F436237

General Info

Members Datasets Scaffolds Average Seq Length
406 238 812 210

Family's Representative Sequence

Representative Sequence 3300027378|Ga0209981_1001661|Ga0209981_10016611
Length 231
Sequence MRPEAFVFDAYGTLYDVHSVAARCESNWPGKGAQLSLLWRTKQLEYTWQRSLMHRYAPFSTVTRDALAYSCEALKLELSAAQTEGLMGEYQKLSLYPDVVPTLEVLRARKAILSNGSPDMLLPLVKNSGLALDAVISVDELRIFKPAPQVYALAVEKLHLNHSKIGFVSSNCWDAMGAKSYGLRVYWINRTGAPVERRDGGYRLPGIDGAIDRDDRLVFVLAAADVGLDVA

Samples

Sample ID Description Type Environment
1 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
133 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
134 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
157 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
158 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
159 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
160 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
161 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
204 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.49
Rhizosphere 99.51
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209981_1001661 3300027378 Bacteria 2809
2 JGI25406J46586_10060400 3300003203 Bacteria 1227
3 Ga0065707_10235677 3300005295 Bacteria 1173
4 Ga0065707_10344648 3300005295 Bacteria 928
5 Ga0065707_10373518 3300005295 Bacteria 883
6 Ga0070676_10208420 3300005328 Bacteria 1285
7 Ga0070676_10514581 3300005328 Unclassified 852
8 Ga0070690_100000131 3300005330 Bacteria 38893
9 Ga0068869_100000392 3300005334 Bacteria 23853
10 Ga0070666_10181848 3300005335 Bacteria 1475
11 Ga0070680_100002214 3300005336 Bacteria 14332
12 Ga0070680_100277058 3300005336 Bacteria 1421
13 Ga0070682_100001688 3300005337 Bacteria 12256
14 Ga0068868_100000656 3300005338 Bacteria 23322
15 Ga0070689_100011268 3300005340 Bacteria 6401
16 Ga0070689_100058295 3300005340 Bacteria 2999
17 Ga0070689_100129368 3300005340 Bacteria 2024
18 Ga0070691_10000200 3300005341 Bacteria 20142
19 Ga0070691_10038016 3300005341 Bacteria 2272
20 Ga0070691_10181302 3300005341 Bacteria 1097
21 Ga0070687_100000175 3300005343 Bacteria 22196
22 Ga0070692_10007635 3300005345 Bacteria 4776
23 Ga0070692_10018010 3300005345 Bacteria 3388
24 Ga0070692_10053024 3300005345 Bacteria 2114
25 Ga0070668_100090128 3300005347 Bacteria 2416
26 Ga0070669_100003743 3300005353 Bacteria 10983
27 Ga0070675_100083730 3300005354 Bacteria 2663
28 Ga0070675_100177404 3300005354 Bacteria 1840
29 Ga0070703_10007984 3300005406 Bacteria 2975
30 Ga0070701_10000060 3300005438 Bacteria 29083
31 Ga0070701_10305420 3300005438 Unclassified 979
32 Ga0070705_100000431 3300005440 Bacteria 24090
33 Ga0070705_100014156 3300005440 Bacteria 4098
34 Ga0070700_100000587 3300005441 Bacteria 18243
35 Ga0070700_100000922 3300005441 Bacteria 14540
36 Ga0070694_100000136 3300005444 Bacteria 36787
37 Ga0070694_100113617 3300005444 Bacteria 1933
38 Ga0070694_100514970 3300005444 Bacteria 954
39 Ga0070694_100545374 3300005444 Bacteria 928
40 Ga0070662_100272514 3300005457 Bacteria 1367
41 Ga0070681_10002380 3300005458 Bacteria 17183
42 Ga0070681_10026556 3300005458 Bacteria 5820
43 Ga0068867_100001154 3300005459 Bacteria 18064
44 Ga0068867_100004652 3300005459 Bacteria 9656
45 Ga0070706_100676217 3300005467 Bacteria 958
46 Ga0070699_100029304 3300005518 Bacteria 4746
47 Ga0070699_100210522 3300005518 Bacteria 1730
48 Ga0070699_100596929 3300005518 Bacteria 1007
49 Ga0070679_100035035 3300005530 Bacteria 4978
50 Ga0070697_100005463 3300005536 Bacteria 9794
51 Ga0070697_100055593 3300005536 Bacteria 3218
52 Ga0070686_100000285 3300005544 Bacteria 34108
53 Ga0070686_100102387 3300005544 Bacteria 1937
54 Ga0070695_100000705 3300005545 Bacteria 17853
55 Ga0070695_100021377 3300005545 Bacteria 3958
56 Ga0070695_100061646 3300005545 Bacteria 2434
57 Ga0070695_100387793 3300005545 Bacteria 1056
58 Ga0070696_100002173 3300005546 Bacteria 12924
59 Ga0070696_100002841 3300005546 Bacteria 11515
60 Ga0070696_100032793 3300005546 Bacteria 3565
61 Ga0070696_100040289 3300005546 Bacteria 3225
62 Ga0070696_100095407 3300005546 Bacteria 2124
63 Ga0070693_100000278 3300005547 Bacteria 24050
64 Ga0070704_100000103 3300005549 Bacteria 29844
65 Ga0070704_100014933 3300005549 Bacteria 4862
66 Ga0068855_100001779 3300005563 Bacteria 26944
67 Ga0068854_100024622 3300005578 Bacteria 4124
68 Ga0068856_100162094 3300005614 Bacteria 2247
69 Ga0070702_100000039 3300005615 Bacteria 35203
70 Ga0070702_100070487 3300005615 Bacteria 2063
71 Ga0068852_101154356 3300005616 Bacteria 795
72 Ga0068859_100000420 3300005617 Bacteria 42401
73 Ga0068859_100249046 3300005617 Bacteria 1867
74 Ga0068859_100964139 3300005617 Unclassified 936
75 Ga0068864_100057814 3300005618 Bacteria 3351
76 Ga0068864_100063982 3300005618 Bacteria 3189
77 Ga0068866_10000153 3300005718 Bacteria 31527
78 Ga0068866_10052891 3300005718 Bacteria 2074
79 Ga0068861_100000399 3300005719 Bacteria 25138
80 Ga0068861_100002062 3300005719 Bacteria 13036
81 Ga0068870_10067982 3300005840 Bacteria 1935
82 Ga0068870_10184051 3300005840 Bacteria 1256
83 Ga0068858_100004592 3300005842 Bacteria 13518
84 Ga0068858_100185818 3300005842 Bacteria 1963
85 Ga0068860_100002528 3300005843 Bacteria 19155
86 Ga0068860_100134318 3300005843 Bacteria 2376
87 Ga0068862_100004066 3300005844 Bacteria 12403
88 Ga0068862_100108106 3300005844 Bacteria 2439
89 Ga0068862_100114512 3300005844 Bacteria 2370
90 Ga0068862_100282924 3300005844 Bacteria 1520
91 Ga0081539_10000668 3300005985 Bacteria 68754
92 Ga0070715_10021157 3300006163 Bacteria 2519
93 Ga0097621_100000754 3300006237 Bacteria 22721
94 Ga0068871_100003849 3300006358 Bacteria 10344
95 Ga0068871_100201393 3300006358 Bacteria 1719
96 Ga0075428_100004852 3300006844 Bacteria 14923
97 Ga0075430_100001797 3300006846 Bacteria 17542
98 Ga0075430_100007389 3300006846 Bacteria 9279
99 Ga0075430_100029485 3300006846 Bacteria 4658
100 Ga0075430_100463367 3300006846 Bacteria 1046
101 Ga0075430_100676982 3300006846 Unclassified 850
102 Ga0075431_100106215 3300006847 Bacteria 2897
103 Ga0075431_100342298 3300006847 Bacteria 1505
104 Ga0075431_100424374 3300006847 Bacteria 1329
105 Ga0075433_10002082 3300006852 Bacteria 15128
106 Ga0075433_10227660 3300006852 Bacteria 1656
107 Ga0075433_10265310 3300006852 Bacteria 1522
108 Ga0075434_100000083 3300006871 Bacteria 51151
109 Ga0075434_100001188 3300006871 Bacteria 21590
110 Ga0075429_100001365 3300006880 Bacteria 19968
111 Ga0075429_100248859 3300006880 Bacteria 1556
112 Ga0075429_100644858 3300006880 Bacteria 928
113 Ga0068865_100003371 3300006881 Bacteria 9571
114 Ga0075436_100000075 3300006914 Bacteria 59554
115 Ga0075436_100001949 3300006914 Bacteria 14215
116 Ga0075436_100044937 3300006914 Bacteria 3047
117 Ga0097620_100000420 3300006931 Bacteria 42401
118 Ga0097620_100249051 3300006931 Bacteria 1867
119 Ga0097620_100964192 3300006931 Unclassified 936
120 Ga0075435_100001823 3300007076 Bacteria 13853
121 Ga0075435_100003441 3300007076 Bacteria 10738
122 Ga0075435_100342063 3300007076 Bacteria 1282
123 Ga0099794_10102574 3300007265 Bacteria 1429
124 Ga0111539_10009727 3300009094 Bacteria 12137
125 Ga0111539_10040126 3300009094 Bacteria 5637
126 Ga0111539_10105400 3300009094 Bacteria 3308
127 Ga0111539_10303542 3300009094 Bacteria 1858
128 Ga0105245_10000533 3300009098 Bacteria 34922
129 Ga0114129_10002987 3300009147 Bacteria 23703
130 Ga0114129_10576668 3300009147 Bacteria 1460
131 Ga0114129_11836579 3300009147 Bacteria 736
132 Ga0105243_10000495 3300009148 Bacteria 40193
133 Ga0105243_10004025 3300009148 Bacteria 11702
134 Ga0105243_10271794 3300009148 Bacteria 1522
135 Ga0105241_10090861 3300009174 Bacteria 2408
136 Ga0105242_10000248 3300009176 Bacteria 42523
137 Ga0105248_10016564 3300009177 Bacteria 8117
138 Ga0105249_10010445 3300009553 Bacteria 8157
139 Ga0105249_10133318 3300009553 Bacteria 2374
140 Ga0105249_10438872 3300009553 Bacteria 1342
141 Ga0105239_10738908 3300010375 Bacteria 1126
142 Ga0157369_10593389 3300013105 Bacteria 1144
143 Ga0157378_10000387 3300013297 Bacteria 43542
144 Ga0157380_10011517 3300014326 Bacteria 6392
145 Ga0157380_10018418 3300014326 Bacteria 5183
146 Ga0157377_10015130 3300014745 Bacteria 3938
147 Ga0157377_10058532 3300014745 Bacteria 2194
148 Ga0157379_10252604 3300014968 Bacteria 1601
149 Ga0157376_10123037 3300014969 Bacteria 2303
150 Ga0207653_10024026 3300025885 Bacteria 1944
151 Ga0207642_10000130 3300025899 Bacteria 20678
152 Ga0207685_10110632 3300025905 Bacteria 1190
153 Ga0207699_10081153 3300025906 Bacteria 2011
154 Ga0207645_10053375 3300025907 Bacteria 2583
155 Ga0207645_10233998 3300025907 Bacteria 1213
156 Ga0207645_10246195 3300025907 Bacteria 1182
157 Ga0207643_10029671 3300025908 Bacteria 3043
158 Ga0207643_10038688 3300025908 Bacteria 2680
159 Ga0207654_10073787 3300025911 Bacteria 2034
160 Ga0207707_10018773 3300025912 Bacteria 6030
161 Ga0207660_10000756 3300025917 Bacteria 21503
162 Ga0207660_10019252 3300025917 Bacteria 4560
163 Ga0207660_10211533 3300025917 Bacteria 1519
164 Ga0207662_10000095 3300025918 Bacteria 41923
165 Ga0207662_10401224 3300025918 Bacteria 930
166 Ga0207652_10014727 3300025921 Bacteria 6338
167 Ga0207652_10415793 3300025921 Bacteria 1213
168 Ga0207687_10000432 3300025927 Bacteria 28412
169 Ga0207664_10235734 3300025929 Bacteria 1592
170 Ga0207686_10001368 3300025934 Bacteria 13851
171 Ga0207709_10001646 3300025935 Bacteria 15123
172 Ga0207670_10006597 3300025936 Bacteria 6447
173 Ga0207670_10033674 3300025936 Bacteria 3304
174 Ga0207670_10056599 3300025936 Bacteria 2656
175 Ga0207704_10000623 3300025938 Bacteria 15673
176 Ga0207704_10042461 3300025938 Bacteria 2677
177 Ga0207689_10000977 3300025942 Bacteria 27402
178 Ga0207667_10010601 3300025949 Bacteria 10766
179 Ga0207651_10103051 3300025960 Bacteria 2123
180 Ga0207651_10702254 3300025960 Bacteria 891
181 Ga0207712_10072467 3300025961 Bacteria 2481
182 Ga0207712_10186168 3300025961 Bacteria 1635
183 Ga0207640_10018911 3300025981 Bacteria 4058
184 Ga0207677_10000832 3300026023 Bacteria 17660
185 Ga0207677_10172422 3300026023 Bacteria 1693
186 Ga0207703_10005254 3300026035 Bacteria 10444
187 Ga0207708_10000551 3300026075 Bacteria 28958
188 Ga0207708_10003472 3300026075 Bacteria 11616
189 Ga0207702_10213788 3300026078 Bacteria 1794
190 Ga0207641_10371854 3300026088 Bacteria 1367
191 Ga0207648_10000513 3300026089 Bacteria 43298
192 Ga0207648_10001314 3300026089 Bacteria 27651
193 Ga0207676_10045889 3300026095 Bacteria 3378
194 Ga0207676_10052134 3300026095 Bacteria 3197
195 Ga0207675_100001063 3300026118 Bacteria 27254
196 Ga0207675_100004650 3300026118 Bacteria 13222
197 Ga0207683_10171311 3300026121 Bacteria 1966
198 Ga0209967_1003363 3300027364 Bacteria 2105
199 Ga0209967_1021337 3300027364 Bacteria 947
200 Ga0210000_1002653 3300027462 Bacteria 2549
201 Ga0209995_1019845 3300027471 Bacteria 1110
202 Ga0209968_1003562 3300027526 Bacteria 2335
203 Ga0209999_1005372 3300027543 Bacteria 2307
204 Ga0209999_1028061 3300027543 Bacteria 1043
205 Ga0209983_1031830 3300027665 Bacteria 1126
206 Ga0209971_1004120 3300027682 Bacteria 3444
207 Ga0209966_1007563 3300027695 Bacteria 1908
208 Ga0209966_1007678 3300027695 Bacteria 1896
209 Ga0209974_10091688 3300027876 Bacteria 1054
210 Ga0207428_10003903 3300027907 Bacteria 14300
211 Ga0207428_10033425 3300027907 Bacteria 4224
212 Ga0207428_10092364 3300027907 Bacteria 2349
213 Ga0268265_10017306 3300028380 Bacteria 4970
214 Ga0268265_10069514 3300028380 Bacteria 2734
215 Ga0268265_10147491 3300028380 Bacteria 1979
216 Ga0268264_10000827 3300028381 Bacteria 33217
217 Ga0307408_100234078 3300031548 Bacteria 1506
218 Ga0307405_10167942 3300031731 Bacteria 1562
219 Ga0307410_10143274 3300031852 Bacteria 1771
220 Ga0307410_10361420 3300031852 Bacteria 1163
221 Ga0307406_10316863 3300031901 Bacteria 1205
222 Ga0307412_10154924 3300031911 Bacteria 1695
223 Ga0307412_10846022 3300031911 Bacteria 798
224 Ga0307409_100511482 3300031995 Bacteria 1171
225 Ga0307416_100116510 3300032002 Bacteria 2369
226 Ga0307416_100235778 3300032002 Bacteria 1768
227 Ga0307416_101306914 3300032002 Bacteria 831
228 Ga0307411_10223568 3300032005 Bacteria 1462
229 Ga0373958_0031040 3300034819 Bacteria 1048
230 Ga0373926_0001711 3300035083 Bacteria 6796
231 Ga0373934_0000215 3300035086 Bacteria 21115
232 Ga0373949_0002595 3300035090 Bacteria 4580
233 Ga0373952_0048919 3300035092 Bacteria 1001
234 Ga0373932_0002574 3300035112 Bacteria 4536
235 Ga0373936_0028014 3300035113 Bacteria 2212
236 Ga0373939_0022149 3300035114 Bacteria 1748
237 Ga0373941_0060256 3300035115 Bacteria 1233
238 Ga0373945_0022349 3300035116 Bacteria 2177
239 Ga0373953_0018168 3300035117 Bacteria 2597
240 Ga0373954_0000012 3300035118 Bacteria 73616
241 Ga0373956_0008308 3300035119 Bacteria 4201
242 Ga0373957_0016230 3300035120 Bacteria 2576
243 Ga0373960_0042144 3300035121 Bacteria 1324
244 Ga0373943_0227164 3300035170 Bacteria 1041
245 Ga0373946_0032581 3300035171 Bacteria 2093
246 Ga0373946_0217523 3300035171 Bacteria 921
247 Ga0373955_0003377 3300035172 Bacteria 7019
248 Ga0373955_0256681 3300035172 Bacteria 1049
249 Ga0373942_0002028 3300035207 Bacteria 5033
250 Ga0373962_0042333 3300035242 Bacteria 1287
251 Ga0373931_0004111 3300035691 Bacteria 6604
252 Ga0373931_0007054 3300035691 Bacteria 5284
253 Ga0373931_0030351 3300035691 Bacteria 2782
254 Ga0373935_0099527 3300035692 Bacteria 1914
255 Ga0373927_0007478 3300035695 Bacteria 7387
256 Ga0373933_0001060 3300035724 Bacteria 16588
257 Ga0373933_0034411 3300035724 Bacteria 2953
258 Ga0373947_0035586 3300035725 Bacteria 2948
259 Ga0373937_0001168 3300036401 Bacteria 22061
260 Ga0373937_0012367 3300036401 Bacteria 7505
261 Ga0373937_0056429 3300036401 Bacteria 3607
262 Ga0373937_0127123 3300036401 Bacteria 2379
263 Ga0373925_0007381 3300037068 Bacteria 8019
264 Ga0373925_0038821 3300037068 Bacteria 3522
265 Ga0439453_0035618 3300041408 Bacteria 959
266 Ga0439441_003694 3300042001 Bacteria 2276
267 Ga0439441_012060 3300042001 Bacteria 1477
268 Ga0439441_034597 3300042001 Bacteria 993
269 Ga0450913_008019 3300042117 Bacteria 806
270 Ga0439435_0000074 3300042436 Bacteria 11894
271 Ga0439444_0000698 3300042437 Bacteria 3959
272 Ga0439444_0001777 3300042437 Bacteria 2853
273 Ga0439460_0003074 3300042461 Bacteria 4033
274 Ga0453684_1747566 3300044712 Bacteria 634
275 Ga0451576_0003270 3300045051 Bacteria 22501
276 Ga0451576_0044419 3300045051 Bacteria 4683
277 Ga0451576_0103050 3300045051 Bacteria 2968
278 Ga0451576_0209846 3300045051 Bacteria 2034
279 Ga0451576_0839116 3300045051 Bacteria 965
280 Ga0451576_1243479 3300045051 Bacteria 777
281 Ga0466967_0884909 3300045976 Bacteria 888
282 Ga0495592_0003983 3300046454 Bacteria 10710
283 Ga0495603_0006723 3300046455 Bacteria 6903
284 Ga0495651_0010755 3300046462 Bacteria 7036
285 Ga0495653_0283489 3300046463 Bacteria 1086
286 Ga0495580_0000775 3300046472 Bacteria 27515
287 Ga0495582_0021440 3300046473 Bacteria 3536
288 Ga0495639_0132658 3300046475 Bacteria 1193
289 Ga0495662_0002876 3300046476 Bacteria 8709
290 Ga0495662_0008313 3300046476 Bacteria 5105
291 Ga0495608_0004903 3300046511 Bacteria 9584
292 Ga0495628_0091404 3300046516 Bacteria 2355
293 Ga0495630_0009637 3300046517 Bacteria 6948
294 Ga0495630_0032900 3300046517 Bacteria 3866
295 Ga0495666_0103946 3300046526 Bacteria 1337
296 Ga0495652_0103659 3300046529 Bacteria 2302
297 Ga0495665_0051522 3300046531 Bacteria 2180
298 Ga0495640_0003336 3300046533 Bacteria 12925
299 Ga0495640_0131266 3300046533 Bacteria 1621
300 Ga0495586_0010045 3300046535 Bacteria 5038
301 Ga0495586_0049921 3300046535 Bacteria 2263
302 Ga0495667_0064878 3300046559 Bacteria 2388
303 Ga0495667_0178389 3300046559 Bacteria 1364
304 Ga0495656_0028663 3300046615 Bacteria 2235
305 Ga0495634_0017995 3300046642 Bacteria 5035
306 Ga0495635_0120172 3300046663 Bacteria 1792
307 Ga0495659_0210469 3300046664 Bacteria 800
308 Ga0495588_0005746 3300046674 Bacteria 5539
309 Ga0495657_0185431 3300046675 Bacteria 1274
310 Ga0495646_0256309 3300046680 Bacteria 936
311 Ga0495647_0002616 3300046681 Bacteria 5705
312 Ga0495658_0030293 3300046683 Bacteria 2937
313 Ga0495613_0017212 3300046689 Bacteria 5384
314 Ga0495624_0025076 3300046690 Bacteria 3920
315 Ga0495600_0016631 3300046809 Bacteria 4673
316 Ga0495581_0020785 3300047315 Bacteria 3808
317 Ga0495604_0019165 3300047317 Bacteria 5479
318 Ga0495636_0010951 3300047318 Bacteria 3591
319 Ga0495674_0040208 3300047319 Bacteria 4184
320 Ga0495676_0099850 3300047321 Bacteria 2150
321 Ga0495680_0000770 3300047322 Bacteria 35924
322 Ga0495684_0172117 3300047471 Bacteria 1610
323 Ga0496106_0332286 3300048909 Bacteria 1220
324 Ga0496115_0227729 3300048918 Unclassified 1538
325 Ga0501290_017019 3300049513 Bacteria 972
326 Ga0501298_026619 3300049521 Bacteria 1114
327 Ga0501031_0247553 3300049568 Bacteria 1158
328 Ga0501033_0383850 3300049570 Bacteria 981
329 Ga0501036_0111443 3300049572 Bacteria 2312
330 Ga0501037_0249178 3300049573 Bacteria 1243
331 Ga0501038_0120967 3300049574 Bacteria 2159
332 Ga0501038_0297114 3300049574 Bacteria 1268
333 Ga0501038_0503466 3300049574 Bacteria 926
334 Ga0501039_0032640 3300049575 Bacteria 4015
335 Ga0501039_0086874 3300049575 Bacteria 2436
336 Ga0501039_0157225 3300049575 Bacteria 1786
337 Ga0501040_0012474 3300049576 Bacteria 5569
338 Ga0501040_0022078 3300049576 Bacteria 4257
339 Ga0501042_0106077 3300049578 Bacteria 2022
340 Ga0501048_0009509 3300049582 Bacteria 7296
341 Ga0501067_0071893 3300049583 Bacteria 1916
342 Ga0501068_0717805 3300049584 Bacteria 654
343 Ga0501071_0013982 3300049587 Bacteria 5482
344 Ga0501071_0181186 3300049587 Bacteria 1578
345 Ga0501071_0200035 3300049587 Bacteria 1501
346 Ga0501071_0218232 3300049587 Bacteria 1435
347 Ga0501072_0029801 3300049588 Bacteria 4264
348 Ga0501072_0079027 3300049588 Bacteria 2605
349 Ga0501072_0174769 3300049588 Bacteria 1713
350 Ga0501072_0717276 3300049588 Bacteria 785
351 Ga0501075_0005270 3300049591 Bacteria 8835
352 Ga0501076_0038310 3300049592 Bacteria 3763
353 Ga0501076_0106635 3300049592 Bacteria 2262
354 Ga0501076_0365665 3300049592 Bacteria 1185
355 Ga0501076_0429525 3300049592 Bacteria 1087
356 Ga0501076_0967663 3300049592 Bacteria 701
357 Ga0501079_0020291 3300049741 Bacteria 5078
358 Ga0501080_0528751 3300049742 Bacteria 1052
359 Ga0501045_0007680 3300049824 Bacteria 7500
360 Ga0501045_0023545 3300049824 Bacteria 4417
361 Ga0501045_0292393 3300049824 Bacteria 1212
362 nmdc:mga05p37_1935_c1 3300050507 Bacteria 24113
363 nmdc:mga05p37_586459_c1 3300050507 Bacteria 1261
364 nmdc:mga05p37_696801_c1 3300050507 Bacteria 1129
365 nmdc:mga09592_1903_c1 3300050508 Bacteria 16783
366 nmdc:mga09592_278588_c1 3300050508 Bacteria 1450
367 nmdc:mga09592_453900_c1 3300050508 Bacteria 1106
368 nmdc:mga0qj67_188220_c1 3300050509 Bacteria 1677
369 nmdc:mga0qj67_24080_c1 3300050509 Bacteria 4690
370 nmdc:mga0qj67_29052_c1 3300050509 Bacteria 4293
371 nmdc:mga0qj67_505035_c1 3300050509 Bacteria 972
372 nmdc:mga0qj67_76581_c1 3300050509 Bacteria 2676
373 nmdc:mga06r32_159636_c1 3300050510 Bacteria 2237
374 nmdc:mga06r32_46315_c1 3300050510 Bacteria 4149
375 nmdc:mga06r32_591600_c1 3300050510 Bacteria 1081
376 nmdc:mga06r32_648886_c1 3300050510 Bacteria 1024
377 nmdc:mga06r32_67049_c1 3300050510 Bacteria 3464
378 nmdc:mga08y16_1053074_c1 3300050511 Bacteria 791
379 nmdc:mga08y16_21205_c1 3300050511 Bacteria 6861
380 nmdc:mga08y16_26260_c1 3300050511 Bacteria 6141
381 nmdc:mga08y16_3602_c1 3300050511 Bacteria 16080
382 nmdc:mga08y16_394299_c1 3300050511 Bacteria 1418
383 nmdc:mga08y16_72557_c1 3300050511 Bacteria 3587
384 nmdc:mga0n895_38108_c1 3300050512 Bacteria 4656
385 nmdc:mga0n895_4239_c1 3300050512 Bacteria 11727
386 nmdc:mga0n895_90_c1 3300050512 Bacteria 52593
387 nmdc:mga0rr50_18757_c1 3300050513 Bacteria 4655
388 nmdc:mga0rr50_2350_c1 3300050513 Bacteria 10641
389 nmdc:mga0rr50_2760_c1 3300050513 Bacteria 9977
390 nmdc:mga08x19_100474_c1 3300050514 Bacteria 1919
391 nmdc:mga08x19_1105_c1 3300050514 Bacteria 16812
392 nmdc:mga08x19_16924_c1 3300050514 Bacteria 4454
393 nmdc:mga0a205_27735_c2 3300050515 Bacteria 3111
394 nmdc:mga0a205_430338_c1 3300050515 Bacteria 1181
395 nmdc:mga0a205_5950_c1 3300050515 Bacteria 10996
396 Ga0495601_0093868 3300053077 Bacteria 1933
397 Ga0495601_0371779 3300053077 Bacteria 928
398 Ga0495619_0201683 3300053085 Bacteria 1377
399 Ga0501084_0245603 3300054114 Bacteria 1511
400 Ga0501084_0897844 3300054114 Bacteria 745
401 Ga0590071_011136 3300059421 Bacteria 2105
402 Ga0590075_056326 3300059424 Bacteria 1011
403 Ga0501082_0042487 3300060353 Bacteria 3920
404 Ga0501082_0330067 3300060353 Bacteria 1329
405 Ga0501082_0998232 3300060353 Bacteria 732
406 Ga0530510_0005787 3300061734 Bacteria 8569
407 Ga0209981_1001661
408 JGI25406J46586_10060400
409 Ga0065707_10235677
410 Ga0065707_10344648
411 Ga0065707_10373518
412 Ga0070676_10208420
413 Ga0070676_10514581
414 Ga0070690_100000131
415 Ga0068869_100000392
416 Ga0070666_10181848
417 Ga0070680_100002214
418 Ga0070680_100277058
419 Ga0070682_100001688
420 Ga0068868_100000656
421 Ga0070689_100011268
422 Ga0070689_100058295
423 Ga0070689_100129368
424 Ga0070691_10000200
425 Ga0070691_10038016
426 Ga0070691_10181302
427 Ga0070687_100000175
428 Ga0070692_10007635
429 Ga0070692_10018010
430 Ga0070692_10053024
431 Ga0070668_100090128
432 Ga0070669_100003743
433 Ga0070675_100083730
434 Ga0070675_100177404
435 Ga0070703_10007984
436 Ga0070701_10000060
437 Ga0070701_10305420
438 Ga0070705_100000431
439 Ga0070705_100014156
440 Ga0070700_100000587
441 Ga0070700_100000922
442 Ga0070694_100000136
443 Ga0070694_100113617
444 Ga0070694_100514970
445 Ga0070694_100545374
446 Ga0070662_100272514
447 Ga0070681_10002380
448 Ga0070681_10026556
449 Ga0068867_100001154
450 Ga0068867_100004652
451 Ga0070706_100676217
452 Ga0070699_100029304
453 Ga0070699_100210522
454 Ga0070699_100596929
455 Ga0070679_100035035
456 Ga0070697_100005463
457 Ga0070697_100055593
458 Ga0070686_100000285
459 Ga0070686_100102387
460 Ga0070695_100000705
461 Ga0070695_100021377
462 Ga0070695_100061646
463 Ga0070695_100387793
464 Ga0070696_100002173
465 Ga0070696_100002841
466 Ga0070696_100032793
467 Ga0070696_100040289
468 Ga0070696_100095407
469 Ga0070693_100000278
470 Ga0070704_100000103
471 Ga0070704_100014933
472 Ga0068855_100001779
473 Ga0068854_100024622
474 Ga0068856_100162094
475 Ga0070702_100000039
476 Ga0070702_100070487
477 Ga0068852_101154356
478 Ga0068859_100000420
479 Ga0068859_100249046
480 Ga0068859_100964139
481 Ga0068864_100057814
482 Ga0068864_100063982
483 Ga0068866_10000153
484 Ga0068866_10052891
485 Ga0068861_100000399
486 Ga0068861_100002062
487 Ga0068870_10067982
488 Ga0068870_10184051
489 Ga0068858_100004592
490 Ga0068858_100185818
491 Ga0068860_100002528
492 Ga0068860_100134318
493 Ga0068862_100004066
494 Ga0068862_100108106
495 Ga0068862_100114512
496 Ga0068862_100282924
497 Ga0081539_10000668
498 Ga0070715_10021157
499 Ga0097621_100000754
500 Ga0068871_100003849
501 Ga0068871_100201393
502 Ga0075428_100004852
503 Ga0075430_100001797
504 Ga0075430_100007389
505 Ga0075430_100029485
506 Ga0075430_100463367
507 Ga0075430_100676982
508 Ga0075431_100106215
509 Ga0075431_100342298
510 Ga0075431_100424374
511 Ga0075433_10002082
512 Ga0075433_10227660
513 Ga0075433_10265310
514 Ga0075434_100000083
515 Ga0075434_100001188
516 Ga0075429_100001365
517 Ga0075429_100248859
518 Ga0075429_100644858
519 Ga0068865_100003371
520 Ga0075436_100000075
521 Ga0075436_100001949
522 Ga0075436_100044937
523 Ga0097620_100000420
524 Ga0097620_100249051
525 Ga0097620_100964192
526 Ga0075435_100001823
527 Ga0075435_100003441
528 Ga0075435_100342063
529 Ga0099794_10102574
530 Ga0111539_10009727
531 Ga0111539_10040126
532 Ga0111539_10105400
533 Ga0111539_10303542
534 Ga0105245_10000533
535 Ga0114129_10002987
536 Ga0114129_10576668
537 Ga0114129_11836579
538 Ga0105243_10000495
539 Ga0105243_10004025
540 Ga0105243_10271794
541 Ga0105241_10090861
542 Ga0105242_10000248
543 Ga0105248_10016564
544 Ga0105249_10010445
545 Ga0105249_10133318
546 Ga0105249_10438872
547 Ga0105239_10738908
548 Ga0157369_10593389
549 Ga0157378_10000387
550 Ga0157380_10011517
551 Ga0157380_10018418
552 Ga0157377_10015130
553 Ga0157377_10058532
554 Ga0157379_10252604
555 Ga0157376_10123037
556 Ga0207653_10024026
557 Ga0207642_10000130
558 Ga0207685_10110632
559 Ga0207699_10081153
560 Ga0207645_10053375
561 Ga0207645_10233998
562 Ga0207645_10246195
563 Ga0207643_10029671
564 Ga0207643_10038688
565 Ga0207654_10073787
566 Ga0207707_10018773
567 Ga0207660_10000756
568 Ga0207660_10019252
569 Ga0207660_10211533
570 Ga0207662_10000095
571 Ga0207662_10401224
572 Ga0207652_10014727
573 Ga0207652_10415793
574 Ga0207687_10000432
575 Ga0207664_10235734
576 Ga0207686_10001368
577 Ga0207709_10001646
578 Ga0207670_10006597
579 Ga0207670_10033674
580 Ga0207670_10056599
581 Ga0207704_10000623
582 Ga0207704_10042461
583 Ga0207689_10000977
584 Ga0207667_10010601
585 Ga0207651_10103051
586 Ga0207651_10702254
587 Ga0207712_10072467
588 Ga0207712_10186168
589 Ga0207640_10018911
590 Ga0207677_10000832
591 Ga0207677_10172422
592 Ga0207703_10005254
593 Ga0207708_10000551
594 Ga0207708_10003472
595 Ga0207702_10213788
596 Ga0207641_10371854
597 Ga0207648_10000513
598 Ga0207648_10001314
599 Ga0207676_10045889
600 Ga0207676_10052134
601 Ga0207675_100001063
602 Ga0207675_100004650
603 Ga0207683_10171311
604 Ga0209967_1003363
605 Ga0209967_1021337
606 Ga0210000_1002653
607 Ga0209995_1019845
608 Ga0209968_1003562
609 Ga0209999_1005372
610 Ga0209999_1028061
611 Ga0209983_1031830
612 Ga0209971_1004120
613 Ga0209966_1007563
614 Ga0209966_1007678
615 Ga0209974_10091688
616 Ga0207428_10003903
617 Ga0207428_10033425
618 Ga0207428_10092364
619 Ga0268265_10017306
620 Ga0268265_10069514
621 Ga0268265_10147491
622 Ga0268264_10000827
623 Ga0307408_100234078
624 Ga0307405_10167942
625 Ga0307410_10143274
626 Ga0307410_10361420
627 Ga0307406_10316863
628 Ga0307412_10154924
629 Ga0307412_10846022
630 Ga0307409_100511482
631 Ga0307416_100116510
632 Ga0307416_100235778
633 Ga0307416_101306914
634 Ga0307411_10223568
635 Ga0373958_0031040
636 Ga0373926_0001711
637 Ga0373934_0000215
638 Ga0373949_0002595
639 Ga0373952_0048919
640 Ga0373932_0002574
641 Ga0373936_0028014
642 Ga0373939_0022149
643 Ga0373941_0060256
644 Ga0373945_0022349
645 Ga0373953_0018168
646 Ga0373954_0000012
647 Ga0373956_0008308
648 Ga0373957_0016230
649 Ga0373960_0042144
650 Ga0373943_0227164
651 Ga0373946_0032581
652 Ga0373946_0217523
653 Ga0373955_0003377
654 Ga0373955_0256681
655 Ga0373942_0002028
656 Ga0373962_0042333
657 Ga0373931_0004111
658 Ga0373931_0007054
659 Ga0373931_0030351
660 Ga0373935_0099527
661 Ga0373927_0007478
662 Ga0373933_0001060
663 Ga0373933_0034411
664 Ga0373947_0035586
665 Ga0373937_0001168
666 Ga0373937_0012367
667 Ga0373937_0056429
668 Ga0373937_0127123
669 Ga0373925_0007381
670 Ga0373925_0038821
671 Ga0439453_0035618
672 Ga0439441_003694
673 Ga0439441_012060
674 Ga0439441_034597
675 Ga0450913_008019
676 Ga0439435_0000074
677 Ga0439444_0000698
678 Ga0439444_0001777
679 Ga0439460_0003074
680 Ga0453684_1747566
681 Ga0451576_0003270
682 Ga0451576_0044419
683 Ga0451576_0103050
684 Ga0451576_0209846
685 Ga0451576_0839116
686 Ga0451576_1243479
687 Ga0466967_0884909
688 Ga0495592_0003983
689 Ga0495603_0006723
690 Ga0495651_0010755
691 Ga0495653_0283489
692 Ga0495580_0000775
693 Ga0495582_0021440
694 Ga0495639_0132658
695 Ga0495662_0002876
696 Ga0495662_0008313
697 Ga0495608_0004903
698 Ga0495628_0091404
699 Ga0495630_0009637
700 Ga0495630_0032900
701 Ga0495666_0103946
702 Ga0495652_0103659
703 Ga0495665_0051522
704 Ga0495640_0003336
705 Ga0495640_0131266
706 Ga0495586_0010045
707 Ga0495586_0049921
708 Ga0495667_0064878
709 Ga0495667_0178389
710 Ga0495656_0028663
711 Ga0495634_0017995
712 Ga0495635_0120172
713 Ga0495659_0210469
714 Ga0495588_0005746
715 Ga0495657_0185431
716 Ga0495646_0256309
717 Ga0495647_0002616
718 Ga0495658_0030293
719 Ga0495613_0017212
720 Ga0495624_0025076
721 Ga0495600_0016631
722 Ga0495581_0020785
723 Ga0495604_0019165
724 Ga0495636_0010951
725 Ga0495674_0040208
726 Ga0495676_0099850
727 Ga0495680_0000770
728 Ga0495684_0172117
729 Ga0496106_0332286
730 Ga0496115_0227729
731 Ga0501290_017019
732 Ga0501298_026619
733 Ga0501031_0247553
734 Ga0501033_0383850
735 Ga0501036_0111443
736 Ga0501037_0249178
737 Ga0501038_0120967
738 Ga0501038_0297114
739 Ga0501038_0503466
740 Ga0501039_0032640
741 Ga0501039_0086874
742 Ga0501039_0157225
743 Ga0501040_0012474
744 Ga0501040_0022078
745 Ga0501042_0106077
746 Ga0501048_0009509
747 Ga0501067_0071893
748 Ga0501068_0717805
749 Ga0501071_0013982
750 Ga0501071_0181186
751 Ga0501071_0200035
752 Ga0501071_0218232
753 Ga0501072_0029801
754 Ga0501072_0079027
755 Ga0501072_0174769
756 Ga0501072_0717276
757 Ga0501075_0005270
758 Ga0501076_0038310
759 Ga0501076_0106635
760 Ga0501076_0365665
761 Ga0501076_0429525
762 Ga0501076_0967663
763 Ga0501079_0020291
764 Ga0501080_0528751
765 Ga0501045_0007680
766 Ga0501045_0023545
767 Ga0501045_0292393
768 nmdc:mga05p37_1935_c1
769 nmdc:mga05p37_586459_c1
770 nmdc:mga05p37_696801_c1
771 nmdc:mga09592_1903_c1
772 nmdc:mga09592_278588_c1
773 nmdc:mga09592_453900_c1
774 nmdc:mga0qj67_188220_c1
775 nmdc:mga0qj67_24080_c1
776 nmdc:mga0qj67_29052_c1
777 nmdc:mga0qj67_505035_c1
778 nmdc:mga0qj67_76581_c1
779 nmdc:mga06r32_159636_c1
780 nmdc:mga06r32_46315_c1
781 nmdc:mga06r32_591600_c1
782 nmdc:mga06r32_648886_c1
783 nmdc:mga06r32_67049_c1
784 nmdc:mga08y16_1053074_c1
785 nmdc:mga08y16_21205_c1
786 nmdc:mga08y16_26260_c1
787 nmdc:mga08y16_3602_c1
788 nmdc:mga08y16_394299_c1
789 nmdc:mga08y16_72557_c1
790 nmdc:mga0n895_38108_c1
791 nmdc:mga0n895_4239_c1
792 nmdc:mga0n895_90_c1
793 nmdc:mga0rr50_18757_c1
794 nmdc:mga0rr50_2350_c1
795 nmdc:mga0rr50_2760_c1
796 nmdc:mga08x19_100474_c1
797 nmdc:mga08x19_1105_c1
798 nmdc:mga08x19_16924_c1
799 nmdc:mga0a205_27735_c2
800 nmdc:mga0a205_430338_c1
801 nmdc:mga0a205_5950_c1
802 Ga0495601_0093868
803 Ga0495601_0371779
804 Ga0495619_0201683
805 Ga0501084_0245603
806 Ga0501084_0897844
807 Ga0590071_011136
808 Ga0590075_056326
809 Ga0501082_0042487
810 Ga0501082_0330067
811 Ga0501082_0998232
812 Ga0530510_0005787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

55

188

0.91

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

3

182

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3um9-assembly1.cif.gz_B crystal structure of the defluorinating l-2-haloacid dehalogenase bpro0530 0.9806 2 209
1zrm-assembly1.cif.gz_A crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate 0.9754 2 209
3umb-assembly1.cif.gz_A-2 crystal structure of the l-2-haloacid dehalogenase rsc1362 0.9671 2 212
1jud-assembly1.cif.gz_A l-2-haloacid dehalogenase 0.9588 2 209
3umb-assembly1.cif.gz_A-2 crystal structure of the l-2-haloacid dehalogenase rsc1362 0.9583 2 212
ID Description Score Start End Superfamily
1zrmA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9798 87 209 3.40.50.1000
3um9B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9791 13 84 1.10.150.240
3um9A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9771 13 84 1.10.150.240
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9622 87 206 3.40.50.1000
1qh9A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9609 13 84 1.10.150.240
ID Description Score Start End GO Terms
AF-A0A352RRF9-F1-model_v4 Haloacid dehalogenase 0.9833 126 210
AF-A0A7D7RVJ0-F1-model_v4 Haloacid dehalogenase type II 0.9823 2 209 GO:0019120
AF-W4QWN4-F1-model_v4 Haloacid dehalogenase 0.9807 51 205 GO:0019120
AF-A0A5F0TJ21-F1-model_v4 deleted 0.9802 2 211
AF-A0A7T9S1C6-F1-model_v4 deleted 0.9799 78 208

Map