F436239

General Info

Members Datasets Scaffolds Average Seq Length
406 247 812 58

Family's Representative Sequence

Representative Sequence 3300028381|Ga0268264_12011040|Ga0268264_120110402
Length 70
Sequence VFTASAHNMEVDRMAVEARIRELGSRHQSLELAIKDEMQRPAADDVKLKELKRQKLKLKEEMEALRGQMH

Samples

Sample ID Description Type Environment
1 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
81 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
122 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
123 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
157 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
158 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
159 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
160 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
161 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
162 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
169 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
207 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
208 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
209 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
210 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
211 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
212 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
213 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
214 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
215 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
216 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
217 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
218 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
219 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
220 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
221 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
222 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
223 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
224 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
225 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
226 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
227 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
228 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
229 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
230 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
231 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
232 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
235 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
236 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
237 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
238 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
239 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
240 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
241 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
242 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
243 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
244 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
245 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
246 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
247 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.73
Nodule 0
Rhizoplane 2.96
Rhizosphere 75.37
Stem 0
Stem Tuber 0
Unclassified 10.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268264_12011040 3300028381 Bacteria 587
2 JGI24751J29686_10060983 3300002459 Bacteria 777
3 JGI25153J46596_10124973 3300003215 Bacteria 575
4 Ga0055530_10001206 3300003791 Bacteria 20000
5 Ga0055531_10026227 3300003794 Bacteria 2086
6 Ga0055543_1007360 3300004625 Bacteria 2554
7 Ga0065165_1001678 3300005262 Bacteria 22406
8 Ga0070658_10100720 3300005327 Bacteria 2388
9 Ga0070676_10900021 3300005328 Bacteria 659
10 Ga0070690_101522280 3300005330 Archaea 541
11 Ga0070670_102118993 3300005331 Bacteria 518
12 Ga0068869_100792965 3300005334 Bacteria 814
13 Ga0068869_101185048 3300005334 Bacteria 671
14 Ga0070666_10982944 3300005335 Unclassified 626
15 Ga0070682_101567223 3300005337 Unclassified 568
16 Ga0068868_100511854 3300005338 Bacteria 1053
17 Ga0068868_100632568 3300005338 Bacteria 951
18 Ga0068868_101443339 3300005338 Bacteria 643
19 Ga0070660_101109551 3300005339 Unclassified 670
20 Ga0070661_100998757 3300005344 Bacteria 694
21 Ga0070692_10664175 3300005345 Bacteria 697
22 Ga0070668_100006028 3300005347 Bacteria 8990
23 Ga0070668_100011938 3300005347 Bacteria 6469
24 Ga0070668_100024382 3300005347 Bacteria 4582
25 Ga0070668_101856346 3300005347 Bacteria 555
26 Ga0070669_100084787 3300005353 Bacteria 2365
27 Ga0070669_100168097 3300005353 Bacteria 1708
28 Ga0070675_101940139 3300005354 Bacteria 543
29 Ga0070671_100854042 3300005355 Bacteria 794
30 Ga0070667_100026904 3300005367 Bacteria 4786
31 Ga0070667_100030428 3300005367 Bacteria 4503
32 Ga0070678_102239323 3300005456 Bacteria 518
33 Ga0070662_101418373 3300005457 Bacteria 598
34 Ga0068867_100719216 3300005459 Bacteria 883
35 Ga0068853_100295115 3300005539 Bacteria 1497
36 Ga0068853_100374992 3300005539 Bacteria 1328
37 Ga0068853_100687020 3300005539 Bacteria 976
38 Ga0068853_100727086 3300005539 Bacteria 948
39 Ga0068853_100759464 3300005539 Bacteria 927
40 Ga0068853_100825773 3300005539 Bacteria 888
41 Ga0068853_102270014 3300005539 Unclassified 526
42 Ga0070693_101192810 3300005547 Bacteria 584
43 Ga0070665_100000311 3300005548 Bacteria 75738
44 Ga0070665_100874134 3300005548 Bacteria 912
45 Ga0070665_101984749 3300005548 Unclassified 587
46 Ga0070665_101993395 3300005548 Bacteria 586
47 Ga0070665_102424514 3300005548 Bacteria 527
48 Ga0068855_100113798 3300005563 Bacteria 3103
49 Ga0070664_100789116 3300005564 Bacteria 888
50 Ga0068856_100205265 3300005614 Bacteria 1985
51 Ga0068856_100685000 3300005614 Bacteria 1046
52 Ga0068856_102702753 3300005614 Bacteria 502
53 Ga0068852_101532724 3300005616 Bacteria 689
54 Ga0068859_100019281 3300005617 Bacteria 6853
55 Ga0068864_100000240 3300005618 Bacteria 49024
56 Ga0068864_100139490 3300005618 Bacteria 2186
57 Ga0068864_101159131 3300005618 Bacteria 771
58 Ga0068851_10861803 3300005834 Bacteria 566
59 Ga0068863_100000091 3300005841 Bacteria 98724
60 Ga0068863_100018210 3300005841 Bacteria 6725
61 Ga0068863_101161970 3300005841 Bacteria 777
62 Ga0068863_101171592 3300005841 Bacteria 774
63 Ga0068863_101807842 3300005841 Bacteria 621
64 Ga0068858_100000059 3300005842 Bacteria 117158
65 Ga0068858_101714224 3300005842 Bacteria 620
66 Ga0068858_102366042 3300005842 Unclassified 525
67 Ga0068860_100010113 3300005843 Bacteria 9348
68 Ga0068860_100828570 3300005843 Bacteria 939
69 Ga0068862_100157920 3300005844 Bacteria 2023
70 Ga0068862_100252481 3300005844 Bacteria 1608
71 Ga0068862_100888861 3300005844 Bacteria 875
72 Ga0075365_10344254 3300006038 Bacteria 1051
73 Ga0075362_10094998 3300006177 Bacteria 1388
74 Ga0075362_10179877 3300006177 Bacteria 1024
75 Ga0075366_10145297 3300006195 Bacteria 1435
76 Ga0075366_10914105 3300006195 Bacteria 547
77 Ga0097621_100822206 3300006237 Bacteria 862
78 Ga0097621_101876310 3300006237 Unclassified 572
79 Ga0068871_100456621 3300006358 Bacteria 1146
80 Ga0068871_101193599 3300006358 Bacteria 713
81 Ga0068865_100003426 3300006881 Bacteria 9489
82 Ga0097620_100019282 3300006931 Bacteria 6853
83 Ga0105251_10553838 3300009011 Bacteria 542
84 Ga0105250_10145188 3300009092 Bacteria 985
85 Ga0105240_11287353 3300009093 Bacteria 771
86 Ga0111539_11018172 3300009094 Bacteria 963
87 Ga0105245_11281529 3300009098 Bacteria 782
88 Ga0105247_10313883 3300009101 Bacteria 1092
89 Ga0105243_10156550 3300009148 Bacteria 1960
90 Ga0105241_10514436 3300009174 Bacteria 1069
91 Ga0105241_11208713 3300009174 Unclassified 716
92 Ga0105242_11532005 3300009176 Bacteria 698
93 Ga0105248_10002268 3300009177 Bacteria 21283
94 Ga0105248_10005982 3300009177 Bacteria 13357
95 Ga0105248_10596797 3300009177 Bacteria 1246
96 Ga0105248_10650255 3300009177 Bacteria 1190
97 Ga0105248_11038821 3300009177 Bacteria 926
98 Ga0105237_10762520 3300009545 Bacteria 974
99 Ga0105237_11955576 3300009545 Bacteria 595
100 Ga0105238_10012550 3300009551 Bacteria 8551
101 Ga0105238_11615281 3300009551 Bacteria 678
102 Ga0105238_12339229 3300009551 Bacteria 570
103 Ga0105238_12502308 3300009551 Bacteria 552
104 Ga0105238_12567377 3300009551 Unclassified 546
105 Ga0105238_12609580 3300009551 Unclassified 541
106 Ga0105249_10127775 3300009553 Bacteria 2422
107 Ga0105249_10249509 3300009553 Bacteria 1759
108 Ga0105249_12022661 3300009553 Unclassified 649
109 Ga0105239_10141734 3300010375 Bacteria 2679
110 Ga0105239_11572803 3300010375 Bacteria 760
111 Ga0105239_11942319 3300010375 Bacteria 683
112 Ga0105246_11173981 3300011119 Bacteria 705
113 Ga0157373_10013213 3300013100 Bacteria 6061
114 Ga0157373_10033267 3300013100 Bacteria 3710
115 Ga0157371_10493876 3300013102 Bacteria 903
116 Ga0157370_10207630 3300013104 Bacteria 1816
117 Ga0157370_11460900 3300013104 Bacteria 615
118 Ga0157369_11072779 3300013105 Bacteria 824
119 Ga0157374_10130075 3300013296 Bacteria 2436
120 Ga0157374_12114458 3300013296 Unclassified 590
121 Ga0157374_12697564 3300013296 Unclassified 525
122 Ga0163162_10731438 3300013306 Bacteria 1110
123 Ga0163162_11350473 3300013306 Bacteria 810
124 Ga0163162_11729107 3300013306 Bacteria 714
125 Ga0157372_10895253 3300013307 Bacteria 1030
126 Ga0157375_10739336 3300013308 Bacteria 1136
127 Ga0157375_13373319 3300013308 Unclassified 532
128 Ga0163163_10175376 3300014325 Bacteria 2190
129 Ga0163163_10786497 3300014325 Bacteria 1015
130 Ga0163163_10901444 3300014325 Bacteria 948
131 Ga0163163_11543227 3300014325 Bacteria 725
132 Ga0157380_10692778 3300014326 Bacteria 1023
133 Ga0157379_10259174 3300014968 Bacteria 1580
134 Ga0157379_10953927 3300014968 Bacteria 816
135 Ga0157379_11192923 3300014968 Bacteria 732
136 Ga0157376_11271018 3300014969 Bacteria 765
137 Ga0163161_10506424 3300017792 Bacteria 984
138 Ga0163161_11879699 3300017792 Unclassified 533
139 Ga0206353_11813988 3300020082 Bacteria 565
140 Ga0213872_10110171 3300021361 Bacteria 1223
141 Ga0213876_10027131 3300021384 Bacteria 3022
142 Ga0213875_10325287 3300021388 Bacteria 729
143 Ga0213871_10002668 3300021441 Bacteria 3317
144 Ga0224712_10359841 3300022467 Bacteria 689
145 Ga0224712_10666115 3300022467 Unclassified 511
146 Ga0209758_1005334 3300025297 Bacteria 9996
147 Ga0209050_1000073 3300025298 Bacteria 292046
148 Ga0209257_1000099 3300025304 Bacteria 255304
149 Ga0209257_1004182 3300025304 Bacteria 11450
150 Ga0207696_1072743 3300025711 Bacteria 954
151 Ga0207710_10279499 3300025900 Bacteria 840
152 Ga0207680_10219042 3300025903 Bacteria 1304
153 Ga0207643_10133263 3300025908 Bacteria 1480
154 Ga0207705_10243553 3300025909 Bacteria 1370
155 Ga0207705_11106684 3300025909 Bacteria 610
156 Ga0207705_11129647 3300025909 Bacteria 603
157 Ga0207654_11370466 3300025911 Unclassified 516
158 Ga0207695_10017061 3300025913 Bacteria 8467
159 Ga0207695_10360490 3300025913 Bacteria 1340
160 Ga0207671_10596211 3300025914 Bacteria 880
161 Ga0207657_10791105 3300025919 Bacteria 734
162 Ga0207649_10442328 3300025920 Bacteria 980
163 Ga0207681_10090170 3300025923 Bacteria 2188
164 Ga0207681_10245651 3300025923 Bacteria 1395
165 Ga0207681_11366502 3300025923 Unclassified 595
166 Ga0207694_10074769 3300025924 Bacteria 2652
167 Ga0207694_11382374 3300025924 Unclassified 595
168 Ga0207650_10006882 3300025925 Bacteria 7752
169 Ga0207650_10686280 3300025925 Bacteria 864
170 Ga0207644_11119950 3300025931 Unclassified 661
171 Ga0207686_10964729 3300025934 Unclassified 690
172 Ga0207709_10623252 3300025935 Bacteria 856
173 Ga0207709_11483780 3300025935 Unclassified 562
174 Ga0207704_10004654 3300025938 Bacteria 6290
175 Ga0207711_10002033 3300025941 Bacteria 18294
176 Ga0207711_10022001 3300025941 Bacteria 5327
177 Ga0207711_10238818 3300025941 Bacteria 1666
178 Ga0207711_10448045 3300025941 Bacteria 1202
179 Ga0207711_10573857 3300025941 Bacteria 1052
180 Ga0207689_10508590 3300025942 Bacteria 1009
181 Ga0207689_11077949 3300025942 Bacteria 677
182 Ga0207679_10012781 3300025945 Bacteria 5485
183 Ga0207679_11901695 3300025945 Unclassified 543
184 Ga0207667_10065167 3300025949 Bacteria 3801
185 Ga0207667_10810687 3300025949 Bacteria 932
186 Ga0207651_11170595 3300025960 Bacteria 690
187 Ga0207651_12011516 3300025960 Unclassified 519
188 Ga0207712_10145568 3300025961 Bacteria 1824
189 Ga0207712_11982101 3300025961 Bacteria 521
190 Ga0207712_11991545 3300025961 Bacteria 520
191 Ga0207668_10000088 3300025972 Bacteria 69295
192 Ga0207668_10004087 3300025972 Bacteria 8574
193 Ga0207668_10573721 3300025972 Bacteria 980
194 Ga0207658_10006078 3300025986 Bacteria 8245
195 Ga0207658_10044833 3300025986 Bacteria 3221
196 Ga0207658_10563022 3300025986 Bacteria 1021
197 Ga0207658_11716121 3300025986 Bacteria 573
198 Ga0207677_11388855 3300026023 Unclassified 647
199 Ga0207677_11982874 3300026023 Bacteria 541
200 Ga0207703_10000049 3300026035 Bacteria 149817
201 Ga0207639_10237619 3300026041 Bacteria 1583
202 Ga0207639_10484307 3300026041 Bacteria 1128
203 Ga0207639_10637760 3300026041 Bacteria 985
204 Ga0207639_10966382 3300026041 Bacteria 797
205 Ga0207639_11555965 3300026041 Archaea 620
206 Ga0207639_12213940 3300026041 Unclassified 511
207 Ga0207702_10159304 3300026078 Bacteria 2060
208 Ga0207702_10795088 3300026078 Bacteria 935
209 Ga0207702_11063987 3300026078 Bacteria 803
210 Ga0207641_10000011 3300026088 Bacteria 384362
211 Ga0207641_10065563 3300026088 Bacteria 3107
212 Ga0207641_10875369 3300026088 Bacteria 891
213 Ga0207641_11828388 3300026088 Bacteria 609
214 Ga0207641_12130712 3300026088 Unclassified 561
215 Ga0207676_10000117 3300026095 Bacteria 69834
216 Ga0207676_10065306 3300026095 Bacteria 2897
217 Ga0207676_12144250 3300026095 Unclassified 557
218 Ga0207674_11132586 3300026116 Bacteria 752
219 Ga0207675_100029738 3300026118 Bacteria 5087
220 Ga0207698_10718426 3300026142 Bacteria 995
221 Ga0207698_10744224 3300026142 Bacteria 979
222 Ga0207698_11193605 3300026142 Bacteria 775
223 Ga0207698_11594666 3300026142 Bacteria 668
224 Ga0268266_10004800 3300028379 Bacteria 12835
225 Ga0268266_10376789 3300028379 Bacteria 1338
226 Ga0268265_10082424 3300028380 Bacteria 2543
227 Ga0268264_10009759 3300028381 Bacteria 7948
228 Ga0268264_10892663 3300028381 Bacteria 892
229 Ga0265334_10022919 3300028573 Bacteria 2543
230 Ga0265318_10158414 3300028577 Bacteria 830
231 Ga0307517_10114782 3300028786 Bacteria 2025
232 Ga0265338_10019378 3300028800 Bacteria 7220
233 Ga0265338_10048231 3300028800 Bacteria 3878
234 Ga0265338_10097693 3300028800 Bacteria 2405
235 Ga0265338_10238961 3300028800 Bacteria 1346
236 Ga0265338_10273133 3300028800 Bacteria 1238
237 Ga0265338_10375679 3300028800 Bacteria 1017
238 Ga0265338_10484411 3300028800 Unclassified 872
239 Ga0265338_10586683 3300028800 Bacteria 777
240 Ga0265338_10809244 3300028800 Bacteria 642
241 Ga0265340_10274467 3300031247 Bacteria 749
242 Ga0265331_10209253 3300031250 Bacteria 878
243 Ga0265327_10000198 3300031251 Bacteria 126077
244 Ga0265327_10001376 3300031251 Bacteria 31183
245 Ga0265327_10160267 3300031251 Bacteria 1040
246 Ga0307513_10000127 3300031456 Bacteria 107100
247 Ga0307408_100988963 3300031548 Bacteria 775
248 Ga0307508_10399932 3300031616 Bacteria 965
249 Ga0265314_10253037 3300031711 Bacteria 1010
250 Ga0265314_10404756 3300031711 Bacteria 737
251 Ga0265342_10226981 3300031712 Bacteria 1004
252 Ga0307516_10000001 3300031730 Bacteria 510338
253 Ga0307516_10701729 3300031730 Bacteria 669
254 Ga0307410_10924979 3300031852 Unclassified 748
255 Ga0307410_11344676 3300031852 Bacteria 626
256 Ga0307406_10285116 3300031901 Bacteria 1262
257 Ga0307406_10414178 3300031901 Bacteria 1072
258 Ga0307412_10124382 3300031911 Bacteria 1863
259 Ga0307412_10841326 3300031911 Bacteria 800
260 Ga0307409_100141518 3300031995 Bacteria 2074
261 Ga0307409_101486255 3300031995 Unclassified 705
262 Ga0307416_102473512 3300032002 Bacteria 618
263 Ga0307414_11828244 3300032004 Bacteria 567
264 Ga0307411_11749265 3300032005 Unclassified 576
265 Ga0307415_100834093 3300032126 Unclassified 844
266 Ga0373936_0018299 3300035113 Bacteria 2704
267 Ga0373946_0654904 3300035171 Unclassified 547
268 Ga0373927_0954908 3300035695 Bacteria 566
269 Ga0373933_0888632 3300035724 Bacteria 587
270 Ga0373937_0985402 3300036401 Bacteria 792
271 Ga0373937_1200086 3300036401 Unclassified 707
272 Ga0373937_1889744 3300036401 Bacteria 543
273 Ga0395899_0000052 3300037312 Bacteria 221643
274 Ga0395899_0117691 3300037312 Bacteria 1906
275 Ga0395900_0000002 3300037418 Bacteria 671103
276 Ga0395900_0026042 3300037418 Bacteria 5989
277 Ga0395900_0206025 3300037418 Bacteria 1988
278 Ga0395898_0060325 3300037466 Bacteria 3686
279 Ga0395898_0717955 3300037466 Bacteria 941
280 Ga0395905_0021225 3300037471 Bacteria 6145
281 Ga0395905_0227645 3300037471 Bacteria 1744
282 Ga0395905_0232350 3300037471 Bacteria 1724
283 Ga0395905_0646084 3300037471 Bacteria 960
284 Ga0395905_1114174 3300037471 Bacteria 693
285 Ga0395905_1355464 3300037471 Bacteria 615
286 Ga0436364_0320320 3300037853 Bacteria 2500
287 Ga0395901_0000013 3300038443 Bacteria 375733
288 Ga0395901_0062035 3300038443 Bacteria 3890
289 Ga0395901_0776588 3300038443 Bacteria 949
290 Ga0436365_1540554 3300039437 Bacteria 3894
291 Ga0436365_1901926 3300039437 Bacteria 766
292 Ga0436360_0500683 3300039438 Bacteria 6765
293 Ga0436360_1246343 3300039438 Bacteria 668
294 Ga0436361_0569329 3300039447 Bacteria 4642
295 Ga0436362_0714357 3300039453 Unclassified 654
296 Ga0439439_0161909 3300041406 Bacteria 639
297 Ga0451791_1401579 3300041451 Bacteria 526
298 Ga0451804_0961457 3300041463 Bacteria 752
299 Ga0439431_0038783 3300041997 Bacteria 1207
300 Ga0439457_075130 3300042014 Bacteria 773
301 Ga0439446_0147744 3300042156 Bacteria 771
302 Ga0451577_1997049 3300042876 Bacteria 507
303 Ga0495629_0098667 3300046459 Bacteria 2038
304 Ga0495651_0752848 3300046462 Bacteria 604
305 Ga0495610_0145482 3300046512 Bacteria 1016
306 Ga0495620_0028408 3300046515 Bacteria 2601
307 Ga0495643_0004997 3300046522 Bacteria 9092
308 Ga0495642_0047135 3300046528 Bacteria 1764
309 Ga0495652_0635052 3300046529 Bacteria 725
310 Ga0495654_0112009 3300046530 Bacteria 1244
311 Ga0495587_0434699 3300046536 Bacteria 728
312 Ga0495609_0056323 3300046538 Bacteria 1742
313 Ga0495597_0015357 3300046542 Bacteria 3627
314 Ga0495622_0001917 3300046557 Bacteria 10219
315 Ga0495668_0016385 3300046616 Bacteria 4307
316 Ga0495668_0191200 3300046616 Bacteria 1121
317 Ga0495625_0209414 3300046660 Bacteria 1282
318 Ga0495625_0477154 3300046660 Bacteria 766
319 Ga0495669_0000002 3300046684 Bacteria 282777
320 Ga0495669_0102722 3300046684 Bacteria 1329
321 Ga0495613_0001877 3300046689 Bacteria 15962
322 Ga0495670_0402244 3300046691 Bacteria 740
323 Ga0495672_0067265 3300047320 Bacteria 2041
324 Ga0495687_011707 3300047443 Bacteria 4693
325 Ga0495677_0053171 3300047445 Bacteria 1493
326 Ga0495593_0328522 3300047673 Bacteria 764
327 Ga0496100_0454255 3300048903 Bacteria 982
328 Ga0496101_1353613 3300048904 Bacteria 556
329 Ga0496102_0121235 3300048905 Bacteria 2442
330 Ga0496106_0233705 3300048909 Bacteria 1468
331 Ga0496106_0404490 3300048909 Bacteria 1097
332 Ga0496107_0322365 3300048910 Bacteria 1150
333 Ga0496107_0329590 3300048910 Bacteria 1136
334 Ga0496107_1246380 3300048910 Bacteria 533
335 Ga0496112_0158992 3300048915 Bacteria 2226
336 Ga0496115_0001980 3300048918 Bacteria 14628
337 Ga0496116_0065856 3300048919 Bacteria 2322
338 Ga0496117_0022054 3300048920 Bacteria 5120
339 Ga0496118_0005132 3300048921 Bacteria 15032
340 Ga0496119_0062062 3300048922 Bacteria 2228
341 Ga0496121_0000035 3300048924 Bacteria 374316
342 Ga0496121_0244817 3300048924 Bacteria 1247
343 Ga0495682_0020757 3300049460 Bacteria 2465
344 Ga0501033_0416549 3300049570 Bacteria 936
345 Ga0501047_0768570 3300049581 Bacteria 779
346 Ga0501047_0777361 3300049581 Bacteria 773
347 Ga0501044_0734623 3300049823 Bacteria 870
348 nmdc:mga03683_51248_c1 3300050489 Bacteria 1722
349 nmdc:mga03n38_148949_c1 3300050490 Bacteria 1176
350 nmdc:mga0yw44_1043262_c1 3300050492 Unclassified 553
351 nmdc:mga0k408_101686_c1 3300050493 Bacteria 1695
352 nmdc:mga07m45_612605_c1 3300050496 Bacteria 628
353 nmdc:mga0sz30_467429_c1 3300050516 Bacteria 566
354 Ga0500635_0000049 3300053080 Bacteria 80019
355 Ga0500635_0062287 3300053080 Bacteria 1305
356 Ga0500578_0228568 3300053086 Bacteria 1128
357 Ga0500643_002598 3300053087 Bacteria 9162
358 Ga0500647_0191094 3300053091 Bacteria 934
359 Ga0500583_0038506 3300053092 Bacteria 2154
360 Ga0500651_0581742 3300053093 Unclassified 609
361 Ga0500566_0069029 3300053094 Bacteria 1986
362 Ga0500641_0000911 3300053096 Bacteria 10559
363 Ga0500650_0105374 3300053098 Bacteria 1318
364 Ga0500555_112843 3300053103 Bacteria 683
365 Ga0500556_0003871 3300053104 Bacteria 4332
366 Ga0500556_0259420 3300053104 Bacteria 683
367 Ga0500557_070457 3300053105 Bacteria 1146
368 Ga0500562_000413 3300053108 Bacteria 10379
369 Ga0500569_135012 3300053109 Bacteria 827
370 Ga0500595_004411 3300053119 Bacteria 6318
371 Ga0500595_013456 3300053119 Bacteria 3133
372 Ga0500607_134247 3300053121 Bacteria 1175
373 Ga0500608_000299 3300053122 Bacteria 19175
374 Ga0500614_013161 3300053123 Bacteria 1814
375 Ga0500642_0202725 3300053130 Bacteria 923
376 Ga0500655_007973 3300053133 Bacteria 1907
377 Ga0500655_059701 3300053133 Bacteria 767
378 Ga0500658_0018336 3300053134 Bacteria 2623
379 Ga0500559_0013649 3300053136 Bacteria 3437
380 Ga0500564_237921 3300053138 Bacteria 728
381 Ga0500568_0279965 3300053139 Bacteria 606
382 Ga0500590_007230 3300053148 Bacteria 5469
383 Ga0500604_0095295 3300053151 Bacteria 976
384 Ga0500616_0010142 3300053153 Bacteria 5659
385 Ga0500616_0225369 3300053153 Bacteria 815
386 Ga0500616_0247962 3300053153 Bacteria 762
387 Ga0500616_0287702 3300053153 Bacteria 687
388 Ga0500619_078646 3300053154 Bacteria 1105
389 Ga0500620_253105 3300053155 Unclassified 585
390 Ga0500620_274667 3300053155 Unclassified 554
391 Ga0500622_0034572 3300053156 Bacteria 2647
392 Ga0500624_003401 3300053157 Bacteria 2090
393 Ga0500638_210309 3300053162 Bacteria 815
394 Ga0500639_071720 3300053163 Bacteria 1764
395 Ga0500636_0004914 3300053177 Bacteria 7593
396 Ga0500636_0087891 3300053177 Bacteria 1783
397 Ga0500636_0393334 3300053177 Unclassified 646
398 Ga0500637_0008071 3300053178 Bacteria 5289
399 Ga0500637_0018007 3300053178 Bacteria 3790
400 Ga0500576_271574 3300053725 Unclassified 510
401 Ga0500645_002360 3300053730 Bacteria 8508
402 Ga0500645_003428 3300053730 Bacteria 6433
403 Ga0500552_062773 3300053733 Unclassified 653
404 Ga0500596_003674 3300053735 Bacteria 2886
405 Ga0500601_050524 3300053737 Bacteria 517
406 Ga0587110_052719 3300059654 Unclassified 548
407 Ga0268264_12011040
408 JGI24751J29686_10060983
409 JGI25153J46596_10124973
410 Ga0055530_10001206
411 Ga0055531_10026227
412 Ga0055543_1007360
413 Ga0065165_1001678
414 Ga0070658_10100720
415 Ga0070676_10900021
416 Ga0070690_101522280
417 Ga0070670_102118993
418 Ga0068869_100792965
419 Ga0068869_101185048
420 Ga0070666_10982944
421 Ga0070682_101567223
422 Ga0068868_100511854
423 Ga0068868_100632568
424 Ga0068868_101443339
425 Ga0070660_101109551
426 Ga0070661_100998757
427 Ga0070692_10664175
428 Ga0070668_100006028
429 Ga0070668_100011938
430 Ga0070668_100024382
431 Ga0070668_101856346
432 Ga0070669_100084787
433 Ga0070669_100168097
434 Ga0070675_101940139
435 Ga0070671_100854042
436 Ga0070667_100026904
437 Ga0070667_100030428
438 Ga0070678_102239323
439 Ga0070662_101418373
440 Ga0068867_100719216
441 Ga0068853_100295115
442 Ga0068853_100374992
443 Ga0068853_100687020
444 Ga0068853_100727086
445 Ga0068853_100759464
446 Ga0068853_100825773
447 Ga0068853_102270014
448 Ga0070693_101192810
449 Ga0070665_100000311
450 Ga0070665_100874134
451 Ga0070665_101984749
452 Ga0070665_101993395
453 Ga0070665_102424514
454 Ga0068855_100113798
455 Ga0070664_100789116
456 Ga0068856_100205265
457 Ga0068856_100685000
458 Ga0068856_102702753
459 Ga0068852_101532724
460 Ga0068859_100019281
461 Ga0068864_100000240
462 Ga0068864_100139490
463 Ga0068864_101159131
464 Ga0068851_10861803
465 Ga0068863_100000091
466 Ga0068863_100018210
467 Ga0068863_101161970
468 Ga0068863_101171592
469 Ga0068863_101807842
470 Ga0068858_100000059
471 Ga0068858_101714224
472 Ga0068858_102366042
473 Ga0068860_100010113
474 Ga0068860_100828570
475 Ga0068862_100157920
476 Ga0068862_100252481
477 Ga0068862_100888861
478 Ga0075365_10344254
479 Ga0075362_10094998
480 Ga0075362_10179877
481 Ga0075366_10145297
482 Ga0075366_10914105
483 Ga0097621_100822206
484 Ga0097621_101876310
485 Ga0068871_100456621
486 Ga0068871_101193599
487 Ga0068865_100003426
488 Ga0097620_100019282
489 Ga0105251_10553838
490 Ga0105250_10145188
491 Ga0105240_11287353
492 Ga0111539_11018172
493 Ga0105245_11281529
494 Ga0105247_10313883
495 Ga0105243_10156550
496 Ga0105241_10514436
497 Ga0105241_11208713
498 Ga0105242_11532005
499 Ga0105248_10002268
500 Ga0105248_10005982
501 Ga0105248_10596797
502 Ga0105248_10650255
503 Ga0105248_11038821
504 Ga0105237_10762520
505 Ga0105237_11955576
506 Ga0105238_10012550
507 Ga0105238_11615281
508 Ga0105238_12339229
509 Ga0105238_12502308
510 Ga0105238_12567377
511 Ga0105238_12609580
512 Ga0105249_10127775
513 Ga0105249_10249509
514 Ga0105249_12022661
515 Ga0105239_10141734
516 Ga0105239_11572803
517 Ga0105239_11942319
518 Ga0105246_11173981
519 Ga0157373_10013213
520 Ga0157373_10033267
521 Ga0157371_10493876
522 Ga0157370_10207630
523 Ga0157370_11460900
524 Ga0157369_11072779
525 Ga0157374_10130075
526 Ga0157374_12114458
527 Ga0157374_12697564
528 Ga0163162_10731438
529 Ga0163162_11350473
530 Ga0163162_11729107
531 Ga0157372_10895253
532 Ga0157375_10739336
533 Ga0157375_13373319
534 Ga0163163_10175376
535 Ga0163163_10786497
536 Ga0163163_10901444
537 Ga0163163_11543227
538 Ga0157380_10692778
539 Ga0157379_10259174
540 Ga0157379_10953927
541 Ga0157379_11192923
542 Ga0157376_11271018
543 Ga0163161_10506424
544 Ga0163161_11879699
545 Ga0206353_11813988
546 Ga0213872_10110171
547 Ga0213876_10027131
548 Ga0213875_10325287
549 Ga0213871_10002668
550 Ga0224712_10359841
551 Ga0224712_10666115
552 Ga0209758_1005334
553 Ga0209050_1000073
554 Ga0209257_1000099
555 Ga0209257_1004182
556 Ga0207696_1072743
557 Ga0207710_10279499
558 Ga0207680_10219042
559 Ga0207643_10133263
560 Ga0207705_10243553
561 Ga0207705_11106684
562 Ga0207705_11129647
563 Ga0207654_11370466
564 Ga0207695_10017061
565 Ga0207695_10360490
566 Ga0207671_10596211
567 Ga0207657_10791105
568 Ga0207649_10442328
569 Ga0207681_10090170
570 Ga0207681_10245651
571 Ga0207681_11366502
572 Ga0207694_10074769
573 Ga0207694_11382374
574 Ga0207650_10006882
575 Ga0207650_10686280
576 Ga0207644_11119950
577 Ga0207686_10964729
578 Ga0207709_10623252
579 Ga0207709_11483780
580 Ga0207704_10004654
581 Ga0207711_10002033
582 Ga0207711_10022001
583 Ga0207711_10238818
584 Ga0207711_10448045
585 Ga0207711_10573857
586 Ga0207689_10508590
587 Ga0207689_11077949
588 Ga0207679_10012781
589 Ga0207679_11901695
590 Ga0207667_10065167
591 Ga0207667_10810687
592 Ga0207651_11170595
593 Ga0207651_12011516
594 Ga0207712_10145568
595 Ga0207712_11982101
596 Ga0207712_11991545
597 Ga0207668_10000088
598 Ga0207668_10004087
599 Ga0207668_10573721
600 Ga0207658_10006078
601 Ga0207658_10044833
602 Ga0207658_10563022
603 Ga0207658_11716121
604 Ga0207677_11388855
605 Ga0207677_11982874
606 Ga0207703_10000049
607 Ga0207639_10237619
608 Ga0207639_10484307
609 Ga0207639_10637760
610 Ga0207639_10966382
611 Ga0207639_11555965
612 Ga0207639_12213940
613 Ga0207702_10159304
614 Ga0207702_10795088
615 Ga0207702_11063987
616 Ga0207641_10000011
617 Ga0207641_10065563
618 Ga0207641_10875369
619 Ga0207641_11828388
620 Ga0207641_12130712
621 Ga0207676_10000117
622 Ga0207676_10065306
623 Ga0207676_12144250
624 Ga0207674_11132586
625 Ga0207675_100029738
626 Ga0207698_10718426
627 Ga0207698_10744224
628 Ga0207698_11193605
629 Ga0207698_11594666
630 Ga0268266_10004800
631 Ga0268266_10376789
632 Ga0268265_10082424
633 Ga0268264_10009759
634 Ga0268264_10892663
635 Ga0265334_10022919
636 Ga0265318_10158414
637 Ga0307517_10114782
638 Ga0265338_10019378
639 Ga0265338_10048231
640 Ga0265338_10097693
641 Ga0265338_10238961
642 Ga0265338_10273133
643 Ga0265338_10375679
644 Ga0265338_10484411
645 Ga0265338_10586683
646 Ga0265338_10809244
647 Ga0265340_10274467
648 Ga0265331_10209253
649 Ga0265327_10000198
650 Ga0265327_10001376
651 Ga0265327_10160267
652 Ga0307513_10000127
653 Ga0307408_100988963
654 Ga0307508_10399932
655 Ga0265314_10253037
656 Ga0265314_10404756
657 Ga0265342_10226981
658 Ga0307516_10000001
659 Ga0307516_10701729
660 Ga0307410_10924979
661 Ga0307410_11344676
662 Ga0307406_10285116
663 Ga0307406_10414178
664 Ga0307412_10124382
665 Ga0307412_10841326
666 Ga0307409_100141518
667 Ga0307409_101486255
668 Ga0307416_102473512
669 Ga0307414_11828244
670 Ga0307411_11749265
671 Ga0307415_100834093
672 Ga0373936_0018299
673 Ga0373946_0654904
674 Ga0373927_0954908
675 Ga0373933_0888632
676 Ga0373937_0985402
677 Ga0373937_1200086
678 Ga0373937_1889744
679 Ga0395899_0000052
680 Ga0395899_0117691
681 Ga0395900_0000002
682 Ga0395900_0026042
683 Ga0395900_0206025
684 Ga0395898_0060325
685 Ga0395898_0717955
686 Ga0395905_0021225
687 Ga0395905_0227645
688 Ga0395905_0232350
689 Ga0395905_0646084
690 Ga0395905_1114174
691 Ga0395905_1355464
692 Ga0436364_0320320
693 Ga0395901_0000013
694 Ga0395901_0062035
695 Ga0395901_0776588
696 Ga0436365_1540554
697 Ga0436365_1901926
698 Ga0436360_0500683
699 Ga0436360_1246343
700 Ga0436361_0569329
701 Ga0436362_0714357
702 Ga0439439_0161909
703 Ga0451791_1401579
704 Ga0451804_0961457
705 Ga0439431_0038783
706 Ga0439457_075130
707 Ga0439446_0147744
708 Ga0451577_1997049
709 Ga0495629_0098667
710 Ga0495651_0752848
711 Ga0495610_0145482
712 Ga0495620_0028408
713 Ga0495643_0004997
714 Ga0495642_0047135
715 Ga0495652_0635052
716 Ga0495654_0112009
717 Ga0495587_0434699
718 Ga0495609_0056323
719 Ga0495597_0015357
720 Ga0495622_0001917
721 Ga0495668_0016385
722 Ga0495668_0191200
723 Ga0495625_0209414
724 Ga0495625_0477154
725 Ga0495669_0000002
726 Ga0495669_0102722
727 Ga0495613_0001877
728 Ga0495670_0402244
729 Ga0495672_0067265
730 Ga0495687_011707
731 Ga0495677_0053171
732 Ga0495593_0328522
733 Ga0496100_0454255
734 Ga0496101_1353613
735 Ga0496102_0121235
736 Ga0496106_0233705
737 Ga0496106_0404490
738 Ga0496107_0322365
739 Ga0496107_0329590
740 Ga0496107_1246380
741 Ga0496112_0158992
742 Ga0496115_0001980
743 Ga0496116_0065856
744 Ga0496117_0022054
745 Ga0496118_0005132
746 Ga0496119_0062062
747 Ga0496121_0000035
748 Ga0496121_0244817
749 Ga0495682_0020757
750 Ga0501033_0416549
751 Ga0501047_0768570
752 Ga0501047_0777361
753 Ga0501044_0734623
754 nmdc:mga03683_51248_c1
755 nmdc:mga03n38_148949_c1
756 nmdc:mga0yw44_1043262_c1
757 nmdc:mga0k408_101686_c1
758 nmdc:mga07m45_612605_c1
759 nmdc:mga0sz30_467429_c1
760 Ga0500635_0000049
761 Ga0500635_0062287
762 Ga0500578_0228568
763 Ga0500643_002598
764 Ga0500647_0191094
765 Ga0500583_0038506
766 Ga0500651_0581742
767 Ga0500566_0069029
768 Ga0500641_0000911
769 Ga0500650_0105374
770 Ga0500555_112843
771 Ga0500556_0003871
772 Ga0500556_0259420
773 Ga0500557_070457
774 Ga0500562_000413
775 Ga0500569_135012
776 Ga0500595_004411
777 Ga0500595_013456
778 Ga0500607_134247
779 Ga0500608_000299
780 Ga0500614_013161
781 Ga0500642_0202725
782 Ga0500655_007973
783 Ga0500655_059701
784 Ga0500658_0018336
785 Ga0500559_0013649
786 Ga0500564_237921
787 Ga0500568_0279965
788 Ga0500590_007230
789 Ga0500604_0095295
790 Ga0500616_0010142
791 Ga0500616_0225369
792 Ga0500616_0247962
793 Ga0500616_0287702
794 Ga0500619_078646
795 Ga0500620_253105
796 Ga0500620_274667
797 Ga0500622_0034572
798 Ga0500624_003401
799 Ga0500638_210309
800 Ga0500639_071720
801 Ga0500636_0004914
802 Ga0500636_0087891
803 Ga0500636_0393334
804 Ga0500637_0008071
805 Ga0500637_0018007
806 Ga0500576_271574
807 Ga0500645_002360
808 Ga0500645_003428
809 Ga0500552_062773
810 Ga0500596_003674
811 Ga0500601_050524
812 Ga0587110_052719

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04325

DUF465

Protein of unknown function (DUF465)

20

66

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lle-assembly2.cif.gz_C the crystal structure of r60l mutant of the histidine kinase (kinb) sensor domain from pseudomonas aeruginosa pa01 0.9627 1 51
3n24-assembly4.cif.gz_H the crystal structure of a two-component sensor domain (3rd form) from pseudomonas aeruginosa pa01 0.959 1 48
3n24-assembly4.cif.gz_G the crystal structure of a two-component sensor domain (3rd form) from pseudomonas aeruginosa pa01 0.9582 1 48
4lle-assembly2.cif.gz_D the crystal structure of r60l mutant of the histidine kinase (kinb) sensor domain from pseudomonas aeruginosa pa01 0.9581 1 51
7n6g-assembly1.cif.gz_3I c1 of central pair 0.9502 2 54
ID Description Score Start End Superfamily
af_O13816_119_876_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9683 6 54 1.25.10.10
af_P24800_30_234_1.20.1250.10 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;; 0.9675 3 53 1.20.1250.10
3l34A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Histidine kinase (KinB), sensor domain 0.9649 2 51 1.20.120.880
4lleC00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Histidine kinase (KinB), sensor domain 0.9649 2 51 1.20.120.880
3n24G00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Histidine kinase (KinB), sensor domain 0.9645 4 48 1.20.120.880
ID Description Score Start End GO Terms
AF-A0A1G7JIB3-F1-model_v4 DUF465 domain-containing protein 1.009 2 53
AF-A0A2E3SL76-F1-model_v4 DUF465 domain-containing protein 1.006 2 54
AF-F2DD28-F1-model_v4 Predicted protein 1.005 2 57 GO:0003700
GO:0005634
GO:0043565
AF-A0A183F4T5-F1-model_v4 PRP21_like_P domain-containing protein 1.003 2 55
AF-A0A4R7CQ90-F1-model_v4 Transposase 1.003 2 55 GO:0003677
GO:0004803
GO:0006313

Map