F436337

General Info

Members Datasets Scaffolds Average Seq Length
406 259 812 328

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_142385_c1|nmdc:mga0yw44_142385_c1_281_1306
Length 341
Sequence LKKEEISMTASTQPKTRTLGNSNLSVLPIGLGCMSLSGAYGKSNDDEAIRVIHHAIDRGVNFLDSSDMYGWGHNETLLGKALAGGRRGKVVLATKFGQTQQPGGANGVDGSPAYVKAACDASLKRLGVDVIDLYYQHRVDPSVPIEDTVGAMGELVKAGKVRALGLSEAKPETIRRAHKVHPLAAVQSEYSLLYREHAEETLKTTRALGISYVAYSPLGRSLLTGTVRQAADIPEGDGRGRHPRFVGDNLGRNLAKTSAIEAVAREKGCKPGQVALAWLLAQGADIVPIPGTKRSERVDENLAALEVALSADEVTRLSTALPPGAAAGTRYPEGGMKGVYL

Samples

Sample ID Description Type Environment
1 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
143 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
144 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
145 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
146 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
147 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
148 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
173 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
176 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
177 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
178 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
179 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.17
Nodule 0
Rhizoplane 0.74
Rhizosphere 93.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0yw44_142385_c1 3300050492 Bacteria 1559
2 Ga0065707_10008820 3300005295 Bacteria 3605
3 Ga0065707_10135065 3300005295 Bacteria 1855
4 Ga0070658_10005298 3300005327 Bacteria 10470
5 Ga0070658_10255320 3300005327 Bacteria 1488
6 Ga0070683_100052087 3300005329 Bacteria 3791
7 Ga0070690_100000841 3300005330 Bacteria 15569
8 Ga0068869_100001651 3300005334 Bacteria 13315
9 Ga0070666_10149100 3300005335 Bacteria 1632
10 Ga0070680_100001241 3300005336 Bacteria 18376
11 Ga0070680_100227103 3300005336 Bacteria 1576
12 Ga0070682_100011140 3300005337 Bacteria 5131
13 Ga0068868_100004039 3300005338 Bacteria 10228
14 Ga0070689_100097436 3300005340 Bacteria 2326
15 Ga0070689_100150351 3300005340 Bacteria 1877
16 Ga0070691_10022378 3300005341 Bacteria 2932
17 Ga0070687_100000713 3300005343 Bacteria 11062
18 Ga0070687_100079261 3300005343 Bacteria 1787
19 Ga0070692_10008183 3300005345 Bacteria 4652
20 Ga0070669_100226914 3300005353 Bacteria 1479
21 Ga0070675_100098135 3300005354 Bacteria 2464
22 Ga0070667_100064038 3300005367 Bacteria 3119
23 Ga0070714_100001717 3300005435 Bacteria 15944
24 Ga0070713_100108891 3300005436 Bacteria 2413
25 Ga0070710_10000615 3300005437 Bacteria 16951
26 Ga0070710_10073068 3300005437 Bacteria 1982
27 Ga0070701_10011337 3300005438 Bacteria 3981
28 Ga0070701_10073381 3300005438 Bacteria 1835
29 Ga0070711_100001965 3300005439 Bacteria 11538
30 Ga0070705_100180656 3300005440 Bacteria 1429
31 Ga0070700_100001890 3300005441 Bacteria 10586
32 Ga0070694_100011477 3300005444 Bacteria 5488
33 Ga0070694_100058806 3300005444 Bacteria 2616
34 Ga0070694_100083203 3300005444 Bacteria 2230
35 Ga0070681_10003085 3300005458 Bacteria 15467
36 Ga0068867_100000640 3300005459 Bacteria 23146
37 Ga0068867_100026035 3300005459 Bacteria 4197
38 Ga0070706_100082746 3300005467 Bacteria 2973
39 Ga0070707_100331883 3300005468 Bacteria 1477
40 Ga0070698_100004749 3300005471 Bacteria 14921
41 Ga0070699_100071116 3300005518 Bacteria 3025
42 Ga0070699_100137863 3300005518 Bacteria 2153
43 Ga0070679_100005398 3300005530 Bacteria 11844
44 Ga0070686_100197543 3300005544 Bacteria 1440
45 Ga0070695_100090317 3300005545 Bacteria 2044
46 Ga0070695_100284486 3300005545 Bacteria 1216
47 Ga0070696_100000527 3300005546 Bacteria 24255
48 Ga0070696_100002762 3300005546 Bacteria 11646
49 Ga0070693_100001459 3300005547 Bacteria 10658
50 Ga0070693_100013135 3300005547 Bacteria 4211
51 Ga0070665_100126997 3300005548 Bacteria 2553
52 Ga0070704_100002169 3300005549 Bacteria 10934
53 Ga0070704_100005292 3300005549 Bacteria 7520
54 Ga0068855_100291339 3300005563 Bacteria 1809
55 Ga0070664_100070708 3300005564 Bacteria 2989
56 Ga0068857_100112954 3300005577 Bacteria 2442
57 Ga0068854_100013384 3300005578 Bacteria 5383
58 Ga0068854_100119514 3300005578 Bacteria 1998
59 Ga0068856_100016600 3300005614 Bacteria 7128
60 Ga0068856_100049328 3300005614 Bacteria 4149
61 Ga0068856_100349116 3300005614 Bacteria 1498
62 Ga0070702_100005829 3300005615 Bacteria 5776
63 Ga0070702_100070951 3300005615 Bacteria 2058
64 Ga0068864_100128626 3300005618 Bacteria 2272
65 Ga0068866_10001344 3300005718 Bacteria 10628
66 Ga0068866_10130366 3300005718 Bacteria 1429
67 Ga0068861_100000456 3300005719 Bacteria 23810
68 Ga0068861_100038867 3300005719 Bacteria 3548
69 Ga0068863_100040665 3300005841 Bacteria 4420
70 Ga0068863_100335157 3300005841 Bacteria 1471
71 Ga0068862_100003371 3300005844 Bacteria 13778
72 Ga0081455_10000243 3300005937 Bacteria 70794
73 Ga0081455_10017097 3300005937 Bacteria 6969
74 Ga0081538_10008234 3300005981 Bacteria 8884
75 Ga0081538_10079656 3300005981 Bacteria 1751
76 Ga0081539_10001920 3300005985 Bacteria 32135
77 Ga0081539_10005219 3300005985 Bacteria 13451
78 Ga0075365_10136898 3300006038 Bacteria 1698
79 Ga0075365_10162055 3300006038 Bacteria 1558
80 Ga0070715_10012665 3300006163 Bacteria 3077
81 Ga0075362_10008147 3300006177 Bacteria 3999
82 Ga0075367_10119255 3300006178 Bacteria 1625
83 Ga0075369_10007173 3300006186 Bacteria 4236
84 Ga0097621_100005085 3300006237 Bacteria 9241
85 Ga0075370_10003641 3300006353 Bacteria 7376
86 Ga0075370_10056358 3300006353 Bacteria 2234
87 Ga0068871_100035054 3300006358 Bacteria 3986
88 Ga0075428_100002876 3300006844 Bacteria 18778
89 Ga0075428_100051805 3300006844 Bacteria 4501
90 Ga0075428_100084187 3300006844 Bacteria 3470
91 Ga0075428_100105661 3300006844 Bacteria 3070
92 Ga0075430_100007753 3300006846 Bacteria 9070
93 Ga0075430_100026081 3300006846 Bacteria 4972
94 Ga0075431_100000647 3300006847 Bacteria 29545
95 Ga0075431_100030839 3300006847 Bacteria 5523
96 Ga0075431_100190800 3300006847 Bacteria 2099
97 Ga0075431_100250997 3300006847 Bacteria 1798
98 Ga0075434_100000221 3300006871 Bacteria 38986
99 Ga0075434_100094831 3300006871 Bacteria 2989
100 Ga0075429_100009086 3300006880 Bacteria 8631
101 Ga0075429_100301597 3300006880 Bacteria 1402
102 Ga0068865_100002491 3300006881 Bacteria 10906
103 Ga0068865_100051202 3300006881 Bacteria 2857
104 Ga0068865_100089269 3300006881 Bacteria 2232
105 Ga0075436_100001742 3300006914 Bacteria 14903
106 Ga0075435_100000249 3300007076 Bacteria 33358
107 Ga0099794_10055086 3300007265 Bacteria 1921
108 Ga0111539_10004830 3300009094 Bacteria 17568
109 Ga0111539_10005703 3300009094 Bacteria 16116
110 Ga0111539_10060150 3300009094 Bacteria 4503
111 Ga0111539_10073836 3300009094 Bacteria 4020
112 Ga0111539_10273147 3300009094 Bacteria 1967
113 Ga0111539_10583581 3300009094 Bacteria 1302
114 Ga0105245_10026033 3300009098 Bacteria 5147
115 Ga0114129_10003165 3300009147 Bacteria 23085
116 Ga0114129_10324278 3300009147 Bacteria 2047
117 Ga0105243_10002569 3300009148 Bacteria 15169
118 Ga0105243_10032653 3300009148 Bacteria 4023
119 Ga0105242_10005337 3300009176 Bacteria 9931
120 Ga0105242_10211746 3300009176 Bacteria 1728
121 Ga0105242_10300932 3300009176 Bacteria 1464
122 Ga0105249_10008025 3300009553 Bacteria 9199
123 Ga0105249_10017573 3300009553 Bacteria 6350
124 Ga0105249_10033380 3300009553 Bacteria 4659
125 Ga0105239_10182689 3300010375 Bacteria 2346
126 Ga0157378_10017676 3300013297 Bacteria 6260
127 Ga0163162_10023311 3300013306 Bacteria 6109
128 Ga0163162_10442379 3300013306 Bacteria 1432
129 Ga0157372_10412071 3300013307 Bacteria 1575
130 Ga0163163_10386565 3300014325 Bacteria 1457
131 Ga0157376_10016340 3300014969 Bacteria 5632
132 Ga0213872_10020935 3300021361 Bacteria 3013
133 Ga0213876_10010605 3300021384 Bacteria 4937
134 Ga0207697_10074392 3300025315 Bacteria 1427
135 Ga0207653_10059513 3300025885 Bacteria 1286
136 Ga0207692_10000073 3300025898 Bacteria 29005
137 Ga0207680_10240052 3300025903 Bacteria 1248
138 Ga0207647_10129736 3300025904 Bacteria 1482
139 Ga0207685_10001201 3300025905 Bacteria 5239
140 Ga0207699_10001951 3300025906 Bacteria 9731
141 Ga0207645_10094013 3300025907 Bacteria 1929
142 Ga0207645_10204497 3300025907 Bacteria 1299
143 Ga0207643_10033050 3300025908 Bacteria 2893
144 Ga0207643_10078169 3300025908 Bacteria 1914
145 Ga0207684_10127087 3300025910 Bacteria 2188
146 Ga0207707_10020057 3300025912 Bacteria 5833
147 Ga0207695_10038583 3300025913 Bacteria 5140
148 Ga0207671_10421418 3300025914 Bacteria 1062
149 Ga0207693_10041377 3300025915 Bacteria 3627
150 Ga0207663_10022203 3300025916 Bacteria 3625
151 Ga0207660_10019929 3300025917 Bacteria 4494
152 Ga0207662_10000953 3300025918 Bacteria 13423
153 Ga0207662_10058161 3300025918 Bacteria 2313
154 Ga0207657_10255520 3300025919 Bacteria 1396
155 Ga0207649_10021559 3300025920 Bacteria 3711
156 Ga0207652_10005518 3300025921 Bacteria 10253
157 Ga0207681_10231578 3300025923 Bacteria 1434
158 Ga0207694_10036678 3300025924 Bacteria 3763
159 Ga0207659_10018191 3300025926 Bacteria 4603
160 Ga0207687_10020099 3300025927 Bacteria 4429
161 Ga0207700_10002308 3300025928 Bacteria 10949
162 Ga0207700_10077086 3300025928 Bacteria 2588
163 Ga0207664_10002203 3300025929 Bacteria 12839
164 Ga0207686_10188026 3300025934 Bacteria 1470
165 Ga0207709_10014755 3300025935 Bacteria 4320
166 Ga0207709_10015973 3300025935 Bacteria 4167
167 Ga0207670_10015089 3300025936 Bacteria 4607
168 Ga0207670_10015283 3300025936 Bacteria 4583
169 Ga0207670_10149157 3300025936 Bacteria 1733
170 Ga0207704_10004892 3300025938 Bacteria 6155
171 Ga0207704_10086660 3300025938 Bacteria 2043
172 Ga0207691_10202574 3300025940 Bacteria 1727
173 Ga0207689_10060040 3300025942 Bacteria 3127
174 Ga0207689_10071265 3300025942 Bacteria 2854
175 Ga0207689_10242636 3300025942 Bacteria 1489
176 Ga0207679_10500239 3300025945 Bacteria 1084
177 Ga0207667_10009161 3300025949 Bacteria 11692
178 Ga0207667_10066083 3300025949 Bacteria 3771
179 Ga0207712_10004759 3300025961 Bacteria 8570
180 Ga0207712_10119674 3300025961 Bacteria 1990
181 Ga0207712_10332600 3300025961 Bacteria 1257
182 Ga0207668_10015913 3300025972 Bacteria 4683
183 Ga0207640_10004854 3300025981 Bacteria 7302
184 Ga0207640_10061970 3300025981 Bacteria 2480
185 Ga0207658_10179743 3300025986 Bacteria 1750
186 Ga0207677_10129799 3300026023 Bacteria 1911
187 Ga0207708_10004694 3300026075 Bacteria 10051
188 Ga0207708_10007120 3300026075 Bacteria 8265
189 Ga0207708_10046266 3300026075 Bacteria 3314
190 Ga0207702_10028548 3300026078 Bacteria 4638
191 Ga0207702_10276204 3300026078 Bacteria 1586
192 Ga0207641_10289853 3300026088 Bacteria 1543
193 Ga0207641_10307180 3300026088 Bacteria 1500
194 Ga0207648_10000238 3300026089 Bacteria 59053
195 Ga0207648_10007300 3300026089 Bacteria 10896
196 Ga0207648_10040208 3300026089 Bacteria 4109
197 Ga0207675_100001083 3300026118 Bacteria 26980
198 Ga0207675_100007203 3300026118 Bacteria 10503
199 Ga0207675_100040231 3300026118 Bacteria 4365
200 Ga0207675_100256900 3300026118 Bacteria 1692
201 Ga0207675_100518982 3300026118 Bacteria 1187
202 Ga0207683_10157179 3300026121 Bacteria 2054
203 Ga0209981_1003934 3300027378 Bacteria 1935
204 Ga0209995_1013364 3300027471 Bacteria 1344
205 Ga0209971_1010152 3300027682 Bacteria 2227
206 Ga0209974_10038533 3300027876 Bacteria 1589
207 Ga0207428_10020619 3300027907 Bacteria 5596
208 Ga0207428_10021886 3300027907 Bacteria 5405
209 Ga0207428_10265079 3300027907 Bacteria 1279
210 Ga0268266_10011364 3300028379 Bacteria 7742
211 Ga0268265_10001655 3300028380 Bacteria 18241
212 Ga0268264_10572153 3300028381 Bacteria 1110
213 Ga0265334_10049885 3300028573 Bacteria 1609
214 Ga0265340_10074745 3300031247 Bacteria 1602
215 Ga0265316_10071045 3300031344 Bacteria 2684
216 Ga0307416_100431962 3300032002 Bacteria 1364
217 Ga0307411_10202837 3300032005 Bacteria 1525
218 Ga0373950_0009117 3300034818 Bacteria 1576
219 Ga0373938_0010026 3300034957 Bacteria 1730
220 Ga0373926_0000727 3300035083 Bacteria 9135
221 Ga0373926_0017944 3300035083 Bacteria 2431
222 Ga0373940_0004706 3300035088 Bacteria 2904
223 Ga0373944_0036683 3300035089 Bacteria 1498
224 Ga0373952_0001215 3300035092 Bacteria 4689
225 Ga0373932_0001922 3300035112 Bacteria 5532
226 Ga0373936_0012624 3300035113 Bacteria 3215
227 Ga0373939_0043573 3300035114 Bacteria 1362
228 Ga0373941_0010886 3300035115 Bacteria 2338
229 Ga0373945_0012991 3300035116 Bacteria 2774
230 Ga0373954_0000071 3300035118 Bacteria 36140
231 Ga0373960_0008016 3300035121 Bacteria 2519
232 Ga0373943_0002563 3300035170 Bacteria 8265
233 Ga0373946_0005223 3300035171 Bacteria 4682
234 Ga0373942_0003706 3300035207 Bacteria 3584
235 Ga0373961_0022581 3300035241 Bacteria 1684
236 Ga0373961_0040012 3300035241 Bacteria 1349
237 Ga0373931_0010151 3300035691 Bacteria 4520
238 Ga0373931_0160964 3300035691 Bacteria 1316
239 Ga0373935_0022922 3300035692 Bacteria 3833
240 Ga0373935_0093840 3300035692 Bacteria 1968
241 Ga0373927_0022719 3300035695 Bacteria 4107
242 Ga0373927_0048238 3300035695 Bacteria 2754
243 Ga0373933_0006966 3300035724 Bacteria 6161
244 Ga0373947_0019259 3300035725 Bacteria 3934
245 Ga0373947_0221217 3300035725 Bacteria 1244
246 Ga0373937_0000282 3300036401 Bacteria 48656
247 Ga0373937_0105716 3300036401 Bacteria 2616
248 Ga0373937_0109804 3300036401 Bacteria 2565
249 Ga0373925_0003559 3300037068 Bacteria 12005
250 Ga0373925_0195186 3300037068 Bacteria 1608
251 Ga0395899_0023110 3300037312 Bacteria 4711
252 Ga0395899_0189323 3300037312 Bacteria 1440
253 Ga0395900_0003439 3300037418 Bacteria 17122
254 Ga0395900_0053653 3300037418 Bacteria 4149
255 Ga0395898_0007003 3300037466 Bacteria 11982
256 Ga0395901_0001004 3300038443 Bacteria 30516
257 Ga0395901_0008299 3300038443 Bacteria 10496
258 Ga0395901_0056148 3300038443 Bacteria 4096
259 Ga0436365_0618909 3300039437 Bacteria 19642
260 Ga0436361_1150609 3300039447 Bacteria 3355
261 Ga0439441_000026 3300042001 Bacteria 11272
262 Ga0439441_011189 3300042001 Bacteria 1518
263 Ga0439443_010979 3300042003 Bacteria 1321
264 Ga0439448_0018509 3300042005 Bacteria 2136
265 Ga0439451_032575 3300042009 Bacteria 1048
266 Ga0450923_011112 3300042125 Bacteria 1613
267 Ga0439435_0000253 3300042436 Bacteria 7765
268 Ga0439435_0007028 3300042436 Bacteria 2558
269 Ga0439460_0003045 3300042461 Bacteria 4049
270 Ga0450893_0006182 3300042532 Bacteria 1933
271 Ga0451577_0116176 3300042876 Bacteria 2396
272 Ga0451577_0551266 3300042876 Bacteria 1047
273 Ga0466963_0142067 3300044694 Bacteria 1663
274 Ga0466957_0231099 3300044842 Bacteria 1224
275 Ga0451576_0007178 3300045051 Bacteria 13426
276 Ga0451576_0050695 3300045051 Bacteria 4352
277 Ga0466967_0003087 3300045976 Bacteria 10707
278 Ga0466967_0185642 3300045976 Bacteria 1963
279 Ga0495592_0025781 3300046454 Bacteria 4462
280 Ga0495603_0015811 3300046455 Bacteria 4562
281 Ga0495629_0101292 3300046459 Bacteria 2010
282 Ga0495580_0018600 3300046472 Bacteria 5171
283 Ga0495582_0015024 3300046473 Bacteria 4258
284 Ga0495639_0002419 3300046475 Bacteria 8156
285 Ga0495608_0001761 3300046511 Bacteria 15451
286 Ga0495618_0093560 3300046514 Bacteria 1922
287 Ga0495642_0027257 3300046528 Bacteria 2273
288 Ga0495665_0034947 3300046531 Bacteria 2687
289 Ga0495586_0045175 3300046535 Bacteria 2373
290 Ga0495587_0028064 3300046536 Bacteria 3427
291 Ga0495621_0138134 3300046539 Bacteria 952
292 Ga0495588_0021948 3300046674 Bacteria 3151
293 Ga0495647_0002172 3300046681 Bacteria 6131
294 Ga0495658_0004465 3300046683 Bacteria 6886
295 Ga0495658_0118600 3300046683 Bacteria 1598
296 Ga0495613_0027382 3300046689 Bacteria 4242
297 Ga0495624_0053660 3300046690 Bacteria 2544
298 Ga0495670_0155689 3300046691 Bacteria 1199
299 Ga0495604_0051744 3300047317 Bacteria 3182
300 Ga0495593_0065552 3300047673 Bacteria 1894
301 Ga0496100_0208241 3300048903 Bacteria 1429
302 Ga0496101_0148692 3300048904 Bacteria 1790
303 Ga0496112_0115875 3300048915 Bacteria 2650
304 Ga0501299_008346 3300049522 Bacteria 1683
305 Ga0501031_0020315 3300049568 Bacteria 4330
306 Ga0501033_0019386 3300049570 Bacteria 5143
307 Ga0501034_0001818 3300049571 Bacteria 27125
308 Ga0501034_0002618 3300049571 Bacteria 21346
309 Ga0501034_0066826 3300049571 Bacteria 3609
310 Ga0501036_0002503 3300049572 Bacteria 14414
311 Ga0501037_0158732 3300049573 Bacteria 1613
312 Ga0501038_0006655 3300049574 Bacteria 10683
313 Ga0501038_0143418 3300049574 Bacteria 1952
314 Ga0501038_0200020 3300049574 Bacteria 1604
315 Ga0501039_0086467 3300049575 Bacteria 2441
316 Ga0501039_0223711 3300049575 Bacteria 1479
317 Ga0501040_0002520 3300049576 Bacteria 11807
318 Ga0501040_0002573 3300049576 Bacteria 11701
319 Ga0501041_0000398 3300049577 Bacteria 21891
320 Ga0501041_0013193 3300049577 Bacteria 4896
321 Ga0501042_0015385 3300049578 Bacteria 5238
322 Ga0501042_0045347 3300049578 Bacteria 3133
323 Ga0501043_0125110 3300049579 Bacteria 2016
324 Ga0501046_0000393 3300049580 Bacteria 43715
325 Ga0501048_0000181 3300049582 Bacteria 39855
326 Ga0501068_0003002 3300049584 Bacteria 8994
327 Ga0501070_0104338 3300049586 Bacteria 2344
328 Ga0501070_0104650 3300049586 Bacteria 2340
329 Ga0501071_0028098 3300049587 Bacteria 3961
330 Ga0501071_0078700 3300049587 Bacteria 2410
331 Ga0501072_0015534 3300049588 Bacteria 5832
332 Ga0501072_0223974 3300049588 Bacteria 1499
333 Ga0501072_0300920 3300049588 Bacteria 1275
334 Ga0501073_0108445 3300049589 Bacteria 1927
335 Ga0501074_0017841 3300049590 Bacteria 5157
336 Ga0501075_0000242 3300049591 Bacteria 29265
337 Ga0501075_0004419 3300049591 Bacteria 9512
338 Ga0501076_0001073 3300049592 Bacteria 17968
339 Ga0501076_0003833 3300049592 Bacteria 10589
340 Ga0501077_0002349 3300049593 Bacteria 11401
341 Ga0501079_0004535 3300049741 Bacteria 10303
342 Ga0501079_0046143 3300049741 Bacteria 3361
343 Ga0501079_0113657 3300049741 Bacteria 2105
344 Ga0501080_0002206 3300049742 Bacteria 16926
345 Ga0501080_0057349 3300049742 Bacteria 3626
346 Ga0501081_0000938 3300049743 Bacteria 17301
347 Ga0501081_0015784 3300049743 Bacteria 4986
348 Ga0501035_0003028 3300049822 Bacteria 16113
349 Ga0501035_0230383 3300049822 Bacteria 1579
350 Ga0501044_0031931 3300049823 Bacteria 5537
351 Ga0501044_0165544 3300049823 Bacteria 2185
352 Ga0501044_0250746 3300049823 Bacteria 1711
353 Ga0501045_0001586 3300049824 Bacteria 15173
354 Ga0501045_0026376 3300049824 Bacteria 4179
355 Ga0501045_0128952 3300049824 Bacteria 1880
356 nmdc:mga03683_23978_c1 3300050489 Bacteria 2383
357 nmdc:mga03683_765_c1 3300050489 Bacteria 9217
358 nmdc:mga0yw44_27133_c1 3300050492 Bacteria 3277
359 nmdc:mga0k408_74468_c1 3300050493 Bacteria 1984
360 nmdc:mga06z11_171797_c1 3300050494 Bacteria 1245
361 nmdc:mga06z11_194842_c1 3300050494 Bacteria 1174
362 nmdc:mga06z11_57078_c1 3300050494 Bacteria 2021
363 nmdc:mga07m45_3409_c1 3300050496 Bacteria 7663
364 nmdc:mga05p37_222422_c1 3300050507 Bacteria 2278
365 nmdc:mga05p37_338950_c1 3300050507 Bacteria 1773
366 nmdc:mga05p37_34048_c1 3300050507 Bacteria 5117
367 nmdc:mga05p37_448377_c1 3300050507 Bacteria 1494
368 nmdc:mga05p37_495794_c1 3300050507 Bacteria 1403
369 nmdc:mga09592_13793_c1 3300050508 Bacteria 6602
370 nmdc:mga09592_18475_c1 3300050508 Bacteria 5718
371 nmdc:mga09592_207589_c1 3300050508 Bacteria 1697
372 nmdc:mga09592_2090_c1 3300050508 Bacteria 16115
373 nmdc:mga09592_250394_c1 3300050508 Bacteria 1535
374 nmdc:mga0qj67_118917_c1 3300050509 Bacteria 2137
375 nmdc:mga0qj67_12927_c1 3300050509 Bacteria 6299
376 nmdc:mga0qj67_2525_c1 3300050509 Bacteria 13071
377 nmdc:mga0qj67_572492_c1 3300050509 Bacteria 905
378 nmdc:mga06r32_10530_c1 3300050510 Bacteria 8338
379 nmdc:mga06r32_12452_c1 3300050510 Bacteria 7676
380 nmdc:mga06r32_148523_c1 3300050510 Bacteria 2321
381 nmdc:mga06r32_303378_c1 3300050510 Bacteria 1583
382 nmdc:mga06r32_66248_c1 3300050510 Bacteria 3485
383 nmdc:mga08y16_127106_c1 3300050511 Bacteria 2651
384 nmdc:mga08y16_19731_c1 3300050511 Bacteria 7108
385 nmdc:mga08y16_34320_c1 3300050511 Bacteria 5330
386 nmdc:mga08y16_46559_c1 3300050511 Bacteria 4541
387 nmdc:mga08y16_6508_c1 3300050511 Bacteria 12251
388 nmdc:mga08y16_83267_c1 3300050511 Bacteria 3334
389 nmdc:mga0n895_133643_c1 3300050512 Bacteria 2507
390 nmdc:mga0n895_511_c1 3300050512 Bacteria 26369
391 nmdc:mga0rr50_1254_c1 3300050513 Bacteria 13821
392 nmdc:mga0rr50_254461_c1 3300050513 Bacteria 1459
393 nmdc:mga08x19_5039_c1 3300050514 Bacteria 7816
394 nmdc:mga0a205_106_c1 3300050515 Bacteria 48183
395 nmdc:mga0sz30_77_c1 3300050516 Bacteria 37634
396 nmdc:mga0sz30_8760_c1 3300050516 Bacteria 3829
397 Ga0495619_0054458 3300053085 Bacteria 2648
398 Ga0500641_0000186 3300053096 Bacteria 23436
399 Ga0500568_0005346 3300053139 Bacteria 6654
400 Ga0500616_0001083 3300053153 Bacteria 28382
401 Ga0501084_0002815 3300054114 Bacteria 14041
402 Ga0501084_0088895 3300054114 Bacteria 2593
403 Ga0590071_014952 3300059421 Bacteria 1821
404 Ga0501082_0000358 3300060353 Bacteria 40322
405 Ga0501082_0016566 3300060353 Bacteria 6345
406 Ga0530510_0063685 3300061734 Bacteria 2669
407 nmdc:mga0yw44_142385_c1
408 Ga0065707_10008820
409 Ga0065707_10135065
410 Ga0070658_10005298
411 Ga0070658_10255320
412 Ga0070683_100052087
413 Ga0070690_100000841
414 Ga0068869_100001651
415 Ga0070666_10149100
416 Ga0070680_100001241
417 Ga0070680_100227103
418 Ga0070682_100011140
419 Ga0068868_100004039
420 Ga0070689_100097436
421 Ga0070689_100150351
422 Ga0070691_10022378
423 Ga0070687_100000713
424 Ga0070687_100079261
425 Ga0070692_10008183
426 Ga0070669_100226914
427 Ga0070675_100098135
428 Ga0070667_100064038
429 Ga0070714_100001717
430 Ga0070713_100108891
431 Ga0070710_10000615
432 Ga0070710_10073068
433 Ga0070701_10011337
434 Ga0070701_10073381
435 Ga0070711_100001965
436 Ga0070705_100180656
437 Ga0070700_100001890
438 Ga0070694_100011477
439 Ga0070694_100058806
440 Ga0070694_100083203
441 Ga0070681_10003085
442 Ga0068867_100000640
443 Ga0068867_100026035
444 Ga0070706_100082746
445 Ga0070707_100331883
446 Ga0070698_100004749
447 Ga0070699_100071116
448 Ga0070699_100137863
449 Ga0070679_100005398
450 Ga0070686_100197543
451 Ga0070695_100090317
452 Ga0070695_100284486
453 Ga0070696_100000527
454 Ga0070696_100002762
455 Ga0070693_100001459
456 Ga0070693_100013135
457 Ga0070665_100126997
458 Ga0070704_100002169
459 Ga0070704_100005292
460 Ga0068855_100291339
461 Ga0070664_100070708
462 Ga0068857_100112954
463 Ga0068854_100013384
464 Ga0068854_100119514
465 Ga0068856_100016600
466 Ga0068856_100049328
467 Ga0068856_100349116
468 Ga0070702_100005829
469 Ga0070702_100070951
470 Ga0068864_100128626
471 Ga0068866_10001344
472 Ga0068866_10130366
473 Ga0068861_100000456
474 Ga0068861_100038867
475 Ga0068863_100040665
476 Ga0068863_100335157
477 Ga0068862_100003371
478 Ga0081455_10000243
479 Ga0081455_10017097
480 Ga0081538_10008234
481 Ga0081538_10079656
482 Ga0081539_10001920
483 Ga0081539_10005219
484 Ga0075365_10136898
485 Ga0075365_10162055
486 Ga0070715_10012665
487 Ga0075362_10008147
488 Ga0075367_10119255
489 Ga0075369_10007173
490 Ga0097621_100005085
491 Ga0075370_10003641
492 Ga0075370_10056358
493 Ga0068871_100035054
494 Ga0075428_100002876
495 Ga0075428_100051805
496 Ga0075428_100084187
497 Ga0075428_100105661
498 Ga0075430_100007753
499 Ga0075430_100026081
500 Ga0075431_100000647
501 Ga0075431_100030839
502 Ga0075431_100190800
503 Ga0075431_100250997
504 Ga0075434_100000221
505 Ga0075434_100094831
506 Ga0075429_100009086
507 Ga0075429_100301597
508 Ga0068865_100002491
509 Ga0068865_100051202
510 Ga0068865_100089269
511 Ga0075436_100001742
512 Ga0075435_100000249
513 Ga0099794_10055086
514 Ga0111539_10004830
515 Ga0111539_10005703
516 Ga0111539_10060150
517 Ga0111539_10073836
518 Ga0111539_10273147
519 Ga0111539_10583581
520 Ga0105245_10026033
521 Ga0114129_10003165
522 Ga0114129_10324278
523 Ga0105243_10002569
524 Ga0105243_10032653
525 Ga0105242_10005337
526 Ga0105242_10211746
527 Ga0105242_10300932
528 Ga0105249_10008025
529 Ga0105249_10017573
530 Ga0105249_10033380
531 Ga0105239_10182689
532 Ga0157378_10017676
533 Ga0163162_10023311
534 Ga0163162_10442379
535 Ga0157372_10412071
536 Ga0163163_10386565
537 Ga0157376_10016340
538 Ga0213872_10020935
539 Ga0213876_10010605
540 Ga0207697_10074392
541 Ga0207653_10059513
542 Ga0207692_10000073
543 Ga0207680_10240052
544 Ga0207647_10129736
545 Ga0207685_10001201
546 Ga0207699_10001951
547 Ga0207645_10094013
548 Ga0207645_10204497
549 Ga0207643_10033050
550 Ga0207643_10078169
551 Ga0207684_10127087
552 Ga0207707_10020057
553 Ga0207695_10038583
554 Ga0207671_10421418
555 Ga0207693_10041377
556 Ga0207663_10022203
557 Ga0207660_10019929
558 Ga0207662_10000953
559 Ga0207662_10058161
560 Ga0207657_10255520
561 Ga0207649_10021559
562 Ga0207652_10005518
563 Ga0207681_10231578
564 Ga0207694_10036678
565 Ga0207659_10018191
566 Ga0207687_10020099
567 Ga0207700_10002308
568 Ga0207700_10077086
569 Ga0207664_10002203
570 Ga0207686_10188026
571 Ga0207709_10014755
572 Ga0207709_10015973
573 Ga0207670_10015089
574 Ga0207670_10015283
575 Ga0207670_10149157
576 Ga0207704_10004892
577 Ga0207704_10086660
578 Ga0207691_10202574
579 Ga0207689_10060040
580 Ga0207689_10071265
581 Ga0207689_10242636
582 Ga0207679_10500239
583 Ga0207667_10009161
584 Ga0207667_10066083
585 Ga0207712_10004759
586 Ga0207712_10119674
587 Ga0207712_10332600
588 Ga0207668_10015913
589 Ga0207640_10004854
590 Ga0207640_10061970
591 Ga0207658_10179743
592 Ga0207677_10129799
593 Ga0207708_10004694
594 Ga0207708_10007120
595 Ga0207708_10046266
596 Ga0207702_10028548
597 Ga0207702_10276204
598 Ga0207641_10289853
599 Ga0207641_10307180
600 Ga0207648_10000238
601 Ga0207648_10007300
602 Ga0207648_10040208
603 Ga0207675_100001083
604 Ga0207675_100007203
605 Ga0207675_100040231
606 Ga0207675_100256900
607 Ga0207675_100518982
608 Ga0207683_10157179
609 Ga0209981_1003934
610 Ga0209995_1013364
611 Ga0209971_1010152
612 Ga0209974_10038533
613 Ga0207428_10020619
614 Ga0207428_10021886
615 Ga0207428_10265079
616 Ga0268266_10011364
617 Ga0268265_10001655
618 Ga0268264_10572153
619 Ga0265334_10049885
620 Ga0265340_10074745
621 Ga0265316_10071045
622 Ga0307416_100431962
623 Ga0307411_10202837
624 Ga0373950_0009117
625 Ga0373938_0010026
626 Ga0373926_0000727
627 Ga0373926_0017944
628 Ga0373940_0004706
629 Ga0373944_0036683
630 Ga0373952_0001215
631 Ga0373932_0001922
632 Ga0373936_0012624
633 Ga0373939_0043573
634 Ga0373941_0010886
635 Ga0373945_0012991
636 Ga0373954_0000071
637 Ga0373960_0008016
638 Ga0373943_0002563
639 Ga0373946_0005223
640 Ga0373942_0003706
641 Ga0373961_0022581
642 Ga0373961_0040012
643 Ga0373931_0010151
644 Ga0373931_0160964
645 Ga0373935_0022922
646 Ga0373935_0093840
647 Ga0373927_0022719
648 Ga0373927_0048238
649 Ga0373933_0006966
650 Ga0373947_0019259
651 Ga0373947_0221217
652 Ga0373937_0000282
653 Ga0373937_0105716
654 Ga0373937_0109804
655 Ga0373925_0003559
656 Ga0373925_0195186
657 Ga0395899_0023110
658 Ga0395899_0189323
659 Ga0395900_0003439
660 Ga0395900_0053653
661 Ga0395898_0007003
662 Ga0395901_0001004
663 Ga0395901_0008299
664 Ga0395901_0056148
665 Ga0436365_0618909
666 Ga0436361_1150609
667 Ga0439441_000026
668 Ga0439441_011189
669 Ga0439443_010979
670 Ga0439448_0018509
671 Ga0439451_032575
672 Ga0450923_011112
673 Ga0439435_0000253
674 Ga0439435_0007028
675 Ga0439460_0003045
676 Ga0450893_0006182
677 Ga0451577_0116176
678 Ga0451577_0551266
679 Ga0466963_0142067
680 Ga0466957_0231099
681 Ga0451576_0007178
682 Ga0451576_0050695
683 Ga0466967_0003087
684 Ga0466967_0185642
685 Ga0495592_0025781
686 Ga0495603_0015811
687 Ga0495629_0101292
688 Ga0495580_0018600
689 Ga0495582_0015024
690 Ga0495639_0002419
691 Ga0495608_0001761
692 Ga0495618_0093560
693 Ga0495642_0027257
694 Ga0495665_0034947
695 Ga0495586_0045175
696 Ga0495587_0028064
697 Ga0495621_0138134
698 Ga0495588_0021948
699 Ga0495647_0002172
700 Ga0495658_0004465
701 Ga0495658_0118600
702 Ga0495613_0027382
703 Ga0495624_0053660
704 Ga0495670_0155689
705 Ga0495604_0051744
706 Ga0495593_0065552
707 Ga0496100_0208241
708 Ga0496101_0148692
709 Ga0496112_0115875
710 Ga0501299_008346
711 Ga0501031_0020315
712 Ga0501033_0019386
713 Ga0501034_0001818
714 Ga0501034_0002618
715 Ga0501034_0066826
716 Ga0501036_0002503
717 Ga0501037_0158732
718 Ga0501038_0006655
719 Ga0501038_0143418
720 Ga0501038_0200020
721 Ga0501039_0086467
722 Ga0501039_0223711
723 Ga0501040_0002520
724 Ga0501040_0002573
725 Ga0501041_0000398
726 Ga0501041_0013193
727 Ga0501042_0015385
728 Ga0501042_0045347
729 Ga0501043_0125110
730 Ga0501046_0000393
731 Ga0501048_0000181
732 Ga0501068_0003002
733 Ga0501070_0104338
734 Ga0501070_0104650
735 Ga0501071_0028098
736 Ga0501071_0078700
737 Ga0501072_0015534
738 Ga0501072_0223974
739 Ga0501072_0300920
740 Ga0501073_0108445
741 Ga0501074_0017841
742 Ga0501075_0000242
743 Ga0501075_0004419
744 Ga0501076_0001073
745 Ga0501076_0003833
746 Ga0501077_0002349
747 Ga0501079_0004535
748 Ga0501079_0046143
749 Ga0501079_0113657
750 Ga0501080_0002206
751 Ga0501080_0057349
752 Ga0501081_0000938
753 Ga0501081_0015784
754 Ga0501035_0003028
755 Ga0501035_0230383
756 Ga0501044_0031931
757 Ga0501044_0165544
758 Ga0501044_0250746
759 Ga0501045_0001586
760 Ga0501045_0026376
761 Ga0501045_0128952
762 nmdc:mga03683_23978_c1
763 nmdc:mga03683_765_c1
764 nmdc:mga0yw44_27133_c1
765 nmdc:mga0k408_74468_c1
766 nmdc:mga06z11_171797_c1
767 nmdc:mga06z11_194842_c1
768 nmdc:mga06z11_57078_c1
769 nmdc:mga07m45_3409_c1
770 nmdc:mga05p37_222422_c1
771 nmdc:mga05p37_338950_c1
772 nmdc:mga05p37_34048_c1
773 nmdc:mga05p37_448377_c1
774 nmdc:mga05p37_495794_c1
775 nmdc:mga09592_13793_c1
776 nmdc:mga09592_18475_c1
777 nmdc:mga09592_207589_c1
778 nmdc:mga09592_2090_c1
779 nmdc:mga09592_250394_c1
780 nmdc:mga0qj67_118917_c1
781 nmdc:mga0qj67_12927_c1
782 nmdc:mga0qj67_2525_c1
783 nmdc:mga0qj67_572492_c1
784 nmdc:mga06r32_10530_c1
785 nmdc:mga06r32_12452_c1
786 nmdc:mga06r32_148523_c1
787 nmdc:mga06r32_303378_c1
788 nmdc:mga06r32_66248_c1
789 nmdc:mga08y16_127106_c1
790 nmdc:mga08y16_19731_c1
791 nmdc:mga08y16_34320_c1
792 nmdc:mga08y16_46559_c1
793 nmdc:mga08y16_6508_c1
794 nmdc:mga08y16_83267_c1
795 nmdc:mga0n895_133643_c1
796 nmdc:mga0n895_511_c1
797 nmdc:mga0rr50_1254_c1
798 nmdc:mga0rr50_254461_c1
799 nmdc:mga08x19_5039_c1
800 nmdc:mga0a205_106_c1
801 nmdc:mga0sz30_77_c1
802 nmdc:mga0sz30_8760_c1
803 Ga0495619_0054458
804 Ga0500641_0000186
805 Ga0500568_0005346
806 Ga0500616_0001083
807 Ga0501084_0002815
808 Ga0501084_0088895
809 Ga0590071_014952
810 Ga0501082_0000358
811 Ga0501082_0016566
812 Ga0530510_0063685

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

28

321

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9365 1 310
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9288 1 309
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.9279 2 309
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9179 3 304
3n2t-assembly1.cif.gz_A structure of the glycerol dehydrogenase akr11b4 from gluconobacter oxydans 0.9172 3 307
ID Description Score Start End Superfamily
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9752 1 320 3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9463 68 320 3.20.20.100
af_P49249_9_269_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9432 2 255 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.942 1 214 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9418 2 309 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A521YKN2-F1-model_v4 Aldo/keto reductase 0.9789 1 328 GO:0004033
GO:0005737
AF-A0A4Y9N7P7-F1-model_v4 Aldo/keto reductase 0.9776 2 318 GO:0004033
GO:0005737
AF-A0A521YKN2-F1-model_v4 Aldo/keto reductase 0.9759 1 328 GO:0004033
GO:0005737
AF-A0A7C8ZCS5-F1-model_v4 Pyridoxine 4-dehydrogenase (EC 1.1.1.65) 0.9701 61 161 GO:0005737
GO:0050236
AF-A0A849IN34-F1-model_v4 Aldo/keto reductase 0.9699 23 204 GO:0004033
GO:0005737

Map