F436336

General Info

Members Datasets Scaffolds Average Seq Length
406 260 348 334

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_88_c1|nmdc:mga00v17_88_c1_16232_17368
Length 378
Sequence MRGDSLRPRRRAGRGARTSPASNSGTRICDNPVTRAPRGLTELHRMLVIGVAGTELTAQERDWLQHDAVAGVILFKRNFASRDQVAELSAAIRAAAPRPQLICVDQEGGRVQRFQDGYSPLPPLDTFGKLYAQDQAAALRLAEEHAWLMASEIRASGVDLSFAPVVDLARGNRAIGNRAFSDDPQVVAAFTRAYVRGMHSVGMGATLKHFPGHGTVLEDTHFDDAVDPRPLEVLRSEDLVPFVAGIDAGADAVMMAHVAYPQVAPEPAGYSPRWIQQILREEMGFRGVVFSDDIGMAAAYSAGGIKARVDAHLDAGCDVVLVCHPELVADSLAAVEGRALNTAALLGLIGRGALGWDGLLADTRYGGARANLPPASLA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
4 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
5 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
6 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
7 2643221559 Lysobacter sp. Root559 Isolate Unclassified
8 2643221573 Lysobacter sp. Root604 Isolate Unclassified
9 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
10 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
11 2643221586 Lysobacter sp. Root667 Isolate Unclassified
12 2643221593 Lysobacter sp. Root690 Isolate Unclassified
13 2643221612 Lysobacter sp. Root76 Isolate Unclassified
14 2643221695 Lysobacter sp. Root494 Isolate Unclassified
15 2643221720 Lysobacter sp. Root916 Isolate Unclassified
16 2643221727 Lysobacter sp. Root96 Isolate Unclassified
17 2643221728 Lysobacter sp. Root983 Isolate Unclassified
18 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
19 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
20 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
21 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
22 2818991457 Xanthomonas translucens 569 Isolate Unclassified
23 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
24 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
25 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
26 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
27 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
28 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
29 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
30 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
31 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
32 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
33 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
34 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
35 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
36 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
37 2919513703 Luteimonas sp. 3794 Isolate Unclassified
38 2919675420 Luteimonas terrae 4099 Isolate Unclassified
39 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
40 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
41 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
42 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
43 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
44 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
45 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
46 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
47 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
48 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
49 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
50 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
51 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
52 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
53 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
54 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
55 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
56 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
57 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
58 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
59 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
60 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
61 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
62 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
63 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
64 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
65 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
66 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
67 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
68 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
69 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
70 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
71 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
72 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
73 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
76 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
81 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
82 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
83 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
122 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
125 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
126 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
127 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
173 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
174 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
175 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
176 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
194 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
195 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
196 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
197 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
198 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
199 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
200 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
201 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
202 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
203 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
204 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
205 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
212 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
213 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
253 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
258 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
259 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
260 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.71
Metatranscriptomes 0
Isolates 14.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 15.27
Nodule 0.25
Rhizoplane 2.46
Rhizosphere 62.56
Stem 0
Stem Tuber 0
Unclassified 19.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1093848 2162886007 Bacteria 4645
2 SwRhRL2b_contig_3286954 2162886007 Bacteria 1792
3 JGI25152J39213_1000018 3300002773 Bacteria 109715
4 JGI25150J39212_1000251 3300002774 Bacteria 28424
5 JGI25151J46595_10000032 3300003187 Bacteria 195408
6 JGI25151J46595_10000111 3300003187 Bacteria 111802
7 JGI25153J46596_10000085 3300003215 Bacteria 111802
8 rootH2_10008460 3300003320 Bacteria 14652
9 rootH1_10055545 3300003323 Bacteria 2310
10 Ga0055526_1000139 3300003771 Bacteria 63930
11 Ga0055526_1001785 3300003771 Bacteria 14939
12 Ga0055537_1000306 3300003773 Bacteria 33928
13 Ga0055537_1000721 3300003773 Bacteria 17128
14 Ga0055524_1000206 3300003775 Bacteria 63929
15 Ga0055524_1023034 3300003775 Bacteria 2015
16 Ga0055536_1001722 3300003781 Bacteria 12941
17 Ga0055536_1001780 3300003781 Bacteria 12694
18 Ga0055534_1000164 3300003784 Bacteria 49529
19 Ga0055534_1000388 3300003784 Bacteria 27515
20 Ga0055528_1000027 3300003790 Bacteria 126420
21 Ga0055528_1000867 3300003790 Bacteria 20519
22 Ga0055530_10003349 3300003791 Bacteria 9188
23 Ga0055530_10003352 3300003791 Bacteria 9185
24 Ga0055531_10002461 3300003794 Bacteria 12378
25 Ga0055531_10011370 3300003794 Bacteria 4303
26 Ga0055531_10014401 3300003794 Bacteria 3560
27 Ga0058692_1000011 3300003856 Bacteria 321321
28 Ga0058692_1000024 3300003856 Bacteria 219702
29 Ga0065714_10023212 3300005288 Bacteria 1504
30 Ga0065704_10079221 3300005289 Bacteria 4224
31 Ga0065704_10085738 3300005289 Bacteria 3191
32 Ga0065704_10092870 3300005289 Bacteria 2566
33 Ga0070670_100018211 3300005331 Bacteria 6027
34 Ga0068868_100062317 3300005338 Bacteria 2956
35 Ga0070661_100089203 3300005344 Bacteria 2283
36 Ga0070668_100014339 3300005347 Bacteria 5922
37 Ga0070668_100082019 3300005347 Bacteria 2529
38 Ga0070669_100048137 3300005353 Bacteria 3111
39 Ga0070669_100155510 3300005353 Bacteria 1773
40 Ga0070675_100135845 3300005354 Bacteria 2099
41 Ga0070671_100025945 3300005355 Bacteria 4812
42 Ga0070667_100071523 3300005367 Bacteria 2954
43 Ga0070714_100244190 3300005435 Bacteria 1658
44 Ga0070701_10120245 3300005438 Bacteria 1479
45 Ga0070663_100010227 3300005455 Bacteria 5843
46 Ga0068867_100356733 3300005459 Bacteria 1222
47 Ga0070685_10014495 3300005466 Bacteria 4177
48 Ga0068853_100048808 3300005539 Bacteria 3636
49 Ga0070672_100036634 3300005543 Bacteria 3738
50 Ga0070665_100000249 3300005548 Bacteria 89011
51 Ga0070665_100044427 3300005548 Bacteria 4461
52 Ga0070665_100065089 3300005548 Bacteria 3657
53 Ga0070664_100159191 3300005564 Bacteria 1997
54 Ga0068854_100004149 3300005578 Bacteria 9108
55 Ga0068852_100016932 3300005616 Bacteria 5702
56 Ga0068851_10016451 3300005834 Bacteria 3539
57 Ga0068863_100181771 3300005841 Bacteria 2019
58 Ga0068858_100027947 3300005842 Bacteria 5241
59 Ga0081539_10031091 3300005985 Bacteria 3298
60 Ga0075368_10070579 3300006042 Bacteria 1410
61 Ga0075364_10000527 3300006051 Bacteria 19477
62 Ga0075367_10073050 3300006178 Bacteria 2066
63 Ga0097620_100084411 3300006931 Bacteria 3221
64 Ga0105251_10001213 3300009011 Bacteria 22282
65 Ga0105244_10014709 3300009036 Bacteria 4517
66 Ga0105240_10001717 3300009093 Bacteria 36977
67 Ga0105240_10010222 3300009093 Bacteria 13208
68 Ga0105243_10013272 3300009148 Bacteria 6229
69 Ga0105241_10019316 3300009174 Bacteria 5025
70 Ga0105248_10008949 3300009177 Bacteria 11012
71 Ga0105248_10639687 3300009177 Bacteria 1200
72 Ga0105237_10295859 3300009545 Bacteria 1622
73 Ga0105238_10003486 3300009551 Bacteria 15662
74 Ga0105238_10026637 3300009551 Bacteria 5895
75 Ga0105249_10082895 3300009553 Bacteria 2984
76 Ga0105032_102188 3300009979 Bacteria 1757
77 Ga0105239_10238540 3300010375 Bacteria 2041
78 Ga0157373_10303655 3300013100 Bacteria 1133
79 Ga0157371_10000320 3300013102 Bacteria 62229
80 Ga0157371_10135104 3300013102 Bacteria 1756
81 Ga0157371_10148539 3300013102 Bacteria 1671
82 Ga0157371_10148540 3300013102 Bacteria 1671
83 Ga0157370_10038424 3300013104 Bacteria 4630
84 Ga0157370_10315722 3300013104 Bacteria 1442
85 Ga0157369_10014136 3300013105 Bacteria 9021
86 Ga0157369_10058886 3300013105 Bacteria 4143
87 Ga0157369_10067150 3300013105 Bacteria 3857
88 Ga0157374_10068080 3300013296 Bacteria 3349
89 Ga0157378_10047070 3300013297 Bacteria 3834
90 Ga0157375_10003676 3300013308 Bacteria 13318
91 Ga0157375_10074420 3300013308 Bacteria 3418
92 Ga0182008_10000045 3300014497 Bacteria 114620
93 Ga0182008_10010480 3300014497 Bacteria 4959
94 Ga0182006_1008438 3300015261 Bacteria 4667
95 Ga0182006_1014347 3300015261 Bacteria 3418
96 Ga0182007_10002332 3300015262 Bacteria 9529
97 Ga0182005_1001481 3300015265 Bacteria 9396
98 Ga0182005_1006647 3300015265 Bacteria 3514
99 Ga0183360_10001 3300015689 Bacteria 3943671
100 Ga0163161_10004554 3300017792 Bacteria 9654
101 Ga0163161_10008115 3300017792 Bacteria 7261
102 Ga0163161_10129870 3300017792 Bacteria 1899
103 Ga0207425_1000028 3300025245 Bacteria 286333
104 Ga0207425_1002152 3300025245 Bacteria 7203
105 Ga0209129_1000065 3300025258 Bacteria 232568
106 Ga0209233_1001201 3300025261 Bacteria 10446
107 Ga0209565_1000005 3300025263 Bacteria 947317
108 Ga0209565_1000119 3300025263 Bacteria 112825
109 Ga0209565_1007592 3300025263 Bacteria 2910
110 Ga0209673_1000011 3300025273 Bacteria 586604
111 Ga0209673_1000866 3300025273 Bacteria 39283
112 Ga0209130_1007945 3300025284 Bacteria 3198
113 Ga0209675_1000004 3300025291 Bacteria 947166
114 Ga0209675_1000048 3300025291 Bacteria 221457
115 Ga0209676_1000034 3300025292 Bacteria 460125
116 Ga0209676_1000091 3300025292 Bacteria 251328
117 Ga0209676_1000117 3300025292 Bacteria 203251
118 Ga0209676_1000355 3300025292 Bacteria 86710
119 Ga0209025_1000002 3300025294 Bacteria 1393142
120 Ga0209025_1000005 3300025294 Bacteria 1272149
121 Ga0209564_1000018 3300025295 Bacteria 586913
122 Ga0209564_1000106 3300025295 Bacteria 216131
123 Ga0209758_1000003 3300025297 Bacteria 1398533
124 Ga0209758_1009098 3300025297 Bacteria 6262
125 Ga0209050_1000175 3300025298 Bacteria 146845
126 Ga0209050_1000206 3300025298 Bacteria 131913
127 Ga0209050_1015949 3300025298 Bacteria 3110
128 Ga0209256_1000031 3300025299 Bacteria 410189
129 Ga0209256_1002529 3300025299 Bacteria 14679
130 Ga0209051_1006778 3300025303 Bacteria 6385
131 Ga0209257_1000062 3300025304 Bacteria 362413
132 Ga0209257_1000320 3300025304 Bacteria 100514
133 Ga0209257_1000492 3300025304 Bacteria 71085
134 Ga0209257_1000745 3300025304 Bacteria 49164
135 Ga0209257_1002308 3300025304 Bacteria 19281
136 Ga0207656_10022092 3300025321 Bacteria 2549
137 Ga0207713_1001220 3300025735 Bacteria 21475
138 Ga0207680_10070673 3300025903 Bacteria 2161
139 Ga0207647_10000111 3300025904 Bacteria 62900
140 Ga0207654_10051055 3300025911 Bacteria 2379
141 Ga0207695_10000033 3300025913 Bacteria 507477
142 Ga0207695_10008040 3300025913 Bacteria 13278
143 Ga0207695_10041932 3300025913 Bacteria 4894
144 Ga0207671_10017419 3300025914 Bacteria 5539
145 Ga0207657_10018935 3300025919 Bacteria 6553
146 Ga0207649_10010542 3300025920 Bacteria 5081
147 Ga0207694_10000487 3300025924 Bacteria 35975
148 Ga0207694_10001676 3300025924 Bacteria 18581
149 Ga0207694_10053952 3300025924 Bacteria 3118
150 Ga0207650_10013971 3300025925 Bacteria 5573
151 Ga0207650_10025350 3300025925 Bacteria 4224
152 Ga0207664_10328218 3300025929 Bacteria 1351
153 Ga0207644_10007411 3300025931 Bacteria 7151
154 Ga0207644_10412894 3300025931 Bacteria 1105
155 Ga0207706_10003449 3300025933 Bacteria 15098
156 Ga0207709_10000841 3300025935 Bacteria 23530
157 Ga0207709_10006756 3300025935 Bacteria 6423
158 Ga0207691_10003987 3300025940 Bacteria 14334
159 Ga0207691_10025162 3300025940 Bacteria 5591
160 Ga0207712_10000798 3300025961 Bacteria 23266
161 Ga0207668_10140855 3300025972 Bacteria 1854
162 Ga0207668_10141231 3300025972 Bacteria 1852
163 Ga0207640_10002211 3300025981 Bacteria 10469
164 Ga0207658_10035849 3300025986 Bacteria 3554
165 Ga0207703_10022651 3300026035 Bacteria 4932
166 Ga0207639_10021478 3300026041 Bacteria 4638
167 Ga0207678_10016445 3300026067 Bacteria 6495
168 Ga0207702_10122554 3300026078 Bacteria 2329
169 Ga0207648_10339708 3300026089 Bacteria 1352
170 Ga0207698_10012212 3300026142 Bacteria 5610
171 Ga0209371_1000007 3300027312 Bacteria 1050654
172 Ga0209371_1000016 3300027312 Bacteria 646301
173 Ga0209995_1013076 3300027471 Bacteria 1359
174 Ga0209970_1010987 3300027614 Bacteria 1486
175 Ga0209983_1006533 3300027665 Bacteria 2392
176 Ga0209971_1000629 3300027682 Bacteria 9157
177 Ga0209974_10001007 3300027876 Bacteria 9942
178 Ga0209974_10007006 3300027876 Bacteria 3903
179 Ga0268266_10000006 3300028379 Bacteria 1410021
180 Ga0268266_10037516 3300028379 Bacteria 4128
181 Ga0268266_10140460 3300028379 Bacteria 2167
182 Ga0268256_1000008 3300030500 Bacteria 1050654
183 Ga0268256_1000015 3300030500 Bacteria 646300
184 Ga0316177_1017865 3300030731 Bacteria 7592
185 Ga0316176_1100916 3300030732 Bacteria 2153
186 Ga0316181_1076177 3300030744 Bacteria 2445
187 Ga0316182_1181180 3300030745 Bacteria 1578
188 Ga0307513_10214853 3300031456 Bacteria 1750
189 Ga0307408_100057495 3300031548 Bacteria 2824
190 Ga0307408_100085460 3300031548 Bacteria 2369
191 Ga0307408_100264201 3300031548 Bacteria 1426
192 Ga0307508_10066378 3300031616 Bacteria 3177
193 Ga0307405_10245966 3300031731 Bacteria 1328
194 Ga0307413_10017513 3300031824 Bacteria 3733
195 Ga0307413_10079667 3300031824 Bacteria 2094
196 Ga0307413_10113116 3300031824 Bacteria 1821
197 Ga0307413_10362146 3300031824 Bacteria 1123
198 Ga0307406_10020122 3300031901 Bacteria 3925
199 Ga0307406_10094173 3300031901 Bacteria 2024
200 Ga0307412_10009157 3300031911 Bacteria 5674
201 Ga0307412_10092943 3300031911 Bacteria 2115
202 Ga0307412_10201164 3300031911 Bacteria 1513
203 Ga0307409_100420828 3300031995 Bacteria 1281
204 Ga0307414_10000389 3300032004 Bacteria 23930
205 Ga0307414_10004373 3300032004 Bacteria 7670
206 Ga0307414_10010446 3300032004 Bacteria 5387
207 Ga0307414_10019238 3300032004 Bacteria 4226
208 Ga0307414_10031049 3300032004 Bacteria 3498
209 Ga0307414_10063335 3300032004 Bacteria 2628
210 Ga0307414_10072805 3300032004 Bacteria 2483
211 Ga0307414_10175236 3300032004 Bacteria 1719
212 Ga0307414_10237693 3300032004 Bacteria 1506
213 Ga0307414_10320930 3300032004 Bacteria 1318
214 Ga0307411_10223102 3300032005 Bacteria 1463
215 Ga0307411_10305611 3300032005 Bacteria 1277
216 Ga0307415_100274368 3300032126 Bacteria 1383
217 Ga0395899_0013184 3300037312 Bacteria 6323
218 Ga0395900_0116115 3300037418 Bacteria 2746
219 Ga0395898_0165128 3300037466 Bacteria 2118
220 Ga0395898_0496838 3300037466 Bacteria 1160
221 Ga0395905_0003086 3300037471 Bacteria 18004
222 Ga0395901_0039960 3300038443 Bacteria 4856
223 Ga0237819_00315 3300038705 Bacteria 17820
224 Ga0439436_0003954 3300041404 Bacteria 4541
225 Ga0439439_0000666 3300041406 Bacteria 6041
226 Ga0439465_0001022 3300041413 Bacteria 8908
227 Ga0439465_0002125 3300041413 Bacteria 6517
228 Ga0439465_0004873 3300041413 Bacteria 4313
229 Ga0451791_0722552 3300041451 Bacteria 3214
230 Ga0451791_0986899 3300041451 Bacteria 2422
231 Ga0451793_0864598 3300041452 Bacteria 4640
232 Ga0451807_1292360 3300041486 Bacteria 2308
233 Ga0451843_0674605 3300041509 Bacteria 2646
234 Ga0451843_1093321 3300041509 Bacteria 2776
235 Ga0439431_0031919 3300041997 Bacteria 1311
236 Ga0439433_0013072 3300041999 Bacteria 1823
237 Ga0439445_0005686 3300042004 Bacteria 2849
238 Ga0439432_021921 3300042006 Bacteria 2113
239 Ga0439432_033048 3300042006 Bacteria 1666
240 Ga0439432_058978 3300042006 Bacteria 1186
241 Ga0439449_0000402 3300042007 Bacteria 16035
242 Ga0439449_0003231 3300042007 Bacteria 6357
243 Ga0439449_0003807 3300042007 Bacteria 5840
244 Ga0439449_0013336 3300042007 Bacteria 3092
245 Ga0439449_0026719 3300042007 Bacteria 2154
246 Ga0439449_0035712 3300042007 Bacteria 1849
247 Ga0453684_0002629 3300044712 Bacteria 42920
248 Ga0451576_0000632 3300045051 Bacteria 73171
249 Ga0495638_0000860 3300046460 Bacteria 31632
250 Ga0495610_0001283 3300046512 Bacteria 22455
251 Ga0495643_0006078 3300046522 Bacteria 8040
252 Ga0495663_0000616 3300046525 Bacteria 12392
253 Ga0495663_0011585 3300046525 Bacteria 2454
254 Ga0495621_0000303 3300046539 Bacteria 11889
255 Ga0495621_0065681 3300046539 Bacteria 1326
256 Ga0495633_0004244 3300046558 Bacteria 9173
257 Ga0495633_0023879 3300046558 Bacteria 3025
258 Ga0495656_0036590 3300046615 Bacteria 2022
259 Ga0495671_0003891 3300046692 Bacteria 9068
260 Ga0495636_0012909 3300047318 Bacteria 3311
261 Ga0495636_0014116 3300047318 Bacteria 3175
262 Ga0495636_0033301 3300047318 Bacteria 2116
263 Ga0495636_0038925 3300047318 Bacteria 1968
264 Ga0495672_0000073 3300047320 Bacteria 179398
265 Ga0495672_0049481 3300047320 Bacteria 2487
266 Ga0495686_0033958 3300047472 Bacteria 3288
267 Ga0496100_0019456 3300048903 Bacteria 4052
268 Ga0496100_0261771 3300048903 Bacteria 1283
269 Ga0496103_0191690 3300048906 Bacteria 1314
270 Ga0496108_0026216 3300048911 Bacteria 4807
271 Ga0496112_0041125 3300048915 Bacteria 4521
272 Ga0496114_0000693 3300048917 Bacteria 25075
273 Ga0496116_0001236 3300048919 Bacteria 29737
274 Ga0496117_0000476 3300048920 Bacteria 66684
275 Ga0496117_0006376 3300048920 Bacteria 11984
276 Ga0496117_0012066 3300048920 Bacteria 7669
277 Ga0496118_0000403 3300048921 Bacteria 72390
278 Ga0496118_0003246 3300048921 Bacteria 20729
279 Ga0496118_0024308 3300048921 Bacteria 5234
280 Ga0496118_0037077 3300048921 Bacteria 3930
281 Ga0496119_0000177 3300048922 Bacteria 89166
282 Ga0496119_0001108 3300048922 Bacteria 33950
283 Ga0496120_0000188 3300048923 Bacteria 105545
284 Ga0496120_0000328 3300048923 Bacteria 79028
285 Ga0496121_0002370 3300048924 Bacteria 28968
286 Ga0496121_0002623 3300048924 Bacteria 27120
287 Ga0496121_0007395 3300048924 Bacteria 13270
288 Ga0496122_0000209 3300048925 Bacteria 130440
289 Ga0496122_0000560 3300048925 Bacteria 76145
290 Ga0496122_0004505 3300048925 Bacteria 17215
291 Ga0496122_0045564 3300048925 Bacteria 3407
292 Ga0496123_0000106 3300048926 Bacteria 167799
293 Ga0496123_0000647 3300048926 Bacteria 58089
294 Ga0496123_0004655 3300048926 Bacteria 14243
295 Ga0496123_0077490 3300048926 Bacteria 2041
296 Ga0496124_0000401 3300048927 Bacteria 79057
297 Ga0496124_0000886 3300048927 Bacteria 48645
298 Ga0496124_0008454 3300048927 Bacteria 10760
299 Ga0496124_0010199 3300048927 Bacteria 9550
300 Ga0496124_0010766 3300048927 Bacteria 9219
301 Ga0496124_0031540 3300048927 Bacteria 4690
302 Ga0496124_0081108 3300048927 Bacteria 2667
303 Ga0496125_0016293 3300048928 Bacteria 7142
304 Ga0496125_0018845 3300048928 Bacteria 6534
305 Ga0496125_0031139 3300048928 Bacteria 4759
306 Ga0496125_0037475 3300048928 Bacteria 4215
307 Ga0496125_0061725 3300048928 Bacteria 3003
308 Ga0496126_0009180 3300048929 Bacteria 10548
309 Ga0496126_0010219 3300048929 Bacteria 9868
310 Ga0496126_0012857 3300048929 Bacteria 8554
311 Ga0501031_0096218 3300049568 Bacteria 1932
312 Ga0501032_0022318 3300049569 Bacteria 4388
313 Ga0501033_0000506 3300049570 Bacteria 36672
314 Ga0501034_0000420 3300049571 Bacteria 71131
315 Ga0501034_0003039 3300049571 Bacteria 19399
316 Ga0501034_0006311 3300049571 Bacteria 12762
317 Ga0501034_0012377 3300049571 Bacteria 8813
318 Ga0501034_0015389 3300049571 Bacteria 7861
319 Ga0501036_0052891 3300049572 Bacteria 3439
320 Ga0501036_0130947 3300049572 Bacteria 2118
321 Ga0501037_0246740 3300049573 Bacteria 1250
322 Ga0501038_0025380 3300049574 Bacteria 5283
323 Ga0501043_0246379 3300049579 Bacteria 1377
324 Ga0501046_0032341 3300049580 Bacteria 4236
325 Ga0501047_0002825 3300049581 Bacteria 16491
326 Ga0501047_0187789 3300049581 Bacteria 1931
327 Ga0501047_0203264 3300049581 Bacteria 1841
328 Ga0501047_0204325 3300049581 Bacteria 1835
329 Ga0501070_0082288 3300049586 Bacteria 2664
330 Ga0501070_0085561 3300049586 Bacteria 2610
331 Ga0501071_0207796 3300049587 Bacteria 1472
332 Ga0501073_0017892 3300049589 Bacteria 5128
333 Ga0501073_0020757 3300049589 Bacteria 4737
334 Ga0501074_0008290 3300049590 Bacteria 7536
335 Ga0501223_011132 3300049663 Bacteria 1806
336 Ga0501079_0114650 3300049741 Bacteria 2095
337 Ga0501080_0022788 3300049742 Bacteria 5802
338 Ga0501080_0060643 3300049742 Bacteria 3521
339 Ga0501080_0109410 3300049742 Bacteria 2561
340 Ga0501268_009948 3300049765 Bacteria 1471
341 Ga0501275_000056 3300049772 Bacteria 11424
342 Ga0501035_0047017 3300049822 Bacteria 3877
343 Ga0501035_0052322 3300049822 Bacteria 3654
344 Ga0501044_0430058 3300049823 Bacteria 1229
345 nmdc:mga00v17_3650_c1 3300050491 Bacteria 7954
346 nmdc:mga00v17_49576_c1 3300050491 Bacteria 2548
347 nmdc:mga00v17_88_c1 3300050491 Bacteria 56091
348 Ga0500634_0000054 3300053161 Bacteria 51788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003794 Ga0055531_10011370 Ga0055531_100113702 312
2 3300025304 Ga0209257_1000320 Ga0209257_100032057 312
3 3300009177 Ga0105248_10008949 Ga0105248_100089493 317
4 3300009093 Ga0105240_10010222 Ga0105240_1001022211 318
5 3300025913 Ga0207695_10008040 Ga0207695_100080406 318
6 3300049571 Ga0501034_0012377 Ga0501034_0012377_2738_3745 318
7 3300049822 Ga0501035_0052322 Ga0501035_0052322_1685_2698 320
8 3300005543 Ga0070672_100036634 Ga0070672_1000366342 321
9 3300025940 Ga0207691_10025162 Ga0207691_100251623 321
10 3300047320 Ga0495672_0049481 Ga0495672_0049481_1282_2292 321
11 iso_pu_bacteria 2919513703 2919514874 324
12 iso_pu_bacteria 2919675420 2919677340 324
13 3300041451 Ga0451791_0986899 Ga0451791_0986899_337_1344 326
14 3300041486 Ga0451807_1292360 Ga0451807_1292360_211_1218 326
15 3300049571 Ga0501034_0015389 Ga0501034_0015389_1422_2432 326
16 3300049581 Ga0501047_0203264 Ga0501047_0203264_799_1809 326
17 3300049586 Ga0501070_0082288 Ga0501070_0082288_1422_2432 326
18 3300049590 Ga0501074_0008290 Ga0501074_0008290_1102_2112 326
19 3300049742 Ga0501080_0022788 Ga0501080_0022788_313_1323 326
20 3300050491 nmdc:mga00v17_49576_c1 nmdc:mga00v17_49576_c1_1433_2500 327
21 iso_pu_bacteria 2571042365 2572255255 327
22 iso_pu_bacteria 2643221559 2643818746 327
23 iso_pu_bacteria 2643221573 2643878400 327
24 iso_pu_bacteria 2643221586 2643940997 327
25 iso_pu_bacteria 2643221593 2643975822 327
26 iso_pu_bacteria 2643221612 2644079961 327
27 iso_pu_bacteria 2643221695 2644529960 327
28 iso_pu_bacteria 2643221720 2644659704 327
29 iso_pu_bacteria 2643221727 2644695556 327
30 iso_pu_bacteria 2643221728 2644700551 327
31 iso_pu_bacteria 2747842501 2748017268 327
32 iso_pu_bacteria 2941489479 2941491441 327
33 iso_pu_bacteria 2995948881 2995952456 327
34 3300050491 nmdc:mga00v17_3650_c1 nmdc:mga00v17_3650_c1_4058_5044 328
35 iso_pu_bacteria 2524614729 2525555779 328
36 iso_pu_bacteria 2627854209 2630650793 328
37 iso_pu_bacteria 2894414249 2894417323 328
38 iso_pu_bacteria 2895498888 2895504045 328
39 iso_pu_bacteria 2895511927 2895515399 328
40 iso_pu_bacteria 2895522137 2895525090 328
41 iso_pu_bacteria 2895525241 2895527826 328
42 3300041451 Ga0451791_0722552 Ga0451791_0722552_96_1094 330
43 3300044712 Ga0453684_0002629 Ga0453684_0002629_39882_40883 330
44 3300045051 Ga0451576_0000632 Ga0451576_0000632_68123_69124 330
45 3300003187 JGI25151J46595_10000032 JGI25151J46595_1000003210 331
46 3300003323 rootH1_10055545 rootH1_100555452 331
47 3300003771 Ga0055526_1000139 Ga0055526_100013943 331
48 3300003773 Ga0055537_1000721 Ga0055537_10007219 331
49 3300003775 Ga0055524_1000206 Ga0055524_100020643 331
50 3300003784 Ga0055534_1000164 Ga0055534_10001649 331
51 3300003790 Ga0055528_1000027 Ga0055528_100002722 331
52 3300005355 Ga0070671_100025945 Ga0070671_1000259452 331
53 3300009177 Ga0105248_10639687 Ga0105248_106396872 331
54 3300013102 Ga0157371_10135104 Ga0157371_101351043 331
55 3300015689 Ga0183360_10001 Ga0183360_10001766 331
56 3300025245 Ga0207425_1002152 Ga0207425_10021526 331
57 3300025263 Ga0209565_1000005 Ga0209565_1000005355 331
58 3300025263 Ga0209565_1007592 Ga0209565_10075924 331
59 3300025273 Ga0209673_1000011 Ga0209673_100001110 331
60 3300025291 Ga0209675_1000004 Ga0209675_1000004355 331
61 3300025294 Ga0209025_1000005 Ga0209025_100000546 331
62 3300025295 Ga0209564_1000018 Ga0209564_100001810 331
63 3300025297 Ga0209758_1009098 Ga0209758_10090983 331
64 3300025299 Ga0209256_1000031 Ga0209256_1000031354 331
65 3300025931 Ga0207644_10007411 Ga0207644_100074113 331
66 3300031548 Ga0307408_100085460 Ga0307408_1000854601 331
67 3300031731 Ga0307405_10245966 Ga0307405_102459661 331
68 3300031824 Ga0307413_10017513 Ga0307413_100175133 331
69 3300031824 Ga0307413_10362146 Ga0307413_103621461 331
70 3300031901 Ga0307406_10020122 Ga0307406_100201224 331
71 3300031911 Ga0307412_10092943 Ga0307412_100929432 331
72 3300032004 Ga0307414_10000389 Ga0307414_1000038918 331
73 3300032004 Ga0307414_10010446 Ga0307414_100104465 331
74 3300032004 Ga0307414_10019238 Ga0307414_100192383 331
75 3300032004 Ga0307414_10063335 Ga0307414_100633352 331
76 3300032004 Ga0307414_10320930 Ga0307414_103209302 331
77 3300032005 Ga0307411_10305611 Ga0307411_103056111 331
78 3300032126 Ga0307415_100274368 Ga0307415_1002743682 331
79 3300037312 Ga0395899_0013184 Ga0395899_0013184_5217_6212 331
80 3300037418 Ga0395900_0116115 Ga0395900_0116115_446_1441 331
81 3300037466 Ga0395898_0496838 Ga0395898_0496838_101_1096 331
82 3300037471 Ga0395905_0003086 Ga0395905_0003086_2296_3291 331
83 3300038443 Ga0395901_0039960 Ga0395901_0039960_2312_3307 331
84 3300041404 Ga0439436_0003954 Ga0439436_0003954_906_1901 331
85 3300041406 Ga0439439_0000666 Ga0439439_0000666_255_1250 331
86 3300042006 Ga0439432_021921 Ga0439432_021921_634_1644 331
87 3300042007 Ga0439449_0003807 Ga0439449_0003807_3964_4974 331
88 3300042007 Ga0439449_0035712 Ga0439449_0035712_73_1083 331
89 3300046615 Ga0495656_0036590 Ga0495656_0036590_344_1402 331
90 3300047318 Ga0495636_0012909 Ga0495636_0012909_1195_2253 331
91 3300047318 Ga0495636_0014116 Ga0495636_0014116_1156_2166 331
92 3300047318 Ga0495636_0033301 Ga0495636_0033301_994_2004 331
93 3300048903 Ga0496100_0019456 Ga0496100_0019456_2540_3535 331
94 3300048911 Ga0496108_0026216 Ga0496108_0026216_76_1071 331
95 3300048915 Ga0496112_0041125 Ga0496112_0041125_1321_2316 331
96 3300048924 Ga0496121_0002370 Ga0496121_0002370_11107_12102 331
97 3300049581 Ga0501047_0187789 Ga0501047_0187789_95_1108 331
98 3300049823 Ga0501044_0430058 Ga0501044_0430058_67_1077 331
99 iso_pu_bacteria 2547132130 2547500114 331
100 iso_pu_bacteria 2547132130 2547503251 331
101 iso_pu_bacteria 2576861471 2578457462 331
102 iso_pu_bacteria 2643221579 2643908122 331
103 iso_pu_bacteria 2643221581 2643915676 331
104 iso_pu_bacteria 2747842428 2747950205 331
105 iso_pu_bacteria 2765235840 2765580022 331
106 iso_pu_bacteria 2816332141 2816518934 331
107 iso_pu_bacteria 2818991457 2819660247 331
108 iso_pu_bacteria 2842391507 2842395277 331
109 iso_pu_bacteria 2842757796 2842759475 331
110 iso_pu_bacteria 2852649853 2852649887 331
111 iso_pu_bacteria 2852684882 2852684934 331
112 iso_pu_bacteria 2857442823 2857444662 331
113 iso_pu_bacteria 2874220319 2874222709 331
114 iso_pu_bacteria 2919089067 2919093097 331
115 iso_pu_bacteria 2919130084 2919130476 331
116 iso_pu_bacteria 2919134579 2919138146 331
117 iso_pu_bacteria 2923516293 2923518796 331
118 iso_pu_bacteria 2928496128 2928500110 331
119 iso_pu_bacteria 2929195423 2929198517 331
120 iso_pu_bacteria 2931380184 2931383829 331
121 iso_pu_bacteria 2937610967 2937614635 331
122 iso_pu_bacteria 2939589442 2939591268 331
123 iso_pu_bacteria 2939622612 2939626791 331
124 iso_pu_bacteria 2939626828 2939628168 331
125 iso_pu_bacteria 2941475908 2941476768 331
126 iso_pu_bacteria 2961047084 2961049474 331
127 iso_pu_bacteria 2961064222 2961065851 331
128 iso_pu_bacteria 2974307012 2974308082 331
129 iso_pu_bacteria 2977247770 2977248814 331
130 iso_pu_bacteria 2984514374 2984516711 331
131 iso_pu_bacteria 2987605356 2987608298 331
132 iso_pu_bacteria 8002869464 8002872408 331
133 iso_pu_bacteria 8021622325 8021625335 331
134 iso_pu_bacteria 8021648035 8021649208 331
135 3300005288 Ga0065714_10023212 Ga0065714_100232122 332
136 3300005347 Ga0070668_100014339 Ga0070668_1000143393 332
137 3300005353 Ga0070669_100155510 Ga0070669_1001555102 332
138 3300005354 Ga0070675_100135845 Ga0070675_1001358452 332
139 3300005438 Ga0070701_10120245 Ga0070701_101202451 332
140 3300005459 Ga0068867_100356733 Ga0068867_1003567331 332
141 3300005539 Ga0068853_100048808 Ga0068853_1000488084 332
142 3300005841 Ga0068863_100181771 Ga0068863_1001817712 332
143 3300006051 Ga0075364_10000527 Ga0075364_100005275 332
144 3300006931 Ga0097620_100084411 Ga0097620_1000844112 332
145 3300010375 Ga0105239_10238540 Ga0105239_102385403 332
146 3300013105 Ga0157369_10058886 Ga0157369_100588862 332
147 3300013296 Ga0157374_10068080 Ga0157374_100680802 332
148 3300013297 Ga0157378_10047070 Ga0157378_100470703 332
149 3300013308 Ga0157375_10003676 Ga0157375_100036765 332
150 3300013308 Ga0157375_10074420 Ga0157375_100744205 332
151 3300025919 Ga0207657_10018935 Ga0207657_100189353 332
152 3300025931 Ga0207644_10412894 Ga0207644_104128942 332
153 3300025940 Ga0207691_10003987 Ga0207691_1000398711 332
154 3300025972 Ga0207668_10140855 Ga0207668_101408552 332
155 3300026041 Ga0207639_10021478 Ga0207639_100214781 332
156 3300026089 Ga0207648_10339708 Ga0207648_103397082 332
157 3300027471 Ga0209995_1013076 Ga0209995_10130762 332
158 3300027614 Ga0209970_1010987 Ga0209970_10109872 332
159 3300027665 Ga0209983_1006533 Ga0209983_10065332 332
160 3300027682 Ga0209971_1000629 Ga0209971_10006293 332
161 3300027876 Ga0209974_10001007 Ga0209974_100010076 332
162 3300027876 Ga0209974_10007006 Ga0209974_100070065 332
163 3300031548 Ga0307408_100057495 Ga0307408_1000574952 332
164 3300031548 Ga0307408_100264201 Ga0307408_1002642012 332
165 3300031824 Ga0307413_10079667 Ga0307413_100796672 332
166 3300031901 Ga0307406_10094173 Ga0307406_100941732 332
167 3300031911 Ga0307412_10201164 Ga0307412_102011642 332
168 3300031995 Ga0307409_100420828 Ga0307409_1004208281 332
169 3300032004 Ga0307414_10175236 Ga0307414_101752363 332
170 3300032005 Ga0307411_10223102 Ga0307411_102231022 332
171 3300037466 Ga0395898_0165128 Ga0395898_0165128_650_1648 332
172 3300041509 Ga0451843_0674605 Ga0451843_0674605_46_1047 332
173 3300042006 Ga0439432_033048 Ga0439432_033048_201_1199 332
174 3300042007 Ga0439449_0003231 Ga0439449_0003231_427_1425 332
175 3300046525 Ga0495663_0011585 Ga0495663_0011585_1236_2234 332
176 3300046539 Ga0495621_0000303 Ga0495621_0000303_9065_10063 332
177 3300046539 Ga0495621_0065681 Ga0495621_0065681_285_1283 332
178 3300047318 Ga0495636_0038925 Ga0495636_0038925_494_1492 332
179 3300049571 Ga0501034_0000420 Ga0501034_0000420_59987_61000 332
180 3300049663 Ga0501223_011132 Ga0501223_011132_253_1251 332
181 3300049765 Ga0501268_009948 Ga0501268_009948_249_1247 332
182 3300050491 nmdc:mga00v17_88_c1 nmdc:mga00v17_88_c1_16232_17368 332
183 3300005338 Ga0068868_100062317 Ga0068868_1000623174 333
184 3300005344 Ga0070661_100089203 Ga0070661_1000892031 333
185 3300005367 Ga0070667_100071523 Ga0070667_1000715233 333
186 3300005455 Ga0070663_100010227 Ga0070663_1000102272 333
187 3300005466 Ga0070685_10014495 Ga0070685_100144956 333
188 3300005548 Ga0070665_100000249 Ga0070665_10000024992 333
189 3300005564 Ga0070664_100159191 Ga0070664_1001591912 333
190 3300005578 Ga0068854_100004149 Ga0068854_1000041496 333
191 3300005616 Ga0068852_100016932 Ga0068852_1000169322 333
192 3300005834 Ga0068851_10016451 Ga0068851_100164512 333
193 3300005842 Ga0068858_100027947 Ga0068858_1000279473 333
194 3300009093 Ga0105240_10001717 Ga0105240_1000171712 333
195 3300009174 Ga0105241_10019316 Ga0105241_100193168 333
196 3300009545 Ga0105237_10295859 Ga0105237_102958591 333
197 3300009551 Ga0105238_10003486 Ga0105238_1000348610 333
198 3300009551 Ga0105238_10026637 Ga0105238_100266373 333
199 3300009553 Ga0105249_10082895 Ga0105249_100828951 333
200 3300013105 Ga0157369_10067150 Ga0157369_100671505 333
201 3300025261 Ga0209233_1001201 Ga0209233_10012016 333
202 3300025321 Ga0207656_10022092 Ga0207656_100220923 333
203 3300025903 Ga0207680_10070673 Ga0207680_100706733 333
204 3300025904 Ga0207647_10000111 Ga0207647_1000011143 333
205 3300025911 Ga0207654_10051055 Ga0207654_100510552 333
206 3300025913 Ga0207695_10000033 Ga0207695_10000033170 333
207 3300025913 Ga0207695_10041932 Ga0207695_100419326 333
208 3300025914 Ga0207671_10017419 Ga0207671_100174193 333
209 3300025920 Ga0207649_10010542 Ga0207649_100105425 333
210 3300025924 Ga0207694_10000487 Ga0207694_1000048726 333
211 3300025924 Ga0207694_10001676 Ga0207694_1000167611 333
212 3300025925 Ga0207650_10025350 Ga0207650_100253502 333
213 3300025933 Ga0207706_10003449 Ga0207706_1000344911 333
214 3300025961 Ga0207712_10000798 Ga0207712_100007987 333
215 3300025981 Ga0207640_10002211 Ga0207640_100022118 333
216 3300025986 Ga0207658_10035849 Ga0207658_100358492 333
217 3300026035 Ga0207703_10022651 Ga0207703_100226513 333
218 3300026067 Ga0207678_10016445 Ga0207678_100164456 333
219 3300026078 Ga0207702_10122554 Ga0207702_101225542 333
220 3300026142 Ga0207698_10012212 Ga0207698_100122125 333
221 3300028379 Ga0268266_10000006 Ga0268266_10000006145 333
222 3300048906 Ga0496103_0191690 Ga0496103_0191690_118_1128 333
223 3300048921 Ga0496118_0037077 Ga0496118_0037077_2123_3133 333
224 3300049571 Ga0501034_0006311 Ga0501034_0006311_1422_2432 333
225 3300049572 Ga0501036_0130947 Ga0501036_0130947_1081_2091 333
226 3300049573 Ga0501037_0246740 Ga0501037_0246740_133_1143 333
227 3300049579 Ga0501043_0246379 Ga0501043_0246379_82_1092 333
228 3300049580 Ga0501046_0032341 Ga0501046_0032341_56_1066 333
229 3300049581 Ga0501047_0002825 Ga0501047_0002825_3056_4066 333
230 3300049586 Ga0501070_0085561 Ga0501070_0085561_158_1168 333
231 3300049589 Ga0501073_0020757 Ga0501073_0020757_1231_2241 333
232 3300049741 Ga0501079_0114650 Ga0501079_0114650_56_1066 333
233 3300049742 Ga0501080_0109410 Ga0501080_0109410_1394_2404 333
234 3300025924 Ga0207694_10053952 Ga0207694_100539523 334
235 3300030731 Ga0316177_1017865 Ga0316177_10178657 334
236 3300041509 Ga0451843_1093321 Ga0451843_1093321_148_1152 334
237 3300041999 Ga0439433_0013072 Ga0439433_0013072_73_1077 334
238 2162886007 SwRhRL2b_contig_1093848 SwRhRL2b_0039.00006600 335
239 2162886007 SwRhRL2b_contig_3286954 SwRhRL2b_0034.00004410 335
240 3300002773 JGI25152J39213_1000018 JGI25152J39213_100001815 335
241 3300002774 JGI25150J39212_1000251 JGI25150J39212_100025116 335
242 3300003187 JGI25151J46595_10000111 JGI25151J46595_1000011116 335
243 3300003215 JGI25153J46596_10000085 JGI25153J46596_1000008586 335
244 3300003320 rootH2_10008460 rootH2_100084605 335
245 3300003771 Ga0055526_1001785 Ga0055526_100178513 335
246 3300003773 Ga0055537_1000306 Ga0055537_10003068 335
247 3300003775 Ga0055524_1023034 Ga0055524_10230342 335
248 3300003781 Ga0055536_1001722 Ga0055536_10017221 335
249 3300003781 Ga0055536_1001780 Ga0055536_10017801 335
250 3300003784 Ga0055534_1000388 Ga0055534_10003888 335
251 3300003790 Ga0055528_1000867 Ga0055528_10008678 335
252 3300003791 Ga0055530_10003349 Ga0055530_1000334910 335
253 3300003791 Ga0055530_10003352 Ga0055530_1000335210 335
254 3300003794 Ga0055531_10002461 Ga0055531_100024611 335
255 3300003794 Ga0055531_10014401 Ga0055531_100144016 335
256 3300003856 Ga0058692_1000011 Ga0058692_1000011122 335
257 3300003856 Ga0058692_1000024 Ga0058692_100002416 335
258 3300005289 Ga0065704_10079221 Ga0065704_100792215 335
259 3300005289 Ga0065704_10085738 Ga0065704_100857384 335
260 3300005289 Ga0065704_10092870 Ga0065704_100928701 335
261 3300005331 Ga0070670_100018211 Ga0070670_1000182115 335
262 3300005347 Ga0070668_100082019 Ga0070668_1000820191 335
263 3300005353 Ga0070669_100048137 Ga0070669_1000481373 335
264 3300005435 Ga0070714_100244190 Ga0070714_1002441902 335
265 3300005548 Ga0070665_100044427 Ga0070665_1000444273 335
266 3300005548 Ga0070665_100065089 Ga0070665_1000650891 335
267 3300005985 Ga0081539_10031091 Ga0081539_100310912 335
268 3300006042 Ga0075368_10070579 Ga0075368_100705791 335
269 3300006178 Ga0075367_10073050 Ga0075367_100730502 335
270 3300009011 Ga0105251_10001213 Ga0105251_1000121319 335
271 3300009036 Ga0105244_10014709 Ga0105244_100147094 335
272 3300009148 Ga0105243_10013272 Ga0105243_100132725 335
273 3300009979 Ga0105032_102188 Ga0105032_1021882 335
274 3300013100 Ga0157373_10303655 Ga0157373_103036551 335
275 3300013102 Ga0157371_10000320 Ga0157371_1000032012 335
276 3300013102 Ga0157371_10148539 Ga0157371_101485391 335
277 3300013102 Ga0157371_10148540 Ga0157371_101485401 335
278 3300013104 Ga0157370_10038424 Ga0157370_100384243 335
279 3300013104 Ga0157370_10315722 Ga0157370_103157222 335
280 3300013105 Ga0157369_10014136 Ga0157369_100141369 335
281 3300014497 Ga0182008_10000045 Ga0182008_1000004512 335
282 3300014497 Ga0182008_10010480 Ga0182008_100104805 335
283 3300015261 Ga0182006_1008438 Ga0182006_10084385 335
284 3300015261 Ga0182006_1014347 Ga0182006_10143472 335
285 3300015262 Ga0182007_10002332 Ga0182007_100023322 335
286 3300015265 Ga0182005_1001481 Ga0182005_100148112 335
287 3300015265 Ga0182005_1006647 Ga0182005_10066474 335
288 3300017792 Ga0163161_10004554 Ga0163161_100045541 335
289 3300017792 Ga0163161_10008115 Ga0163161_100081157 335
290 3300017792 Ga0163161_10129870 Ga0163161_101298702 335
291 3300025245 Ga0207425_1000028 Ga0207425_1000028185 335
292 3300025258 Ga0209129_1000065 Ga0209129_1000065133 335
293 3300025263 Ga0209565_1000119 Ga0209565_100011910 335
294 3300025273 Ga0209673_1000866 Ga0209673_100086618 335
295 3300025284 Ga0209130_1007945 Ga0209130_10079455 335
296 3300025291 Ga0209675_1000048 Ga0209675_100004836 335
297 3300025292 Ga0209676_1000034 Ga0209676_1000034322 335
298 3300025292 Ga0209676_1000091 Ga0209676_100009127 335
299 3300025292 Ga0209676_1000117 Ga0209676_100011728 335
300 3300025292 Ga0209676_1000355 Ga0209676_100035510 335
301 3300025294 Ga0209025_1000002 Ga0209025_100000287 335
302 3300025295 Ga0209564_1000106 Ga0209564_1000106137 335
303 3300025297 Ga0209758_1000003 Ga0209758_100000394 335
304 3300025298 Ga0209050_1000175 Ga0209050_100017513 335
305 3300025298 Ga0209050_1000206 Ga0209050_1000206120 335
306 3300025298 Ga0209050_1015949 Ga0209050_10159492 335
307 3300025299 Ga0209256_1002529 Ga0209256_10025298 335
308 3300025303 Ga0209051_1006778 Ga0209051_10067785 335
309 3300025304 Ga0209257_1000062 Ga0209257_1000062180 335
310 3300025304 Ga0209257_1000492 Ga0209257_100049251 335
311 3300025304 Ga0209257_1000745 Ga0209257_100074541 335
312 3300025304 Ga0209257_1002308 Ga0209257_100230812 335
313 3300025735 Ga0207713_1001220 Ga0207713_100122018 335
314 3300025925 Ga0207650_10013971 Ga0207650_100139714 335
315 3300025929 Ga0207664_10328218 Ga0207664_103282182 335
316 3300025935 Ga0207709_10000841 Ga0207709_1000084115 335
317 3300025935 Ga0207709_10006756 Ga0207709_100067562 335
318 3300025972 Ga0207668_10141231 Ga0207668_101412312 335
319 3300027312 Ga0209371_1000007 Ga0209371_1000007517 335
320 3300027312 Ga0209371_1000016 Ga0209371_1000016553 335
321 3300028379 Ga0268266_10037516 Ga0268266_100375162 335
322 3300028379 Ga0268266_10140460 Ga0268266_101404603 335
323 3300030500 Ga0268256_1000008 Ga0268256_1000008433 335
324 3300030500 Ga0268256_1000015 Ga0268256_100001516 335
325 3300030732 Ga0316176_1100916 Ga0316176_11009163 335
326 3300030744 Ga0316181_1076177 Ga0316181_10761773 335
327 3300030745 Ga0316182_1181180 Ga0316182_11811802 335
328 3300031456 Ga0307513_10214853 Ga0307513_102148532 335
329 3300031616 Ga0307508_10066378 Ga0307508_100663783 335
330 3300031824 Ga0307413_10113116 Ga0307413_101131162 335
331 3300031911 Ga0307412_10009157 Ga0307412_100091573 335
332 3300032004 Ga0307414_10004373 Ga0307414_100043735 335
333 3300032004 Ga0307414_10031049 Ga0307414_100310494 335
334 3300032004 Ga0307414_10072805 Ga0307414_100728053 335
335 3300032004 Ga0307414_10237693 Ga0307414_102376931 335
336 3300038705 Ga0237819_00315 Ga0237819_00315_6027_7034 335
337 3300041413 Ga0439465_0001022 Ga0439465_0001022_765_1772 335
338 3300041413 Ga0439465_0002125 Ga0439465_0002125_4907_5914 335
339 3300041413 Ga0439465_0004873 Ga0439465_0004873_497_1504 335
340 3300041452 Ga0451793_0864598 Ga0451793_0864598_100_1107 335
341 3300041997 Ga0439431_0031919 Ga0439431_0031919_101_1108 335
342 3300042004 Ga0439445_0005686 Ga0439445_0005686_842_1849 335
343 3300042006 Ga0439432_058978 Ga0439432_058978_83_1090 335
344 3300042007 Ga0439449_0000402 Ga0439449_0000402_3916_4923 335
345 3300042007 Ga0439449_0013336 Ga0439449_0013336_319_1326 335
346 3300042007 Ga0439449_0026719 Ga0439449_0026719_287_1294 335
347 3300046460 Ga0495638_0000860 Ga0495638_0000860_8648_9655 335
348 3300046512 Ga0495610_0001283 Ga0495610_0001283_16607_17614 335
349 3300046522 Ga0495643_0006078 Ga0495643_0006078_6797_7804 335
350 3300046525 Ga0495663_0000616 Ga0495663_0000616_11060_12067 335
351 3300046558 Ga0495633_0004244 Ga0495633_0004244_217_1323 335
352 3300046558 Ga0495633_0023879 Ga0495633_0023879_715_1767 335
353 3300046692 Ga0495671_0003891 Ga0495671_0003891_8034_9041 335
354 3300047320 Ga0495672_0000073 Ga0495672_0000073_6829_7836 335
355 3300047472 Ga0495686_0033958 Ga0495686_0033958_2037_3044 335
356 3300048903 Ga0496100_0261771 Ga0496100_0261771_190_1245 335
357 3300048917 Ga0496114_0000693 Ga0496114_0000693_5834_6841 335
358 3300048919 Ga0496116_0001236 Ga0496116_0001236_8605_9612 335
359 3300048920 Ga0496117_0000476 Ga0496117_0000476_8411_9418 335
360 3300048920 Ga0496117_0006376 Ga0496117_0006376_2311_3318 335
361 3300048920 Ga0496117_0012066 Ga0496117_0012066_3893_4900 335
362 3300048921 Ga0496118_0000403 Ga0496118_0000403_8408_9415 335
363 3300048921 Ga0496118_0003246 Ga0496118_0003246_11056_12063 335
364 3300048921 Ga0496118_0024308 Ga0496118_0024308_268_1275 335
365 3300048922 Ga0496119_0000177 Ga0496119_0000177_5173_6180 335
366 3300048922 Ga0496119_0001108 Ga0496119_0001108_8412_9419 335
367 3300048923 Ga0496120_0000188 Ga0496120_0000188_8396_9403 335
368 3300048923 Ga0496120_0000328 Ga0496120_0000328_8573_9580 335
369 3300048924 Ga0496121_0002623 Ga0496121_0002623_17471_18478 335
370 3300048924 Ga0496121_0007395 Ga0496121_0007395_50_1057 335
371 3300048925 Ga0496122_0000209 Ga0496122_0000209_120855_121862 335
372 3300048925 Ga0496122_0000560 Ga0496122_0000560_30915_31922 335
373 3300048925 Ga0496122_0004505 Ga0496122_0004505_8137_9159 335
374 3300048925 Ga0496122_0045564 Ga0496122_0045564_2320_3327 335
375 3300048926 Ga0496123_0000106 Ga0496123_0000106_158209_159216 335
376 3300048926 Ga0496123_0000647 Ga0496123_0000647_30893_31900 335
377 3300048926 Ga0496123_0004655 Ga0496123_0004655_4858_5880 335
378 3300048926 Ga0496123_0077490 Ga0496123_0077490_932_1939 335
379 3300048927 Ga0496124_0000401 Ga0496124_0000401_69578_70585 335
380 3300048927 Ga0496124_0000886 Ga0496124_0000886_40422_41429 335
381 3300048927 Ga0496124_0008454 Ga0496124_0008454_102_1109 335
382 3300048927 Ga0496124_0010199 Ga0496124_0010199_77_1084 335
383 3300048927 Ga0496124_0010766 Ga0496124_0010766_8029_9036 335
384 3300048927 Ga0496124_0031540 Ga0496124_0031540_903_1910 335
385 3300048927 Ga0496124_0081108 Ga0496124_0081108_1477_2484 335
386 3300048928 Ga0496125_0016293 Ga0496125_0016293_6056_7063 335
387 3300048928 Ga0496125_0018845 Ga0496125_0018845_5444_6451 335
388 3300048928 Ga0496125_0031139 Ga0496125_0031139_3647_4654 335
389 3300048928 Ga0496125_0037475 Ga0496125_0037475_3129_4136 335
390 3300048928 Ga0496125_0061725 Ga0496125_0061725_391_1398 335
391 3300048929 Ga0496126_0009180 Ga0496126_0009180_1185_2192 335
392 3300048929 Ga0496126_0010219 Ga0496126_0010219_4470_5492 335
393 3300048929 Ga0496126_0012857 Ga0496126_0012857_1866_2873 335
394 3300049568 Ga0501031_0096218 Ga0501031_0096218_205_1272 335
395 3300049569 Ga0501032_0022318 Ga0501032_0022318_2518_3570 335
396 3300049570 Ga0501033_0000506 Ga0501033_0000506_19763_20815 335
397 3300049571 Ga0501034_0003039 Ga0501034_0003039_8366_9373 335
398 3300049572 Ga0501036_0052891 Ga0501036_0052891_1598_2650 335
399 3300049574 Ga0501038_0025380 Ga0501038_0025380_396_1448 335
400 3300049581 Ga0501047_0204325 Ga0501047_0204325_660_1712 335
401 3300049587 Ga0501071_0207796 Ga0501071_0207796_395_1447 335
402 3300049589 Ga0501073_0017892 Ga0501073_0017892_3820_4872 335
403 3300049742 Ga0501080_0060643 Ga0501080_0060643_1805_2857 335
404 3300049772 Ga0501275_000056 Ga0501275_000056_1116_2123 335
405 3300049822 Ga0501035_0047017 Ga0501035_0047017_1344_2396 335
406 3300053161 Ga0500634_0000054 Ga0500634_0000054_41117_42169 335

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00933

Glyco_hydro_3

Glycosyl hydrolase family 3 N terminal domain

40

346

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5utr-assembly2.cif.gz_B crystal structure of burkholderia cenocepacia family 3 glycoside hydrolase (nagz) bound to (3s,4r,5r,6s)-3-butyryl-4,5,6-trihydroxyazepane 0.9573 2 331
4hzm-assembly2.cif.gz_B crystal structure of salmonella typhimurium family 3 glycoside hydrolase (nagz) bound to n-[(3s,4r,5r,6r)-4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl]butanamide 0.9489 2 329
4gvi-assembly2.cif.gz_B crystal structure of mutant (d248n) salmonella typhimurium family 3 glycoside hydrolase (nagz) in complex with glcnac-1,6-anhmurnac 0.9481 2 329
4gvi-assembly1.cif.gz_A crystal structure of mutant (d248n) salmonella typhimurium family 3 glycoside hydrolase (nagz) in complex with glcnac-1,6-anhmurnac 0.9474 2 329
4gvf-assembly1.cif.gz_A crystal structure of salmonella typhimurium family 3 glycoside hydrolase (nagz) bound to glcnac 0.9463 2 329
ID Description Score Start End Superfamily
4gnvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.9422 2 331 3.20.20.300
5g3rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.9378 2 331 3.20.20.300
4gnvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.9258 2 331 3.20.20.300
2oxnA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.9238 2 329 3.20.20.300
5g3rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.916 2 331 3.20.20.300
ID Description Score Start End GO Terms
AF-Q4USG7-F1-model_v4 Beta-hexosaminidase (EC 3.2.1.52) (Beta-N-acetylhexosaminidase) (N-acetyl-beta-glucosaminidase) 0.9909 1 318 GO:0005737
GO:0005975
GO:0008360
GO:0009252
GO:0009254
GO:0016231
GO:0051301
GO:0071555
AF-B4SRK3-F1-model_v4 Beta-hexosaminidase (EC 3.2.1.52) (Beta-N-acetylhexosaminidase) (N-acetyl-beta-glucosaminidase) 0.9907 1 332 GO:0005737
GO:0005975
GO:0008360
GO:0009252
GO:0009254
GO:0016231
GO:0051301
GO:0071555
AF-W4SK91-F1-model_v4 Beta-hexosaminidase (EC 3.2.1.52) (Beta-N-acetylhexosaminidase) (N-acetyl-beta-glucosaminidase) 0.9902 1 316 GO:0005737
GO:0005975
GO:0008360
GO:0009252
GO:0009254
GO:0016231
GO:0051301
GO:0071555
AF-A0A126NK80-F1-model_v4 Beta-hexosaminidase (EC 3.2.1.52) (Beta-N-acetylhexosaminidase) (N-acetyl-beta-glucosaminidase) 0.9861 1 331 GO:0005737
GO:0005975
GO:0008360
GO:0009252
GO:0009254
GO:0016231
GO:0051301
GO:0071555
AF-B0U3L0-F1-model_v4 Beta-hexosaminidase (EC 3.2.1.52) (Beta-N-acetylhexosaminidase) (N-acetyl-beta-glucosaminidase) 0.9852 1 329 GO:0005737
GO:0005975
GO:0008360
GO:0009252
GO:0009254
GO:0016231
GO:0051301
GO:0071555

Feature Viewer

pLDDT pTM Quality
91.07 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map