F436341

General Info

Members Datasets Scaffolds Average Seq Length
406 213 812 149

Family's Representative Sequence

Representative Sequence 3300055283|Ga0500661_046302|Ga0500661_046302_128_670
Length 180
Sequence MREKQQYNGAATVAVFFYLSREKIVAPNSGVKSTSGFNAALRRKARHYAMQALYQWQISHNALRDIENQFRSEYDFTQVDLEFFQELLHQVPAQLGTLEETFSPYLDRPLKDLTPIELSLLRMGTYELANRIDVPFKVVINESVSLAKKFGAAESHKYINGVLDNVAKQLRGVEIAAEKR

Samples

Sample ID Description Type Environment
1 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
137 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
149 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
163 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
166 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
170 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
173 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
176 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
177 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
178 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
179 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
180 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
181 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
182 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
183 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
202 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
208 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
209 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
210 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
211 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
212 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
213 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.99
Nodule 0.49
Rhizoplane 2.46
Rhizosphere 92.12
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500661_046302 3300055283 Bacteria 773
2 JGI24745J21846_1029860 3300002073 Bacteria 656
3 rootH2_10303568 3300003320 Bacteria 3294
4 rootH1_10001451 3300003323 Bacteria 19518
5 rootH1_10025242 3300003323 Bacteria 17315
6 Ga0065715_10531600 3300005293 Bacteria 755
7 Ga0070658_10912298 3300005327 Bacteria 764
8 Ga0070676_10003255 3300005328 Bacteria 8430
9 Ga0070676_10027589 3300005328 Bacteria 3221
10 Ga0070676_10171819 3300005328 Bacteria 1403
11 Ga0070690_100066757 3300005330 Bacteria 2329
12 Ga0070670_100001861 3300005331 Bacteria 17194
13 Ga0070670_100733218 3300005331 Bacteria 890
14 Ga0068869_100000108 3300005334 Bacteria 39249
15 Ga0068869_100488478 3300005334 Bacteria 1026
16 Ga0070666_10064193 3300005335 Bacteria 2490
17 Ga0070666_10267564 3300005335 Bacteria 1213
18 Ga0070666_10326417 3300005335 Bacteria 1095
19 Ga0070666_10465956 3300005335 Bacteria 914
20 Ga0070682_100942328 3300005337 Bacteria 712
21 Ga0070682_101361434 3300005337 Bacteria 605
22 Ga0068868_100077515 3300005338 Bacteria 2659
23 Ga0068868_100330914 3300005338 Bacteria 1300
24 Ga0068868_101472790 3300005338 Bacteria 637
25 Ga0070660_100005400 3300005339 Bacteria 8847
26 Ga0070660_100096411 3300005339 Bacteria 2339
27 Ga0070689_100759530 3300005340 Bacteria 850
28 Ga0070687_100039944 3300005343 Bacteria 2361
29 Ga0070661_100001790 3300005344 Bacteria 14900
30 Ga0070661_100056801 3300005344 Bacteria 2868
31 Ga0070668_100012924 3300005347 Bacteria 6218
32 Ga0070669_100002544 3300005353 Bacteria 13184
33 Ga0070669_100241247 3300005353 Bacteria 1436
34 Ga0070669_100249411 3300005353 Bacteria 1413
35 Ga0070675_100182286 3300005354 Bacteria 1816
36 Ga0070675_100770247 3300005354 Bacteria 879
37 Ga0070671_100000025 3300005355 Bacteria 121912
38 Ga0070671_100000582 3300005355 Bacteria 25999
39 Ga0070671_100108840 3300005355 Bacteria 2327
40 Ga0070671_100313538 3300005355 Bacteria 1336
41 Ga0070674_100038687 3300005356 Bacteria 3217
42 Ga0070674_100289869 3300005356 Bacteria 1301
43 Ga0070674_100292402 3300005356 Bacteria 1296
44 Ga0070673_100002656 3300005364 Bacteria 10942
45 Ga0070673_100033668 3300005364 Bacteria 3872
46 Ga0070673_100552846 3300005364 Bacteria 1046
47 Ga0070659_100001088 3300005366 Bacteria 19812
48 Ga0070667_100000095 3300005367 Bacteria 109595
49 Ga0070667_100003815 3300005367 Bacteria 12806
50 Ga0070667_100020231 3300005367 Bacteria 5525
51 Ga0070667_100076944 3300005367 Bacteria 2849
52 Ga0070667_100542432 3300005367 Bacteria 1068
53 Ga0070667_101788584 3300005367 Bacteria 578
54 Ga0070703_10135093 3300005406 Bacteria 910
55 Ga0070709_10590261 3300005434 Bacteria 854
56 Ga0070663_100020141 3300005455 Bacteria 4413
57 Ga0070663_100045794 3300005455 Bacteria 3092
58 Ga0070663_100147587 3300005455 Bacteria 1801
59 Ga0070663_100312807 3300005455 Bacteria 1261
60 Ga0070678_100161469 3300005456 Bacteria 1816
61 Ga0070678_100456748 3300005456 Bacteria 1120
62 Ga0070678_100644690 3300005456 Bacteria 949
63 Ga0070662_100000134 3300005457 Bacteria 41711
64 Ga0070662_100389002 3300005457 Bacteria 1149
65 Ga0070662_100406587 3300005457 Bacteria 1124
66 Ga0070662_100588545 3300005457 Bacteria 935
67 Ga0068867_100006428 3300005459 Bacteria 8298
68 Ga0068867_100478434 3300005459 Bacteria 1066
69 Ga0070685_10000005 3300005466 Bacteria 190119
70 Ga0070679_100548302 3300005530 Bacteria 1100
71 Ga0068853_100000458 3300005539 Bacteria 27839
72 Ga0070672_100029477 3300005543 Bacteria 4116
73 Ga0070672_100148790 3300005543 Bacteria 1936
74 Ga0070672_100261819 3300005543 Bacteria 1459
75 Ga0070695_100074482 3300005545 Bacteria 2231
76 Ga0070693_100950793 3300005547 Bacteria 647
77 Ga0070665_100002661 3300005548 Bacteria 19422
78 Ga0070665_100003568 3300005548 Bacteria 16494
79 Ga0070665_100737748 3300005548 Bacteria 998
80 Ga0070704_100685936 3300005549 Bacteria 907
81 Ga0068855_100001419 3300005563 Bacteria 29756
82 Ga0068855_100002481 3300005563 Bacteria 22756
83 Ga0068855_100126098 3300005563 Bacteria 2927
84 Ga0070664_100100214 3300005564 Bacteria 2518
85 Ga0070664_100284539 3300005564 Bacteria 1491
86 Ga0070664_100391043 3300005564 Bacteria 1271
87 Ga0068857_100015058 3300005577 Bacteria 6750
88 Ga0068857_101119150 3300005577 Bacteria 761
89 Ga0068857_101434926 3300005577 Bacteria 672
90 Ga0068854_100114115 3300005578 Bacteria 2042
91 Ga0068854_100279425 3300005578 Bacteria 1344
92 Ga0068854_100516605 3300005578 Bacteria 1008
93 Ga0068856_100000265 3300005614 Bacteria 56919
94 Ga0068856_100048345 3300005614 Bacteria 4191
95 Ga0070702_100736703 3300005615 Bacteria 755
96 Ga0070702_100836032 3300005615 Bacteria 715
97 Ga0068852_100043384 3300005616 Bacteria 3815
98 Ga0068852_100050497 3300005616 Bacteria 3564
99 Ga0068859_100000217 3300005617 Bacteria 56968
100 Ga0068859_100006607 3300005617 Bacteria 11775
101 Ga0068864_100000073 3300005618 Bacteria 109681
102 Ga0068864_100001680 3300005618 Bacteria 18191
103 Ga0068864_100039293 3300005618 Bacteria 4044
104 Ga0068864_101669508 3300005618 Bacteria 642
105 Ga0068861_100004666 3300005719 Bacteria 9207
106 Ga0068861_100093225 3300005719 Bacteria 2381
107 Ga0068851_10015435 3300005834 Bacteria 3639
108 Ga0068851_10621126 3300005834 Bacteria 659
109 Ga0068870_10005304 3300005840 Bacteria 5619
110 Ga0068863_100003558 3300005841 Bacteria 15371
111 Ga0068863_100084046 3300005841 Bacteria 3017
112 Ga0068863_100528474 3300005841 Bacteria 1163
113 Ga0068858_100030245 3300005842 Bacteria 5029
114 Ga0068858_100213453 3300005842 Bacteria 1826
115 Ga0068860_100000326 3300005843 Bacteria 64692
116 Ga0068860_100006779 3300005843 Bacteria 11481
117 Ga0068860_101836976 3300005843 Bacteria 628
118 Ga0068862_100002886 3300005844 Bacteria 15044
119 Ga0068862_100026056 3300005844 Bacteria 4914
120 Ga0068862_101401844 3300005844 Bacteria 702
121 Ga0068871_101056690 3300006358 Bacteria 758
122 Ga0075428_100853361 3300006844 Bacteria 967
123 Ga0075434_100292389 3300006871 Bacteria 1649
124 Ga0075429_100294484 3300006880 Bacteria 1421
125 Ga0068865_100298701 3300006881 Bacteria 1288
126 Ga0097620_100000217 3300006931 Bacteria 56968
127 Ga0097620_100006607 3300006931 Bacteria 11775
128 Ga0097620_100311047 3300006931 Bacteria 1669
129 Ga0099826_10111354 3300006948 Bacteria 1631
130 Ga0075435_100250427 3300007076 Bacteria 1508
131 Ga0105240_10299047 3300009093 Bacteria 1841
132 Ga0105247_10028802 3300009101 Bacteria 3361
133 Ga0105243_10218135 3300009148 Bacteria 1684
134 Ga0105248_10032070 3300009177 Bacteria 5871
135 Ga0105248_10160606 3300009177 Bacteria 2535
136 Ga0105237_10168355 3300009545 Bacteria 2191
137 Ga0105237_10692743 3300009545 Bacteria 1025
138 Ga0105249_10025967 3300009553 Bacteria 5275
139 Ga0105249_10077855 3300009553 Bacteria 3076
140 Ga0105249_10170703 3300009553 Bacteria 2109
141 Ga0105249_10282214 3300009553 Bacteria 1659
142 Ga0105249_10586229 3300009553 Bacteria 1168
143 Ga0105239_10279941 3300010375 Bacteria 1878
144 Ga0105246_11443008 3300011119 Bacteria 644
145 Ga0157373_10000321 3300013100 Bacteria 38735
146 Ga0157371_10000470 3300013102 Bacteria 49205
147 Ga0157371_10273615 3300013102 Bacteria 1219
148 Ga0157369_10147643 3300013105 Bacteria 2486
149 Ga0157374_11407578 3300013296 Bacteria 720
150 Ga0163162_10030012 3300013306 Bacteria 5384
151 Ga0163162_10077697 3300013306 Bacteria 3384
152 Ga0157372_10002397 3300013307 Bacteria 20296
153 Ga0157372_10576586 3300013307 Bacteria 1311
154 Ga0157375_10024696 3300013308 Bacteria 5568
155 Ga0157375_11026341 3300013308 Bacteria 963
156 Ga0163163_10000230 3300014325 Bacteria 57639
157 Ga0157380_10185578 3300014326 Bacteria 1831
158 Ga0157377_10994578 3300014745 Bacteria 635
159 Ga0157379_10044181 3300014968 Bacteria 3977
160 Ga0157379_10501261 3300014968 Bacteria 1125
161 Ga0157376_10250795 3300014969 Bacteria 1653
162 Ga0157376_10652847 3300014969 Bacteria 1053
163 Ga0163161_10131233 3300017792 Bacteria 1890
164 Ga0213876_10451564 3300021384 Bacteria 684
165 Ga0207697_10167008 3300025315 Bacteria 961
166 Ga0207656_10012668 3300025321 Bacteria 3210
167 Ga0207653_10216066 3300025885 Bacteria 727
168 Ga0207682_10121292 3300025893 Bacteria 1160
169 Ga0207682_10132702 3300025893 Bacteria 1113
170 Ga0207642_10280723 3300025899 Bacteria 958
171 Ga0207642_10281908 3300025899 Bacteria 956
172 Ga0207710_10040533 3300025900 Bacteria 2064
173 Ga0207688_10032849 3300025901 Bacteria 2868
174 Ga0207688_10464825 3300025901 Bacteria 790
175 Ga0207688_10490315 3300025901 Bacteria 769
176 Ga0207680_10038805 3300025903 Bacteria 2759
177 Ga0207680_10158146 3300025903 Bacteria 1517
178 Ga0207680_10356208 3300025903 Bacteria 1028
179 Ga0207680_10548991 3300025903 Bacteria 825
180 Ga0207680_10591565 3300025903 Bacteria 793
181 Ga0207699_10423002 3300025906 Bacteria 952
182 Ga0207645_10007023 3300025907 Bacteria 8017
183 Ga0207645_10036113 3300025907 Bacteria 3173
184 Ga0207643_10009039 3300025908 Bacteria 5350
185 Ga0207671_10355407 3300025914 Bacteria 1162
186 Ga0207662_10273032 3300025918 Bacteria 1116
187 Ga0207657_10008703 3300025919 Bacteria 10274
188 Ga0207657_10082465 3300025919 Bacteria 2699
189 Ga0207649_10130943 3300025920 Bacteria 1703
190 Ga0207652_10123760 3300025921 Bacteria 2303
191 Ga0207681_10000156 3300025923 Bacteria 56382
192 Ga0207681_10013098 3300025923 Bacteria 5127
193 Ga0207681_10200969 3300025923 Bacteria 1530
194 Ga0207681_10239049 3300025923 Bacteria 1413
195 Ga0207650_10000106 3300025925 Bacteria 110058
196 Ga0207650_10003583 3300025925 Bacteria 10654
197 Ga0207650_10658782 3300025925 Bacteria 883
198 Ga0207650_10679100 3300025925 Bacteria 869
199 Ga0207659_10021820 3300025926 Bacteria 4258
200 Ga0207687_10140861 3300025927 Bacteria 1829
201 Ga0207644_10000049 3300025931 Bacteria 95260
202 Ga0207644_10003130 3300025931 Bacteria 10655
203 Ga0207644_10250135 3300025931 Bacteria 1414
204 Ga0207690_10000395 3300025932 Bacteria 28806
205 Ga0207706_10000002 3300025933 Bacteria 360309
206 Ga0207706_10142290 3300025933 Bacteria 2110
207 Ga0207706_10222933 3300025933 Bacteria 1651
208 Ga0207686_10486652 3300025934 Bacteria 955
209 Ga0207670_10173467 3300025936 Bacteria 1619
210 Ga0207669_10005777 3300025937 Bacteria 5588
211 Ga0207669_10051451 3300025937 Bacteria 2468
212 Ga0207669_10275576 3300025937 Bacteria 1266
213 Ga0207704_10170566 3300025938 Bacteria 1560
214 Ga0207704_10682079 3300025938 Bacteria 849
215 Ga0207691_10039009 3300025940 Bacteria 4395
216 Ga0207691_10077169 3300025940 Bacteria 3002
217 Ga0207691_10116273 3300025940 Bacteria 2374
218 Ga0207691_10268973 3300025940 Bacteria 1468
219 Ga0207691_10400183 3300025940 Bacteria 1171
220 Ga0207711_10001196 3300025941 Bacteria 24599
221 Ga0207711_10016430 3300025941 Bacteria 6151
222 Ga0207689_10000030 3300025942 Bacteria 97584
223 Ga0207689_10744547 3300025942 Bacteria 827
224 Ga0207679_10001203 3300025945 Bacteria 16448
225 Ga0207679_10046161 3300025945 Bacteria 3156
226 Ga0207679_10491869 3300025945 Bacteria 1093
227 Ga0207667_10002085 3300025949 Bacteria 25050
228 Ga0207667_10002263 3300025949 Bacteria 24190
229 Ga0207667_10113627 3300025949 Bacteria 2792
230 Ga0207667_10366496 3300025949 Bacteria 1469
231 Ga0207651_10000744 3300025960 Bacteria 13955
232 Ga0207651_10014965 3300025960 Bacteria 4494
233 Ga0207651_10542833 3300025960 Bacteria 1010
234 Ga0207712_10010093 3300025961 Bacteria 5988
235 Ga0207712_10052270 3300025961 Bacteria 2861
236 Ga0207712_10118546 3300025961 Bacteria 1998
237 Ga0207712_10205056 3300025961 Bacteria 1566
238 Ga0207712_10418266 3300025961 Bacteria 1130
239 Ga0207668_10014281 3300025972 Bacteria 4914
240 Ga0207668_10225941 3300025972 Bacteria 1506
241 Ga0207668_10338942 3300025972 Bacteria 1253
242 Ga0207668_10398488 3300025972 Bacteria 1163
243 Ga0207640_10010032 3300025981 Bacteria 5321
244 Ga0207640_10126682 3300025981 Bacteria 1839
245 Ga0207658_10000073 3300025986 Bacteria 111738
246 Ga0207658_10067229 3300025986 Bacteria 2699
247 Ga0207658_10184701 3300025986 Bacteria 1728
248 Ga0207658_10291982 3300025986 Bacteria 1401
249 Ga0207658_10376451 3300025986 Bacteria 1242
250 Ga0207677_10061755 3300026023 Bacteria 2596
251 Ga0207677_10707715 3300026023 Bacteria 894
252 Ga0207677_11217889 3300026023 Bacteria 689
253 Ga0207703_10002181 3300026035 Bacteria 17180
254 Ga0207703_10080975 3300026035 Bacteria 2705
255 Ga0207703_10441012 3300026035 Bacteria 1215
256 Ga0207639_10001640 3300026041 Bacteria 15075
257 Ga0207678_10003781 3300026067 Bacteria 13610
258 Ga0207678_10213759 3300026067 Bacteria 1650
259 Ga0207678_10354007 3300026067 Bacteria 1266
260 Ga0207678_10452064 3300026067 Bacteria 1117
261 Ga0207708_11400925 3300026075 Bacteria 613
262 Ga0207702_10000810 3300026078 Bacteria 33176
263 Ga0207702_10022175 3300026078 Bacteria 5263
264 Ga0207641_10007204 3300026088 Bacteria 9272
265 Ga0207641_10022040 3300026088 Bacteria 5238
266 Ga0207641_10206717 3300026088 Bacteria 1813
267 Ga0207641_10242640 3300026088 Unclassified 1679
268 Ga0207648_10011609 3300026089 Bacteria 8294
269 Ga0207648_10029102 3300026089 Bacteria 4898
270 Ga0207648_10130265 3300026089 Bacteria 2214
271 Ga0207676_10000010 3300026095 Bacteria 519402
272 Ga0207676_10304745 3300026095 Bacteria 1456
273 Ga0207674_10264169 3300026116 Bacteria 1668
274 Ga0207674_11304059 3300026116 Bacteria 695
275 Ga0207675_100000852 3300026118 Bacteria 30393
276 Ga0207675_100104516 3300026118 Bacteria 2669
277 Ga0207675_100433709 3300026118 Bacteria 1300
278 Ga0207683_10038714 3300026121 Bacteria 4158
279 Ga0207683_10049980 3300026121 Bacteria 3661
280 Ga0207683_10252029 3300026121 Bacteria 1611
281 Ga0207683_10455426 3300026121 Bacteria 1180
282 Ga0207698_10042011 3300026142 Bacteria 3412
283 Ga0207698_10572340 3300026142 Bacteria 1110
284 Ga0209281_1018539 3300027111 Bacteria 1389
285 Ga0209983_1005806 3300027665 Bacteria 2549
286 Ga0209974_10021246 3300027876 Bacteria 2149
287 Ga0207428_10356015 3300027907 Bacteria 1076
288 Ga0268266_10022816 3300028379 Bacteria 5327
289 Ga0268266_11166705 3300028379 Bacteria 745
290 Ga0268266_11745085 3300028379 Bacteria 597
291 Ga0268265_10003355 3300028380 Bacteria 11563
292 Ga0268265_10042309 3300028380 Bacteria 3379
293 Ga0268265_10187093 3300028380 Bacteria 1785
294 Ga0268264_10000123 3300028381 Bacteria 189361
295 Ga0268264_10025783 3300028381 Bacteria 4801
296 Ga0268264_10237766 3300028381 Bacteria 1686
297 Ga0268264_11289102 3300028381 Bacteria 741
298 Ga0265332_10327927 3300031238 Bacteria 632
299 Ga0265331_10169709 3300031250 Unclassified 987
300 Ga0265327_10000094 3300031251 Bacteria 195099
301 Ga0307513_10558015 3300031456 Bacteria 857
302 Ga0307408_100000192 3300031548 Bacteria 65993
303 Ga0307408_100015800 3300031548 Bacteria 5030
304 Ga0316579_10249930 3300031691 Bacteria 858
305 Ga0316576_10215957 3300031727 Bacteria 1443
306 Ga0316576_10524532 3300031727 Bacteria 870
307 Ga0316576_10595747 3300031727 Bacteria 807
308 Ga0316576_10755572 3300031727 Bacteria 702
309 Ga0307405_10002481 3300031731 Bacteria 8146
310 Ga0307405_10768660 3300031731 Bacteria 804
311 Ga0316577_10331073 3300031733 Bacteria 864
312 Ga0307413_10005033 3300031824 Bacteria 5837
313 Ga0307413_10069433 3300031824 Bacteria 2211
314 Ga0307413_10095738 3300031824 Bacteria 1947
315 Ga0307410_10007305 3300031852 Bacteria 6037
316 Ga0307410_10136031 3300031852 Bacteria 1812
317 Ga0307406_10001571 3300031901 Bacteria 12584
318 Ga0307406_10017922 3300031901 Bacteria 4131
319 Ga0307406_10088287 3300031901 Bacteria 2080
320 Ga0307407_10000698 3300031903 Bacteria 10903
321 Ga0307407_10191206 3300031903 Bacteria 1364
322 Ga0307407_11205757 3300031903 Bacteria 591
323 Ga0307412_10021547 3300031911 Bacteria 3938
324 Ga0307409_100005474 3300031995 Bacteria 7317
325 Ga0307409_100019629 3300031995 Bacteria 4583
326 Ga0307409_100159059 3300031995 Bacteria 1973
327 Ga0307409_100184609 3300031995 Bacteria 1850
328 Ga0307416_100013567 3300032002 Bacteria 5545
329 Ga0307416_100232235 3300032002 Bacteria 1779
330 Ga0307416_102980361 3300032002 Bacteria 566
331 Ga0307414_10029227 3300032004 Bacteria 3585
332 Ga0307414_10080652 3300032004 Bacteria 2380
333 Ga0307411_10000867 3300032005 Bacteria 11397
334 Ga0307411_10648647 3300032005 Bacteria 914
335 Ga0307411_10715437 3300032005 Bacteria 874
336 Ga0307411_10720312 3300032005 Bacteria 871
337 Ga0307415_100009857 3300032126 Bacteria 5383
338 Ga0307415_100099231 3300032126 Bacteria 2131
339 Ga0316585_10266538 3300032137 Bacteria 568
340 Ga0316580_10096741 3300032139 Bacteria 904
341 Ga0316580_10105252 3300032139 Bacteria 864
342 Ga0373955_0681664 3300035172 Bacteria 631
343 Ga0373961_0212617 3300035241 Bacteria 686
344 Ga0316574_0065044 3300035398 Bacteria 2295
345 Ga0316574_0079477 3300035398 Bacteria 2080
346 Ga0316574_0302312 3300035398 Bacteria 1017
347 Ga0373931_0531206 3300035691 Bacteria 762
348 Ga0373937_0266350 3300036401 Bacteria 1617
349 Ga0316582_0072515 3300036647 Bacteria 2232
350 Ga0316582_0181438 3300036647 Bacteria 1432
351 Ga0316582_0412322 3300036647 Bacteria 931
352 Ga0316582_0418514 3300036647 Bacteria 923
353 Ga0316582_0660438 3300036647 Bacteria 719
354 Ga0316584_0016769 3300036712 Bacteria 5255
355 Ga0316584_0060045 3300036712 Bacteria 2847
356 Ga0316584_0075231 3300036712 Bacteria 2531
357 Ga0316584_0202763 3300036712 Bacteria 1463
358 Ga0395900_1001327 3300037418 Bacteria 756
359 Ga0316581_0002317 3300037588 Bacteria 4523
360 Ga0400483_028483 3300039062 Bacteria 154566
361 Ga0400483_029989 3300039062 Bacteria 58053
362 Ga0400483_077867 3300039062 Bacteria 2043
363 Ga0400483_151143 3300039062 Bacteria 268199
364 Ga0400483_242281 3300039062 Bacteria 55044
365 Ga0436365_0115737 3300039437 Bacteria 3142
366 Ga0451797_0799138 3300041453 Bacteria 1561
367 Ga0451802_1835745 3300041460 Bacteria 1063
368 Ga0451807_0832178 3300041486 Bacteria 2043
369 Ga0451833_0042069 3300041491 Bacteria 757
370 Ga0451851_0565157 3300041507 Bacteria 675
371 Ga0451843_1202550 3300041509 Bacteria 953
372 Ga0439432_133216 3300042006 Bacteria 733
373 Ga0450914_000785 3300042118 Bacteria 1703
374 Ga0439435_0189397 3300042436 Bacteria 674
375 Ga0451577_0111952 3300042876 Bacteria 2442
376 Ga0451577_0283774 3300042876 Bacteria 1500
377 Ga0453684_0373300 3300044712 Bacteria 1603
378 Ga0495630_0277749 3300046517 Bacteria 1280
379 Ga0495587_0562797 3300046536 Bacteria 629
380 Ga0495598_0116272 3300046537 Bacteria 902
381 Ga0495621_0027977 3300046539 Bacteria 1914
382 Ga0495668_0491986 3300046616 Bacteria 676
383 Ga0495634_0336190 3300046642 Bacteria 907
384 Ga0495680_0082739 3300047322 Bacteria 2422
385 Ga0495680_0121387 3300047322 Unclassified 1929
386 Ga0496101_0045751 3300048904 Bacteria 3136
387 Ga0496102_0001905 3300048905 Bacteria 17998
388 Ga0496103_0250998 3300048906 Bacteria 1138
389 Ga0496106_0000553 3300048909 Bacteria 26612
390 Ga0496107_0007756 3300048910 Bacteria 7416
391 Ga0496109_0595386 3300048912 Bacteria 1042
392 Ga0496113_0594655 3300048916 Bacteria 886
393 Ga0496124_0007877 3300048927 Bacteria 11222
394 Ga0496125_0050172 3300048928 Bacteria 3458
395 Ga0501290_006225 3300049513 Bacteria 1494
396 Ga0501034_0942433 3300049571 Bacteria 749
397 Ga0501275_000535 3300049772 Bacteria 4274
398 nmdc:mga0n895_173694_c1 3300050512 Bacteria 2186
399 nmdc:mga0rr50_323023_c1 3300050513 Bacteria 1294
400 Ga0500595_013196 3300053119 Bacteria 3169
401 Ga0500617_201809 3300053124 Bacteria 728
402 Ga0500588_0000119 3300053146 Bacteria 10440
403 2895499497 2895498888 Bacteria 5283788
404 2895512519 2895511927 Bacteria 6802080
405 2895522530 2895522137 Bacteria 3284416
406 2895525704 2895525241 Bacteria 3388457
407 Ga0500661_046302
408 JGI24745J21846_1029860
409 rootH2_10303568
410 rootH1_10001451
411 rootH1_10025242
412 Ga0065715_10531600
413 Ga0070658_10912298
414 Ga0070676_10003255
415 Ga0070676_10027589
416 Ga0070676_10171819
417 Ga0070690_100066757
418 Ga0070670_100001861
419 Ga0070670_100733218
420 Ga0068869_100000108
421 Ga0068869_100488478
422 Ga0070666_10064193
423 Ga0070666_10267564
424 Ga0070666_10326417
425 Ga0070666_10465956
426 Ga0070682_100942328
427 Ga0070682_101361434
428 Ga0068868_100077515
429 Ga0068868_100330914
430 Ga0068868_101472790
431 Ga0070660_100005400
432 Ga0070660_100096411
433 Ga0070689_100759530
434 Ga0070687_100039944
435 Ga0070661_100001790
436 Ga0070661_100056801
437 Ga0070668_100012924
438 Ga0070669_100002544
439 Ga0070669_100241247
440 Ga0070669_100249411
441 Ga0070675_100182286
442 Ga0070675_100770247
443 Ga0070671_100000025
444 Ga0070671_100000582
445 Ga0070671_100108840
446 Ga0070671_100313538
447 Ga0070674_100038687
448 Ga0070674_100289869
449 Ga0070674_100292402
450 Ga0070673_100002656
451 Ga0070673_100033668
452 Ga0070673_100552846
453 Ga0070659_100001088
454 Ga0070667_100000095
455 Ga0070667_100003815
456 Ga0070667_100020231
457 Ga0070667_100076944
458 Ga0070667_100542432
459 Ga0070667_101788584
460 Ga0070703_10135093
461 Ga0070709_10590261
462 Ga0070663_100020141
463 Ga0070663_100045794
464 Ga0070663_100147587
465 Ga0070663_100312807
466 Ga0070678_100161469
467 Ga0070678_100456748
468 Ga0070678_100644690
469 Ga0070662_100000134
470 Ga0070662_100389002
471 Ga0070662_100406587
472 Ga0070662_100588545
473 Ga0068867_100006428
474 Ga0068867_100478434
475 Ga0070685_10000005
476 Ga0070679_100548302
477 Ga0068853_100000458
478 Ga0070672_100029477
479 Ga0070672_100148790
480 Ga0070672_100261819
481 Ga0070695_100074482
482 Ga0070693_100950793
483 Ga0070665_100002661
484 Ga0070665_100003568
485 Ga0070665_100737748
486 Ga0070704_100685936
487 Ga0068855_100001419
488 Ga0068855_100002481
489 Ga0068855_100126098
490 Ga0070664_100100214
491 Ga0070664_100284539
492 Ga0070664_100391043
493 Ga0068857_100015058
494 Ga0068857_101119150
495 Ga0068857_101434926
496 Ga0068854_100114115
497 Ga0068854_100279425
498 Ga0068854_100516605
499 Ga0068856_100000265
500 Ga0068856_100048345
501 Ga0070702_100736703
502 Ga0070702_100836032
503 Ga0068852_100043384
504 Ga0068852_100050497
505 Ga0068859_100000217
506 Ga0068859_100006607
507 Ga0068864_100000073
508 Ga0068864_100001680
509 Ga0068864_100039293
510 Ga0068864_101669508
511 Ga0068861_100004666
512 Ga0068861_100093225
513 Ga0068851_10015435
514 Ga0068851_10621126
515 Ga0068870_10005304
516 Ga0068863_100003558
517 Ga0068863_100084046
518 Ga0068863_100528474
519 Ga0068858_100030245
520 Ga0068858_100213453
521 Ga0068860_100000326
522 Ga0068860_100006779
523 Ga0068860_101836976
524 Ga0068862_100002886
525 Ga0068862_100026056
526 Ga0068862_101401844
527 Ga0068871_101056690
528 Ga0075428_100853361
529 Ga0075434_100292389
530 Ga0075429_100294484
531 Ga0068865_100298701
532 Ga0097620_100000217
533 Ga0097620_100006607
534 Ga0097620_100311047
535 Ga0099826_10111354
536 Ga0075435_100250427
537 Ga0105240_10299047
538 Ga0105247_10028802
539 Ga0105243_10218135
540 Ga0105248_10032070
541 Ga0105248_10160606
542 Ga0105237_10168355
543 Ga0105237_10692743
544 Ga0105249_10025967
545 Ga0105249_10077855
546 Ga0105249_10170703
547 Ga0105249_10282214
548 Ga0105249_10586229
549 Ga0105239_10279941
550 Ga0105246_11443008
551 Ga0157373_10000321
552 Ga0157371_10000470
553 Ga0157371_10273615
554 Ga0157369_10147643
555 Ga0157374_11407578
556 Ga0163162_10030012
557 Ga0163162_10077697
558 Ga0157372_10002397
559 Ga0157372_10576586
560 Ga0157375_10024696
561 Ga0157375_11026341
562 Ga0163163_10000230
563 Ga0157380_10185578
564 Ga0157377_10994578
565 Ga0157379_10044181
566 Ga0157379_10501261
567 Ga0157376_10250795
568 Ga0157376_10652847
569 Ga0163161_10131233
570 Ga0213876_10451564
571 Ga0207697_10167008
572 Ga0207656_10012668
573 Ga0207653_10216066
574 Ga0207682_10121292
575 Ga0207682_10132702
576 Ga0207642_10280723
577 Ga0207642_10281908
578 Ga0207710_10040533
579 Ga0207688_10032849
580 Ga0207688_10464825
581 Ga0207688_10490315
582 Ga0207680_10038805
583 Ga0207680_10158146
584 Ga0207680_10356208
585 Ga0207680_10548991
586 Ga0207680_10591565
587 Ga0207699_10423002
588 Ga0207645_10007023
589 Ga0207645_10036113
590 Ga0207643_10009039
591 Ga0207671_10355407
592 Ga0207662_10273032
593 Ga0207657_10008703
594 Ga0207657_10082465
595 Ga0207649_10130943
596 Ga0207652_10123760
597 Ga0207681_10000156
598 Ga0207681_10013098
599 Ga0207681_10200969
600 Ga0207681_10239049
601 Ga0207650_10000106
602 Ga0207650_10003583
603 Ga0207650_10658782
604 Ga0207650_10679100
605 Ga0207659_10021820
606 Ga0207687_10140861
607 Ga0207644_10000049
608 Ga0207644_10003130
609 Ga0207644_10250135
610 Ga0207690_10000395
611 Ga0207706_10000002
612 Ga0207706_10142290
613 Ga0207706_10222933
614 Ga0207686_10486652
615 Ga0207670_10173467
616 Ga0207669_10005777
617 Ga0207669_10051451
618 Ga0207669_10275576
619 Ga0207704_10170566
620 Ga0207704_10682079
621 Ga0207691_10039009
622 Ga0207691_10077169
623 Ga0207691_10116273
624 Ga0207691_10268973
625 Ga0207691_10400183
626 Ga0207711_10001196
627 Ga0207711_10016430
628 Ga0207689_10000030
629 Ga0207689_10744547
630 Ga0207679_10001203
631 Ga0207679_10046161
632 Ga0207679_10491869
633 Ga0207667_10002085
634 Ga0207667_10002263
635 Ga0207667_10113627
636 Ga0207667_10366496
637 Ga0207651_10000744
638 Ga0207651_10014965
639 Ga0207651_10542833
640 Ga0207712_10010093
641 Ga0207712_10052270
642 Ga0207712_10118546
643 Ga0207712_10205056
644 Ga0207712_10418266
645 Ga0207668_10014281
646 Ga0207668_10225941
647 Ga0207668_10338942
648 Ga0207668_10398488
649 Ga0207640_10010032
650 Ga0207640_10126682
651 Ga0207658_10000073
652 Ga0207658_10067229
653 Ga0207658_10184701
654 Ga0207658_10291982
655 Ga0207658_10376451
656 Ga0207677_10061755
657 Ga0207677_10707715
658 Ga0207677_11217889
659 Ga0207703_10002181
660 Ga0207703_10080975
661 Ga0207703_10441012
662 Ga0207639_10001640
663 Ga0207678_10003781
664 Ga0207678_10213759
665 Ga0207678_10354007
666 Ga0207678_10452064
667 Ga0207708_11400925
668 Ga0207702_10000810
669 Ga0207702_10022175
670 Ga0207641_10007204
671 Ga0207641_10022040
672 Ga0207641_10206717
673 Ga0207641_10242640
674 Ga0207648_10011609
675 Ga0207648_10029102
676 Ga0207648_10130265
677 Ga0207676_10000010
678 Ga0207676_10304745
679 Ga0207674_10264169
680 Ga0207674_11304059
681 Ga0207675_100000852
682 Ga0207675_100104516
683 Ga0207675_100433709
684 Ga0207683_10038714
685 Ga0207683_10049980
686 Ga0207683_10252029
687 Ga0207683_10455426
688 Ga0207698_10042011
689 Ga0207698_10572340
690 Ga0209281_1018539
691 Ga0209983_1005806
692 Ga0209974_10021246
693 Ga0207428_10356015
694 Ga0268266_10022816
695 Ga0268266_11166705
696 Ga0268266_11745085
697 Ga0268265_10003355
698 Ga0268265_10042309
699 Ga0268265_10187093
700 Ga0268264_10000123
701 Ga0268264_10025783
702 Ga0268264_10237766
703 Ga0268264_11289102
704 Ga0265332_10327927
705 Ga0265331_10169709
706 Ga0265327_10000094
707 Ga0307513_10558015
708 Ga0307408_100000192
709 Ga0307408_100015800
710 Ga0316579_10249930
711 Ga0316576_10215957
712 Ga0316576_10524532
713 Ga0316576_10595747
714 Ga0316576_10755572
715 Ga0307405_10002481
716 Ga0307405_10768660
717 Ga0316577_10331073
718 Ga0307413_10005033
719 Ga0307413_10069433
720 Ga0307413_10095738
721 Ga0307410_10007305
722 Ga0307410_10136031
723 Ga0307406_10001571
724 Ga0307406_10017922
725 Ga0307406_10088287
726 Ga0307407_10000698
727 Ga0307407_10191206
728 Ga0307407_11205757
729 Ga0307412_10021547
730 Ga0307409_100005474
731 Ga0307409_100019629
732 Ga0307409_100159059
733 Ga0307409_100184609
734 Ga0307416_100013567
735 Ga0307416_100232235
736 Ga0307416_102980361
737 Ga0307414_10029227
738 Ga0307414_10080652
739 Ga0307411_10000867
740 Ga0307411_10648647
741 Ga0307411_10715437
742 Ga0307411_10720312
743 Ga0307415_100009857
744 Ga0307415_100099231
745 Ga0316585_10266538
746 Ga0316580_10096741
747 Ga0316580_10105252
748 Ga0373955_0681664
749 Ga0373961_0212617
750 Ga0316574_0065044
751 Ga0316574_0079477
752 Ga0316574_0302312
753 Ga0373931_0531206
754 Ga0373937_0266350
755 Ga0316582_0072515
756 Ga0316582_0181438
757 Ga0316582_0412322
758 Ga0316582_0418514
759 Ga0316582_0660438
760 Ga0316584_0016769
761 Ga0316584_0060045
762 Ga0316584_0075231
763 Ga0316584_0202763
764 Ga0395900_1001327
765 Ga0316581_0002317
766 Ga0400483_028483
767 Ga0400483_029989
768 Ga0400483_077867
769 Ga0400483_151143
770 Ga0400483_242281
771 Ga0436365_0115737
772 Ga0451797_0799138
773 Ga0451802_1835745
774 Ga0451807_0832178
775 Ga0451833_0042069
776 Ga0451851_0565157
777 Ga0451843_1202550
778 Ga0439432_133216
779 Ga0450914_000785
780 Ga0439435_0189397
781 Ga0451577_0111952
782 Ga0451577_0283774
783 Ga0453684_0373300
784 Ga0495630_0277749
785 Ga0495587_0562797
786 Ga0495598_0116272
787 Ga0495621_0027977
788 Ga0495668_0491986
789 Ga0495634_0336190
790 Ga0495680_0082739
791 Ga0495680_0121387
792 Ga0496101_0045751
793 Ga0496102_0001905
794 Ga0496103_0250998
795 Ga0496106_0000553
796 Ga0496107_0007756
797 Ga0496109_0595386
798 Ga0496113_0594655
799 Ga0496124_0007877
800 Ga0496125_0050172
801 Ga0501290_006225
802 Ga0501034_0942433
803 Ga0501275_000535
804 nmdc:mga0n895_173694_c1
805 nmdc:mga0rr50_323023_c1
806 Ga0500595_013196
807 Ga0500617_201809
808 Ga0500588_0000119
809 2895499497
810 2895512519
811 2895522530
812 2895525704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01029

NusB

NusB family

43

168

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d3c-assembly3.cif.gz_C structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex. 0.949 5 137
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.9467 4 137
5lm7-assembly2.cif.gz_D crystal structure of the lambda n-nus factor complex 0.9284 6 129
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.9201 4 137
3d3c-assembly3.cif.gz_C structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex. 0.9095 5 137
ID Description Score Start End Superfamily
af_P0A780_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9593 1 137 1.10.940.10
af_P0A780_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9394 1 137 1.10.940.10
5lm7D00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9284 6 129 1.10.940.10
af_Q8VYC4_72_208_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8961 50 132 1.10.940.10
4eyaA00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8733 1 130 1.10.940.10
ID Description Score Start End GO Terms
AF-A0A358JMK5-F1-model_v4 deleted 0.99 9 142
AF-A0A536TZI2-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.989 5 143 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-Q2YD50-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9865 2 141 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A7V8BGB7-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9861 5 138 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A328ZJA4-F1-model_v4 deleted 0.9851 2 141

Map