545 | Ga0070695_100005767 | Ga0070695_1000057673 | 250 |
| 174 | 3300005546 | Ga0070696_100008236 | Ga0070696_1000082363 | 250 |
| 175 | 3300005548 | Ga0070665_100050768 | Ga0070665_1000507683 | 250 |
| 176 | 3300005549 | Ga0070704_100002418 | Ga0070704_1000024183 | 250 |
| 177 | 3300005578 | Ga0068854_100000759 | Ga0068854_1000007593 | 250 |
| 178 | 3300005615 | Ga0070702_100001149 | Ga0070702_1000011492 | 250 |
| 179 | 3300005617 | Ga0068859_100000995 | Ga0068859_1000009954 | 250 |
| 180 | 3300005718 | Ga0068866_10000103 | Ga0068866_1000010320 | 250 |
| 181 | 3300005719 | Ga0068861_100000166 | Ga0068861_1000001667 | 250 |
| 182 | 3300005842 | Ga0068858_100007032 | Ga0068858_1000070327 | 250 |
| 183 | 3300005843 | Ga0068860_100005999 | Ga0068860_1000059992 | 250 |
| 184 | 3300005844 | Ga0068862_100002488 | Ga0068862_1000024889 | 250 |
| 185 | 3300005937 | Ga0081455_10034137 | Ga0081455_100341372 | 250 |
| 186 | 3300006163 | Ga0070715_10001324 | Ga0070715_100013242 | 250 |
| 187 | 3300006173 | Ga0070716_100001550 | Ga0070716_1000015504 | 250 |
| 188 | 3300006175 | Ga0070712_100000214 | Ga0070712_10000021411 | 250 |
| 189 | 3300006237 | Ga0097621_100069391 | Ga0097621_1000693912 | 250 |
| 190 | 3300006358 | Ga0068871_100108713 | Ga0068871_1001087132 | 250 |
| 191 | 3300006881 | Ga0068865_100000672 | Ga0068865_1000006722 | 250 |
| 192 | 3300006931 | Ga0097620_100000995 | Ga0097620_10000099521 | 250 |
| 193 | 3300009098 | Ga0105245_10019369 | Ga0105245_100193694 | 250 |
| 194 | 3300009101 | Ga0105247_10000279 | Ga0105247_1000027919 | 250 |
| 195 | 3300009148 | Ga0105243_10002691 | Ga0105243_100026919 | 250 |
| 196 | 3300009176 | Ga0105242_10000551 | Ga0105242_1000055121 | 250 |
| 197 | 3300009177 | Ga0105248_10017005 | Ga0105248_100170053 | 250 |
| 198 | 3300009545 | Ga0105237_10049408 | Ga0105237_100494082 | 250 |
| 199 | 3300009553 | Ga0105249_10002292 | Ga0105249_100022927 | 250 |
| 200 | 3300010375 | Ga0105239_10004339 | Ga0105239_1000433913 | 250 |
| 201 | 3300013296 | Ga0157374_10008517 | Ga0157374_100085173 | 250 |
| 202 | 3300013297 | Ga0157378_10000675 | Ga0157378_1000067510 | 250 |
| 203 | 3300013306 | Ga0163162_10007269 | Ga0163162_100072693 | 250 |
| 204 | 3300013307 | Ga0157372_10015788 | Ga0157372_100157884 | 250 |
| 205 | 3300013308 | Ga0157375_10002974 | Ga0157375_100029747 | 250 |
| 206 | 3300014326 | Ga0157380_10003537 | Ga0157380_100035374 | 250 |
| 207 | 3300014968 | Ga0157379_10000781 | Ga0157379_1000078117 | 250 |
| 208 | 3300014969 | Ga0157376_10313825 | Ga0157376_103138251 | 250 |
| 209 | 3300017792 | Ga0163161_10001407 | Ga0163161_1000140715 | 250 |
| 210 | 3300025898 | Ga0207692_10000585 | Ga0207692_100005853 | 250 |
| 211 | 3300025900 | Ga0207710_10004251 | Ga0207710_100042512 | 250 |
| 212 | 3300025901 | Ga0207688_10000462 | Ga0207688_1000046214 | 250 |
| 213 | 3300025905 | Ga0207685_10001136 | Ga0207685_100011362 | 250 |
| 214 | 3300025907 | Ga0207645_10006630 | Ga0207645_100066303 | 250 |
| 215 | 3300025915 | Ga0207693_10000320 | Ga0207693_1000032025 | 250 |
| 216 | 3300025916 | Ga0207663_10010055 | Ga0207663_100100552 | 250 |
| 217 | 3300025919 | Ga0207657_10339029 | Ga0207657_103390291 | 250 |
| 218 | 3300025923 | Ga0207681_10043852 | Ga0207681_100438522 | 250 |
| 219 | 3300025933 | Ga0207706_10002248 | Ga0207706_1000224813 | 250 |
| 220 | 3300025934 | Ga0207686_10004043 | Ga0207686_100040434 | 250 |
| 221 | 3300025935 | Ga0207709_10005111 | Ga0207709_100051112 | 250 |
| 222 | 3300025937 | Ga0207669_10000415 | Ga0207669_100004152 | 250 |
| 223 | 3300025938 | Ga0207704_10001734 | Ga0207704_100017344 | 250 |
| 224 | 3300025939 | Ga0207665_10004881 | Ga0207665_100048813 | 250 |
| 225 | 3300025940 | Ga0207691_10060056 | Ga0207691_100600563 | 250 |
| 226 | 3300025941 | Ga0207711_10025825 | Ga0207711_100258253 | 250 |
| 227 | 3300025961 | Ga0207712_10011563 | Ga0207712_100115632 | 250 |
| 228 | 3300025972 | Ga0207668_10066434 | Ga0207668_100664341 | 250 |
| 229 | 3300025986 | Ga0207658_10008270 | Ga0207658_100082704 | 250 |
| 230 | 3300026023 | Ga0207677_10001154 | Ga0207677_1000115410 | 250 |
| 231 | 3300026035 | Ga0207703_10054377 | Ga0207703_100543772 | 250 |
| 232 | 3300026089 | Ga0207648_10000451 | Ga0207648_1000045127 | 250 |
| 233 | 3300026118 | Ga0207675_100000675 | Ga0207675_1000006757 | 250 |
| 234 | 3300026121 | Ga0207683_10000665 | Ga0207683_1000066514 | 250 |
| 235 | 3300028379 | Ga0268266_10097528 | Ga0268266_100975282 | 250 |
| 236 | 3300028380 | Ga0268265_10023821 | Ga0268265_100238212 | 250 |
| 237 | 3300028381 | Ga0268264_10009940 | Ga0268264_100099405 | 250 |
| 238 | 3300032002 | Ga0307416_100388083 | Ga0307416_1003880832 | 250 |
| 239 | 3300034820 | Ga0373959_0020844 | Ga0373959_0020844_49_936 | 250 |
| 240 | 3300035112 | Ga0373932_0056957 | Ga0373932_0056957_117_1004 | 250 |
| 241 | 3300041404 | Ga0439436_0001328 | Ga0439436_0001328_3719_4564 | 250 |
| 242 | 3300041406 | Ga0439439_0004162 | Ga0439439_0004162_293_1138 | 250 |
| 243 | 3300041999 | Ga0439433_0001248 | Ga0439433_0001248_2446_3291 | 250 |
| 244 | 3300042007 | Ga0439449_0012247 | Ga0439449_0012247_1908_2753 | 250 |
| 245 | 3300042014 | Ga0439457_000494 | Ga0439457_000494_8564_9409 | 250 |
| 246 | 3300042015 | Ga0439462_0015694 | Ga0439462_0015694_586_1431 | 250 |
| 247 | 3300042146 | Ga0450907_009900 | Ga0450907_009900_402_1247 | 250 |
| 248 | 3300048903 | Ga0496100_0003360 | Ga0496100_0003360_3147_4034 | 250 |
| 249 | 3300048904 | Ga0496101_0003844 | Ga0496101_0003844_3475_4362 | 250 |
| 250 | 3300048905 | Ga0496102_0034243 | Ga0496102_0034243_3648_4535 | 250 |
| 251 | 3300048906 | Ga0496103_0000325 | Ga0496103_0000325_25831_26727 | 250 |
| 252 | 3300048909 | Ga0496106_0001168 | Ga0496106_0001168_15964_16851 | 250 |
| 253 | 3300048910 | Ga0496107_0015680 | Ga0496107_0015680_3392_4279 | 250 |
| 254 | 3300048917 | Ga0496114_0001466 | Ga0496114_0001466_8274_9161 | 250 |
| 255 | 3300048918 | Ga0496115_0002019 | Ga0496115_0002019_11881_12768 | 250 |
| 256 | 3300005616 | Ga0068852_100182574 | Ga0068852_1001825742 | 251 |
| 257 | 3300044658 | Ga0466972_0045486 | Ga0466972_0045486_277_1104 | 251 |
| 258 | 3300044683 | Ga0466965_0006924 | Ga0466965_0006924_2631_3458 | 251 |
| 259 | 3300044694 | Ga0466963_0049092 | Ga0466963_0049092_1951_2778 | 251 |
| 260 | 3300044735 | Ga0466968_0035061 | Ga0466968_0035061_1162_1989 | 251 |
| 261 | 3300044765 | Ga0466970_0002435 | Ga0466970_0002435_5533_6360 | 251 |
| 262 | 3300044842 | Ga0466957_0005197 | Ga0466957_0005197_3226_4053 | 251 |
| 263 | 3300045836 | Ga0466958_0015523 | Ga0466958_0015523_1022_1849 | 251 |
| 264 | 3300031456 | Ga0307513_10023143 | Ga0307513_100231433 | 252 |
| 265 | 3300031731 | Ga0307405_10335492 | Ga0307405_103354921 | 252 |
| 266 | 3300031901 | Ga0307406_10069778 | Ga0307406_100697784 | 252 |
| 267 | 3300031911 | Ga0307412_10248343 | Ga0307412_102483432 | 252 |
| 268 | 3300031995 | Ga0307409_100017338 | Ga0307409_1000173386 | 252 |
| 269 | 3300032005 | Ga0307411_10058779 | Ga0307411_100587792 | 252 |
| 270 | 3300045976 | Ga0466967_0186015 | Ga0466967_0186015_458_1324 | 252 |
| 271 | 3300050510 | nmdc:mga06r32_5161_c1 | nmdc:mga06r32_5161_c1_436_1257 | 252 |
| 272 | 3300005347 | Ga0070668_100282013 | Ga0070668_1002820132 | 253 |
| 273 | 3300005455 | Ga0070663_100468546 | Ga0070663_1004685461 | 253 |
| 274 | 3300005618 | Ga0068864_100115086 | Ga0068864_1001150862 | 253 |
| 275 | 3300006178 | Ga0075367_10136294 | Ga0075367_101362942 | 253 |
| 276 | 3300006353 | Ga0075370_10003922 | Ga0075370_100039222 | 253 |
| 277 | 3300006353 | Ga0075370_10056944 | Ga0075370_100569442 | 253 |
| 278 | 3300031901 | Ga0307406_10493489 | Ga0307406_104934891 | 253 |
| 279 | 3300048904 | Ga0496101_0029499 | Ga0496101_0029499_1873_2703 | 253 |
| 280 | 3300048905 | Ga0496102_0034939 | Ga0496102_0034939_2867_3697 | 253 |
| 281 | 3300048907 | Ga0496104_0568820 | Ga0496104_0568820_169_999 | 253 |
| 282 | 3300048917 | Ga0496114_0270479 | Ga0496114_0270479_172_1002 | 253 |
| 283 | 3300050513 | nmdc:mga0rr50_224749_c1 | nmdc:mga0rr50_224749_c1_191_1024 | 253 |
| 284 | 3300050516 | nmdc:mga0sz30_189652_c1 | nmdc:mga0sz30_189652_c1_22_852 | 253 |
| 285 | 3300005338 | Ga0068868_100131678 | Ga0068868_1001316781 | 256 |
| 286 | 3300006048 | Ga0075363_100003724 | Ga0075363_1000037244 | 256 |
| 287 | 3300006177 | Ga0075362_10041675 | Ga0075362_100416752 | 256 |
| 288 | 3300041411 | Ga0439466_0004145 | Ga0439466_0004145_1457_2281 | 256 |
| 289 | 3300041413 | Ga0439465_0000232 | Ga0439465_0000232_14206_15030 | 256 |
| 290 | 3300042002 | Ga0439442_011160 | Ga0439442_011160_714_1538 | 256 |
| 291 | 3300042435 | Ga0439434_0018523 | Ga0439434_0018523_536_1360 | 256 |
| 292 | 3300050489 | nmdc:mga03683_3606_c1 | nmdc:mga03683_3606_c1_3329_4156 | 256 |
| 293 | 3300050490 | nmdc:mga03n38_114085_c1 | nmdc:mga03n38_114085_c1_378_1205 | 256 |
| 294 | 3300050492 | nmdc:mga0yw44_159049_c1 | nmdc:mga0yw44_159049_c1_103_930 | 256 |
| 295 | 3300050496 | nmdc:mga07m45_25860_c2 | nmdc:mga07m45_25860_c2_944_1771 | 256 |
| 296 | 3300006048 | Ga0075363_100005658 | Ga0075363_1000056582 | 257 |
| 297 | 3300006051 | Ga0075364_10003110 | Ga0075364_100031108 | 257 |
| 298 | 3300006353 | Ga0075370_10003127 | Ga0075370_100031277 | 257 |
| 299 | 3300013306 | Ga0163162_10155899 | Ga0163162_101558992 | 257 |
| 300 | 3300014326 | Ga0157380_10570466 | Ga0157380_105704661 | 257 |
| 301 | 3300025972 | Ga0207668_10194091 | Ga0207668_101940911 | 257 |
| 302 | 3300050490 | nmdc:mga03n38_9745_c1 | nmdc:mga03n38_9745_c1_2009_2845 | 257 |
| 303 | 3300050496 | nmdc:mga07m45_27240_c1 | nmdc:mga07m45_27240_c1_876_1712 | 257 |
| 304 | 3300001977 | JGI24746J21847_1006224 | JGI24746J21847_10062241 | 258 |
| 305 | 3300002075 | JGI24738J21930_10012369 | JGI24738J21930_100123692 | 258 |
| 306 | 3300005328 | Ga0070676_10185450 | Ga0070676_101854502 | 258 |
| 307 | 3300005334 | Ga0068869_100034883 | Ga0068869_1000348832 | 258 |
| 308 | 3300005336 | Ga0070680_100244133 | Ga0070680_1002441332 | 258 |
| 309 | 3300005339 | Ga0070660_100134844 | Ga0070660_1001348441 | 258 |
| 310 | 3300005340 | Ga0070689_100059988 | Ga0070689_1000599883 | 258 |
| 311 | 3300005341 | Ga0070691_10092072 | Ga0070691_100920721 | 258 |
| 312 | 3300005343 | Ga0070687_100321932 | Ga0070687_1003219321 | 258 |
| 313 | 3300005345 | Ga0070692_10014647 | Ga0070692_100146472 | 258 |
| 314 | 3300005347 | Ga0070668_100000135 | Ga0070668_10000013526 | 258 |
| 315 | 3300005347 | Ga0070668_100025280 | Ga0070668_1000252803 | 258 |
| 316 | 3300005354 | Ga0070675_100589565 | Ga0070675_1005895651 | 258 |
| 317 | 3300005356 | Ga0070674_100035308 | Ga0070674_1000353083 | 258 |
| 318 | 3300005364 | Ga0070673_100112499 | Ga0070673_1001124991 | 258 |
| 319 | 3300005366 | Ga0070659_100061127 | Ga0070659_1000611271 | 258 |
| 320 | 3300005367 | Ga0070667_100057982 | Ga0070667_1000579823 | 258 |
| 321 | 3300005434 | Ga0070709_10008111 | Ga0070709_100081113 | 258 |
| 322 | 3300005435 | Ga0070714_100069130 | Ga0070714_1000691303 | 258 |
| 323 | 3300005437 | Ga0070710_10002347 | Ga0070710_100023473 | 258 |
| 324 | 3300005439 | Ga0070711_100002072 | Ga0070711_1000020726 | 258 |
| 325 | 3300005440 | Ga0070705_100059622 | Ga0070705_1000596221 | 258 |
| 326 | 3300005441 | Ga0070700_100066027 | Ga0070700_1000660272 | 258 |
| 327 | 3300005444 | Ga0070694_100118845 | Ga0070694_1001188452 | 258 |
| 328 | 3300005455 | Ga0070663_100026072 | Ga0070663_1000260723 | 258 |
| 329 | 3300005456 | Ga0070678_100024907 | Ga0070678_1000249074 | 258 |
| 330 | 3300005457 | Ga0070662_100146829 | Ga0070662_1001468292 | 258 |
| 331 | 3300005459 | Ga0068867_100137036 | Ga0068867_1001370362 | 258 |
| 332 | 3300005544 | Ga0070686_100110360 | Ga0070686_1001103602 | 258 |
| 333 | 3300005546 | Ga0070696_100064708 | Ga0070696_1000647081 | 258 |
| 334 | 3300005547 | Ga0070693_100045307 | Ga0070693_1000453073 | 258 |
| 335 | 3300005548 | Ga0070665_100187800 | Ga0070665_1001878003 | 258 |
| 336 | 3300005549 | Ga0070704_100029570 | Ga0070704_1000295701 | 258 |
| 337 | 3300005578 | Ga0068854_100103921 | Ga0068854_1001039212 | 258 |
| 338 | 3300005614 | Ga0068856_100255571 | Ga0068856_1002555712 | 258 |
| 339 | 3300005615 | Ga0070702_100024059 | Ga0070702_1000240591 | 258 |
| 340 | 3300005616 | Ga0068852_100022727 | Ga0068852_1000227273 | 258 |
| 341 | 3300005617 | Ga0068859_100097166 | Ga0068859_1000971663 | 258 |
| 342 | 3300005718 | Ga0068866_10034986 | Ga0068866_100349862 | 258 |
| 343 | 3300005719 | Ga0068861_100133546 | Ga0068861_1001335462 | 258 |
| 344 | 3300005842 | Ga0068858_100016466 | Ga0068858_1000164664 | 258 |
| 345 | 3300005843 | Ga0068860_100816144 | Ga0068860_1008161442 | 258 |
| 346 | 3300006173 | Ga0070716_100003938 | Ga0070716_1000039384 | 258 |
| 347 | 3300006237 | Ga0097621_100035884 | Ga0097621_1000358843 | 258 |
| 348 | 3300006881 | Ga0068865_100118213 | Ga0068865_1001182131 | 258 |
| 349 | 3300006931 | Ga0097620_100097172 | Ga0097620_1000971723 | 258 |
| 350 | 3300009098 | Ga0105245_10133820 | Ga0105245_101338203 | 258 |
| 351 | 3300009101 | Ga0105247_10005951 | Ga0105247_100059513 | 258 |
| 352 | 3300009148 | Ga0105243_10131536 | Ga0105243_101315361 | 258 |
| 353 | 3300009174 | Ga0105241_10123340 | Ga0105241_101233402 | 258 |
| 354 | 3300009176 | Ga0105242_10087347 | Ga0105242_100873472 | 258 |
| 355 | 3300009545 | Ga0105237_10102736 | Ga0105237_101027362 | 258 |
| 356 | 3300009551 | Ga0105238_10522953 | Ga0105238_105229532 | 258 |
| 357 | 3300010375 | Ga0105239_10062682 | Ga0105239_100626822 | 258 |
| 358 | 3300011119 | Ga0105246_10009201 | Ga0105246_100092012 | 258 |
| 359 | 3300013296 | Ga0157374_10090885 | Ga0157374_100908852 | 258 |
| 360 | 3300013306 | Ga0163162_10343467 | Ga0163162_103434672 | 258 |
| 361 | 3300014325 | Ga0163163_10296155 | Ga0163163_102961552 | 258 |
| 362 | 3300014326 | Ga0157380_10011514 | Ga0157380_100115146 | 258 |
| 363 | 3300014968 | Ga0157379_10021168 | Ga0157379_100211683 | 258 |
| 364 | 3300014969 | Ga0157376_10056195 | Ga0157376_100561954 | 258 |
| 365 | 3300017792 | Ga0163161_10031233 | Ga0163161_100312332 | 258 |
| 366 | 3300025898 | Ga0207692_10045352 | Ga0207692_100453523 | 258 |
| 367 | 3300025900 | Ga0207710_10011537 | Ga0207710_100115373 | 258 |
| 368 | 3300025901 | Ga0207688_10000373 | Ga0207688_100003735 | 258 |
| 369 | 3300025904 | Ga0207647_10007841 | Ga0207647_100078413 | 258 |
| 370 | 3300025905 | Ga0207685_10013669 | Ga0207685_100136693 | 258 |
| 371 | 3300025906 | Ga0207699_10017258 | Ga0207699_100172583 | 258 |
| 372 | 3300025907 | Ga0207645_10030420 | Ga0207645_100304204 | 258 |
| 373 | 3300025915 | Ga0207693_10001428 | Ga0207693_1000142811 | 258 |
| 374 | 3300025916 | Ga0207663_10022458 | Ga0207663_100224581 | 258 |
| 375 | 3300025918 | Ga0207662_10039946 | Ga0207662_100399461 | 258 |
| 376 | 3300025919 | Ga0207657_10148861 | Ga0207657_101488611 | 258 |
| 377 | 3300025927 | Ga0207687_10046601 | Ga0207687_100466012 | 258 |
| 378 | 3300025929 | Ga0207664_10088133 | Ga0207664_100881333 | 258 |
| 379 | 3300025932 | Ga0207690_10633015 | Ga0207690_106330151 | 258 |
| 380 | 3300025933 | Ga0207706_10018768 | Ga0207706_100187683 | 258 |
| 381 | 3300025935 | Ga0207709_10041139 | Ga0207709_100411392 | 258 |
| 382 | 3300025938 | Ga0207704_10145272 | Ga0207704_101452721 | 258 |
| 383 | 3300025939 | Ga0207665_10011581 | Ga0207665_100115812 | 258 |
| 384 | 3300025940 | Ga0207691_10094757 | Ga0207691_100947574 | 258 |
| 385 | 3300025942 | Ga0207689_10013030 | Ga0207689_100130304 | 258 |
| 386 | 3300025972 | Ga0207668_10001507 | Ga0207668_100015075 | 258 |
| 387 | 3300026023 | Ga0207677_10527602 | Ga0207677_105276021 | 258 |
| 388 | 3300026035 | Ga0207703_10297715 | Ga0207703_102977151 | 258 |
| 389 | 3300026067 | Ga0207678_10113249 | Ga0207678_101132492 | 258 |
| 390 | 3300026075 | Ga0207708_10006801 | Ga0207708_100068013 | 258 |
| 391 | 3300026088 | Ga0207641_10192383 | Ga0207641_101923831 | 258 |
| 392 | 3300026089 | Ga0207648_10062672 | Ga0207648_100626723 | 258 |
| 393 | 3300026118 | Ga0207675_100177904 | Ga0207675_1001779042 | 258 |
| 394 | 3300028380 | Ga0268265_10119488 | Ga0268265_101194883 | 258 |
| 395 | 3300035691 | Ga0373931_0036071 | Ga0373931_0036071_1009_1839 | 258 |
| 396 | 3300048904 | Ga0496101_0172589 | Ga0496101_0172589_78_908 | 258 |
| 397 | 3300048906 | Ga0496103_0078879 | Ga0496103_0078879_916_1746 | 258 |
| 398 | 3300048907 | Ga0496104_0049970 | Ga0496104_0049970_190_1020 | 258 |
| 399 | 3300048908 | Ga0496105_0099961 | Ga0496105_0099961_1145_1975 | 258 |
| 400 | 3300048910 | Ga0496107_0081152 | Ga0496107_0081152_924_1754 | 258 |
| 401 | 3300048911 | Ga0496108_0000188 | Ga0496108_0000188_13465_14295 | 258 |
| 402 | 3300048912 | Ga0496109_0009871 | Ga0496109_0009871_7275_8105 | 258 |
| 403 | 3300048913 | Ga0496110_0136722 | Ga0496110_0136722_757_1587 | 258 |
| 404 | 3300048915 | Ga0496112_0009288 | Ga0496112_0009288_2550_3380 | 258 |
| 405 | 3300048916 | Ga0496113_0012496 | Ga0496113_0012496_4800_5630 | 258 |
| 406 | 3300048917 | Ga0496114_0304080 | Ga0496114_0304080_564_1394 | 258 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cjt-assembly4.cif.gz_G | ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 | 0.857 | 23 | 134 |
| 3cjt-assembly8.cif.gz_O | ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 | 0.857 | 23 | 134 |
| 2nxj-assembly2.cif.gz_B | t.thermophilus ribosomal protein l11 methyltransferase (prma) in space group p 21 21 2 | 0.8565 | 23 | 134 |
| 3cjr-assembly1.cif.gz_A | ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11 (k39a) and inhibitor sinefungin. | 0.8557 | 23 | 134 |
| 3cjq-assembly2.cif.gz_D | ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 in space group p212121 | 0.8513 | 23 | 134 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q553T0_166_421_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9333 | 31 | 137 | 3.40.50.150 |
| af_O74198_45_292_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9269 | 31 | 137 | 3.40.50.150 |
| af_A0A0N7KI91_1_189_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9154 | 24 | 133 | 3.40.50.150 |
| af_A0A1D6FP61_65_209_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9136 | 33 | 83 | 3.40.50.150 |
| af_I1L8V0_149_258_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8951 | 92 | 134 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0GKN9-F1-model_v4 | Methyltransferase domain-containing protein | 0.9303 | 72 | 256 |
GO:0008757
GO:0032259 |
| AF-A0A6G9Y7I9-F1-model_v4 | Methyltransferase domain-containing protein | 0.9292 | 16 | 257 |
GO:0008168
GO:0032259 |
| AF-A0A7W0PXW5-F1-model_v4 | Methyltransferase domain-containing protein | 0.9225 | 34 | 133 |
GO:0008757
GO:0032259 |
| AF-X1H6Z5-F1-model_v4 | Methyltransferase domain-containing protein | 0.9193 | 32 | 91 |
|
| AF-A0A3N1CP95-F1-model_v4 | Methyltransferase family protein | 0.9155 | 19 | 134 |
GO:0008168
GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar