F436384

General Info

Members Datasets Scaffolds Average Seq Length
407 171 407 105

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_11179015|Ga0070658_111790151
Length 111
Sequence MEMNFVTIRARIAEDRGDERRRSERLPVALEVKMRELGANGVEARVLNISERGFMATAEGRFEVGSRVWLMLPGRDRANAIVKWTAGDKIGAEFAEALPLDGLVGLTSIDR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
132 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
148 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
168 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
169 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
170 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.42
Rhizosphere 95.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10024782 3300001979 Bacteria 2030
2 JGI24739J22299_10077166 3300001989 Bacteria 1028
3 JGI24737J22298_10065238 3300001990 Bacteria 1091
4 JGI24735J21928_10017911 3300002067 Bacteria 2188
5 JGI24735J21928_10024998 3300002067 Bacteria 1804
6 JGI24738J21930_10036059 3300002075 Bacteria 1007
7 Ga0065715_10107705 3300005293 Bacteria 2742
8 Ga0070658_10016931 3300005327 Bacteria 5834
9 Ga0070658_10018413 3300005327 Bacteria 5591
10 Ga0070658_10090040 3300005327 Bacteria 2527
11 Ga0070658_10341593 3300005327 Unclassified 1281
12 Ga0070658_10632193 3300005327 Bacteria 928
13 Ga0070658_11179015 3300005327 Unclassified 666
14 Ga0070676_10030317 3300005328 Bacteria 3084
15 Ga0070683_100248530 3300005329 Bacteria 1692
16 Ga0070683_101514052 3300005329 Unclassified 645
17 Ga0070670_100000632 3300005331 Bacteria 27410
18 Ga0070670_100089916 3300005331 Bacteria 2639
19 Ga0070670_100511229 3300005331 Bacteria 1069
20 Ga0070677_10019228 3300005333 Bacteria 2471
21 Ga0070666_10048126 3300005335 Bacteria 2864
22 Ga0070666_10234083 3300005335 Bacteria 1298
23 Ga0070666_10988977 3300005335 Unclassified 624
24 Ga0070680_100236464 3300005336 Bacteria 1543
25 Ga0070682_100062334 3300005337 Bacteria 2362
26 Ga0068868_100295147 3300005338 Unclassified 1375
27 Ga0068868_100376408 3300005338 Unclassified 1221
28 Ga0068868_101603019 3300005338 Bacteria 612
29 Ga0070660_100035657 3300005339 Bacteria 3766
30 Ga0070660_100088988 3300005339 Unclassified 2432
31 Ga0070660_100146630 3300005339 Bacteria 1896
32 Ga0070660_100201054 3300005339 Bacteria 1616
33 Ga0070660_100334877 3300005339 Bacteria 1245
34 Ga0070660_100816961 3300005339 Bacteria 784
35 Ga0070661_100015064 3300005344 Bacteria 5455
36 Ga0070661_100032874 3300005344 Bacteria 3756
37 Ga0070661_100043858 3300005344 Bacteria 3267
38 Ga0070661_100224798 3300005344 Bacteria 1441
39 Ga0070661_100277337 3300005344 Bacteria 1300
40 Ga0070692_10066178 3300005345 Bacteria 1915
41 Ga0070669_100051039 3300005353 Bacteria 3022
42 Ga0070675_100001534 3300005354 Bacteria 17081
43 Ga0070671_100001248 3300005355 Bacteria 19067
44 Ga0070671_100002414 3300005355 Bacteria 14439
45 Ga0070671_100124552 3300005355 Bacteria 2169
46 Ga0070671_100811494 3300005355 Bacteria 815
47 Ga0070671_101186707 3300005355 Unclassified 672
48 Ga0070674_100108630 3300005356 Bacteria 2033
49 Ga0070673_100033460 3300005364 Bacteria 3882
50 Ga0070673_100356014 3300005364 Unclassified 1300
51 Ga0070659_100022023 3300005366 Bacteria 4863
52 Ga0070659_100076306 3300005366 Bacteria 2672
53 Ga0070659_100894669 3300005366 Bacteria 776
54 Ga0070659_101461452 3300005366 Bacteria 608
55 Ga0070667_100014441 3300005367 Bacteria 6526
56 Ga0070667_100030943 3300005367 Bacteria 4463
57 Ga0070667_100214108 3300005367 Bacteria 1713
58 Ga0070709_10926167 3300005434 Bacteria 690
59 Ga0070714_100051350 3300005435 Bacteria 3514
60 Ga0070713_100002001 3300005436 Bacteria 13155
61 Ga0070663_100070508 3300005455 Bacteria 2542
62 Ga0070663_100210500 3300005455 Bacteria 1522
63 Ga0070663_100230942 3300005455 Bacteria 1457
64 Ga0070663_100250582 3300005455 Unclassified 1401
65 Ga0070663_100308600 3300005455 Bacteria 1269
66 Ga0070663_102055959 3300005455 Unclassified 514
67 Ga0070662_100012651 3300005457 Bacteria 5601
68 Ga0070662_100031229 3300005457 Bacteria 3737
69 Ga0070662_100098494 3300005457 Bacteria 2208
70 Ga0070662_100135304 3300005457 Bacteria 1905
71 Ga0070662_100274533 3300005457 Bacteria 1362
72 Ga0070681_10089236 3300005458 Bacteria 3034
73 Ga0070681_10463424 3300005458 Bacteria 1180
74 Ga0070681_10619531 3300005458 Bacteria 997
75 Ga0070681_11879162 3300005458 Unclassified 526
76 Ga0068867_100107757 3300005459 Bacteria 2136
77 Ga0070685_11563349 3300005466 Bacteria 509
78 Ga0070679_100059591 3300005530 Bacteria 3804
79 Ga0070679_100306106 3300005530 Bacteria 1539
80 Ga0070679_100353216 3300005530 Bacteria 1418
81 Ga0070679_100579608 3300005530 Bacteria 1065
82 Ga0070684_100404572 3300005535 Unclassified 1259
83 Ga0070684_102140134 3300005535 Unclassified 528
84 Ga0068853_100674328 3300005539 Bacteria 985
85 Ga0068853_100784972 3300005539 Unclassified 911
86 Ga0068853_101070707 3300005539 Bacteria 777
87 Ga0070672_100002117 3300005543 Bacteria 12535
88 Ga0070672_100033519 3300005543 Bacteria 3890
89 Ga0070672_100144107 3300005543 Bacteria 1967
90 Ga0070672_100530796 3300005543 Unclassified 1020
91 Ga0070693_100625875 3300005547 Bacteria 780
92 Ga0068855_100111205 3300005563 Bacteria 3145
93 Ga0068855_100200509 3300005563 Bacteria 2246
94 Ga0068855_100722767 3300005563 Bacteria 1064
95 Ga0070664_100003263 3300005564 Bacteria 13103
96 Ga0070664_100009094 3300005564 Bacteria 8063
97 Ga0070664_100055970 3300005564 Bacteria 3351
98 Ga0070664_100098080 3300005564 Bacteria 2545
99 Ga0070664_100188980 3300005564 Bacteria 1834
100 Ga0068857_100055724 3300005577 Bacteria 3508
101 Ga0068857_100093265 3300005577 Bacteria 2696
102 Ga0068854_100023845 3300005578 Bacteria 4182
103 Ga0068854_100026854 3300005578 Bacteria 3961
104 Ga0068854_101023634 3300005578 Bacteria 732
105 Ga0068856_100291930 3300005614 Bacteria 1647
106 Ga0068856_100947140 3300005614 Bacteria 880
107 Ga0068856_101307783 3300005614 Bacteria 740
108 Ga0068852_100696751 3300005616 Bacteria 1026
109 Ga0068852_100813009 3300005616 Bacteria 949
110 Ga0068852_101336596 3300005616 Bacteria 738
111 Ga0068859_101011035 3300005617 Bacteria 913
112 Ga0068864_100001058 3300005618 Bacteria 23117
113 Ga0068864_100019310 3300005618 Bacteria 5698
114 Ga0068864_100064886 3300005618 Bacteria 3168
115 Ga0068863_100736438 3300005841 Bacteria 981
116 Ga0081539_10013845 3300005985 Bacteria 6035
117 Ga0081539_10014180 3300005985 Bacteria 5919
118 Ga0070717_10012042 3300006028 Bacteria 6589
119 Ga0097621_100326615 3300006237 Bacteria 1360
120 Ga0097621_100661468 3300006237 Bacteria 959
121 Ga0068871_100137773 3300006358 Bacteria 2074
122 Ga0097620_101010801 3300006931 Bacteria 913
123 Ga0105247_10723020 3300009101 Unclassified 752
124 Ga0105241_10911431 3300009174 Bacteria 817
125 Ga0105248_10000862 3300009177 Bacteria 34132
126 Ga0105248_10785686 3300009177 Bacteria 1074
127 Ga0105238_10141685 3300009551 Bacteria 2381
128 Ga0105239_11033893 3300010375 Bacteria 945
129 Ga0105239_11302570 3300010375 Bacteria 838
130 Ga0157373_10077788 3300013100 Bacteria 2340
131 Ga0157371_10060078 3300013102 Bacteria 2695
132 Ga0157371_10164355 3300013102 Unclassified 1585
133 Ga0157371_10343363 3300013102 Bacteria 1086
134 Ga0157371_10484513 3300013102 Unclassified 912
135 Ga0157371_11040857 3300013102 Unclassified 626
136 Ga0157371_11214574 3300013102 Bacteria 581
137 Ga0157370_10002746 3300013104 Bacteria 21034
138 Ga0157370_10054290 3300013104 Bacteria 3819
139 Ga0157370_10647329 3300013104 Bacteria 966
140 Ga0157369_10004619 3300013105 Bacteria 16188
141 Ga0157369_10176929 3300013105 Bacteria 2246
142 Ga0157369_10793196 3300013105 Bacteria 973
143 Ga0157374_10247883 3300013296 Bacteria 1752
144 Ga0157374_10506832 3300013296 Bacteria 1212
145 Ga0157374_12302003 3300013296 Bacteria 566
146 Ga0157378_10869101 3300013297 Unclassified 931
147 Ga0157378_12906695 3300013297 Unclassified 531
148 Ga0157372_10241623 3300013307 Bacteria 2095
149 Ga0157372_10772165 3300013307 Bacteria 1117
150 Ga0157372_10776699 3300013307 Bacteria 1114
151 Ga0157375_10269112 3300013308 Bacteria 1866
152 Ga0163163_10305619 3300014325 Bacteria 1643
153 Ga0157380_10305258 3300014326 Unclassified 1468
154 Ga0157380_10415368 3300014326 Bacteria 1281
155 Ga0157380_12025762 3300014326 Unclassified 638
156 Ga0163161_10097401 3300017792 Unclassified 2185
157 Ga0206353_11009223 3300020082 Bacteria 1078
158 Ga0207656_10088463 3300025321 Unclassified 1402
159 Ga0207682_10063398 3300025893 Unclassified 1551
160 Ga0207688_10028788 3300025901 Bacteria 3055
161 Ga0207688_10730384 3300025901 Bacteria 627
162 Ga0207680_10088596 3300025903 Bacteria 1963
163 Ga0207680_11286162 3300025903 Unclassified 520
164 Ga0207647_10010028 3300025904 Bacteria 6707
165 Ga0207647_10035437 3300025904 Bacteria 3180
166 Ga0207645_10078913 3300025907 Bacteria 2110
167 Ga0207645_10163837 3300025907 Unclassified 1455
168 Ga0207705_10018056 3300025909 Bacteria 5044
169 Ga0207705_10028544 3300025909 Bacteria 3978
170 Ga0207705_10041576 3300025909 Bacteria 3298
171 Ga0207705_10102955 3300025909 Bacteria 2102
172 Ga0207705_10587143 3300025909 Bacteria 866
173 Ga0207705_11082238 3300025909 Unclassified 618
174 Ga0207705_11280870 3300025909 Unclassified 560
175 Ga0207654_11288093 3300025911 Bacteria 533
176 Ga0207707_11162400 3300025912 Bacteria 626
177 Ga0207660_10139716 3300025917 Bacteria 1851
178 Ga0207657_10048793 3300025919 Bacteria 3695
179 Ga0207657_10049875 3300025919 Bacteria 3645
180 Ga0207657_10050720 3300025919 Bacteria 3609
181 Ga0207657_10111591 3300025919 Unclassified 2257
182 Ga0207657_10117313 3300025919 Bacteria 2192
183 Ga0207657_10130083 3300025919 Bacteria 2064
184 Ga0207657_10162657 3300025919 Bacteria 1812
185 Ga0207657_10618787 3300025919 Unclassified 844
186 Ga0207649_10022116 3300025920 Bacteria 3672
187 Ga0207649_10022640 3300025920 Bacteria 3631
188 Ga0207649_10035554 3300025920 Bacteria 2994
189 Ga0207649_10122652 3300025920 Bacteria 1754
190 Ga0207649_10153416 3300025920 Bacteria 1589
191 Ga0207652_10365549 3300025921 Bacteria 1302
192 Ga0207681_10257257 3300025923 Unclassified 1365
193 Ga0207694_10168424 3300025924 Bacteria 1773
194 Ga0207650_10002896 3300025925 Bacteria 11844
195 Ga0207650_10656511 3300025925 Bacteria 884
196 Ga0207650_10942972 3300025925 Bacteria 733
197 Ga0207659_10001181 3300025926 Bacteria 15609
198 Ga0207659_10275557 3300025926 Bacteria 1374
199 Ga0207700_10224717 3300025928 Bacteria 1593
200 Ga0207700_10240629 3300025928 Bacteria 1542
201 Ga0207664_10071682 3300025929 Bacteria 2792
202 Ga0207664_10195638 3300025929 Bacteria 1743
203 Ga0207644_10003512 3300025931 Bacteria 10147
204 Ga0207644_10008225 3300025931 Bacteria 6833
205 Ga0207690_10019381 3300025932 Bacteria 4188
206 Ga0207690_10114656 3300025932 Bacteria 1946
207 Ga0207690_10169766 3300025932 Bacteria 1633
208 Ga0207690_10478842 3300025932 Bacteria 1004
209 Ga0207690_10945263 3300025932 Unclassified 716
210 Ga0207706_10031454 3300025933 Bacteria 4728
211 Ga0207706_10041113 3300025933 Bacteria 4099
212 Ga0207706_10054214 3300025933 Bacteria 3539
213 Ga0207706_10237772 3300025933 Bacteria 1592
214 Ga0207706_10346728 3300025933 Bacteria 1291
215 Ga0207706_11645712 3300025933 Bacteria 519
216 Ga0207669_10009821 3300025937 Bacteria 4577
217 Ga0207669_11449256 3300025937 Bacteria 585
218 Ga0207691_10000143 3300025940 Bacteria 65645
219 Ga0207691_10100932 3300025940 Bacteria 2575
220 Ga0207691_10387260 3300025940 Unclassified 1193
221 Ga0207711_10000344 3300025941 Bacteria 49354
222 Ga0207711_10019510 3300025941 Bacteria 5644
223 Ga0207711_10923662 3300025941 Bacteria 811
224 Ga0207661_10521981 3300025944 Bacteria 1086
225 Ga0207661_11846141 3300025944 Bacteria 550
226 Ga0207679_10002993 3300025945 Bacteria 10483
227 Ga0207679_10019763 3300025945 Bacteria 4534
228 Ga0207667_10606589 3300025949 Unclassified 1103
229 Ga0207667_10966733 3300025949 Bacteria 840
230 Ga0207667_11184701 3300025949 Bacteria 744
231 Ga0207651_10104503 3300025960 Unclassified 2110
232 Ga0207651_10326139 3300025960 Unclassified 1285
233 Ga0207668_10846538 3300025972 Bacteria 812
234 Ga0207640_10022431 3300025981 Bacteria 3779
235 Ga0207640_10115759 3300025981 Bacteria 1910
236 Ga0207640_11876798 3300025981 Bacteria 542
237 Ga0207658_10004545 3300025986 Bacteria 9630
238 Ga0207658_10008580 3300025986 Bacteria 6954
239 Ga0207677_10522926 3300026023 Bacteria 1029
240 Ga0207703_11685995 3300026035 Unclassified 610
241 Ga0207639_10059967 3300026041 Bacteria 2934
242 Ga0207639_11392294 3300026041 Bacteria 658
243 Ga0207678_10017937 3300026067 Bacteria 6218
244 Ga0207678_10041064 3300026067 Bacteria 4010
245 Ga0207678_10097690 3300026067 Bacteria 2510
246 Ga0207678_10311139 3300026067 Unclassified 1354
247 Ga0207678_10355737 3300026067 Bacteria 1263
248 Ga0207678_11093980 3300026067 Bacteria 706
249 Ga0207702_10321660 3300026078 Bacteria 1473
250 Ga0207702_10676963 3300026078 Bacteria 1016
251 Ga0207702_12087376 3300026078 Bacteria 556
252 Ga0207641_10242090 3300026088 Bacteria 1681
253 Ga0207648_10032350 3300026089 Bacteria 4618
254 Ga0207676_10003831 3300026095 Bacteria 10626
255 Ga0207676_10032996 3300026095 Bacteria 3908
256 Ga0207676_10412061 3300026095 Bacteria 1265
257 Ga0207674_10001507 3300026116 Bacteria 30052
258 Ga0207674_10136491 3300026116 Bacteria 2414
259 Ga0207683_10111288 3300026121 Bacteria 2452
260 Ga0207698_10185279 3300026142 Bacteria 1848
261 Ga0207698_10755853 3300026142 Bacteria 971
262 Ga0207698_10871717 3300026142 Bacteria 906
263 Ga0307408_100497752 3300031548 Bacteria 1066
264 Ga0307405_10418880 3300031731 Bacteria 1053
265 Ga0307405_10472781 3300031731 Bacteria 999
266 Ga0307405_10822138 3300031731 Unclassified 780
267 Ga0307413_10016663 3300031824 Bacteria 3804
268 Ga0307410_10008560 3300031852 Bacteria 5683
269 Ga0307410_10050311 3300031852 Bacteria 2801
270 Ga0307406_10587676 3300031901 Bacteria 916
271 Ga0307407_10035075 3300031903 Bacteria 2752
272 Ga0307412_10305529 3300031911 Bacteria 1259
273 Ga0307412_10612253 3300031911 Unclassified 924
274 Ga0307409_100022858 3300031995 Bacteria 4318
275 Ga0307409_100623123 3300031995 Bacteria 1069
276 Ga0307409_100643252 3300031995 Bacteria 1053
277 Ga0307409_101387900 3300031995 Bacteria 729
278 Ga0307416_103267821 3300032002 Bacteria 542
279 Ga0307414_10002648 3300032004 Bacteria 9420
280 Ga0307414_10159763 3300032004 Unclassified 1788
281 Ga0307414_10788409 3300032004 Bacteria 866
282 Ga0307411_10099086 3300032005 Bacteria 2056
283 Ga0307411_10352361 3300032005 Bacteria 1200
284 Ga0307411_12202328 3300032005 Unclassified 517
285 Ga0307415_100004164 3300032126 Bacteria 7461
286 Ga0307415_101316709 3300032126 Bacteria 685
287 Ga0395899_0000255 3300037312 Bacteria 70382
288 Ga0395899_0040737 3300037312 Bacteria 3473
289 Ga0395899_0076242 3300037312 Bacteria 2448
290 Ga0395899_0106624 3300037312 Bacteria 2017
291 Ga0395899_0131953 3300037312 Unclassified 1783
292 Ga0395899_0336910 3300037312 Unclassified 1012
293 Ga0395899_0592849 3300037312 Bacteria 707
294 Ga0395899_0686358 3300037312 Bacteria 643
295 Ga0395900_0000308 3300037418 Bacteria 72664
296 Ga0395900_0001779 3300037418 Bacteria 24718
297 Ga0395900_0003085 3300037418 Bacteria 18103
298 Ga0395900_0067021 3300037418 Bacteria 3688
299 Ga0395900_0086807 3300037418 Bacteria 3216
300 Ga0395900_0115619 3300037418 Bacteria 2753
301 Ga0395900_0143218 3300037418 Bacteria 2446
302 Ga0395900_0146573 3300037418 Bacteria 2413
303 Ga0395900_0153157 3300037418 Bacteria 2355
304 Ga0395900_0271773 3300037418 Bacteria 1689
305 Ga0395900_0351890 3300037418 Bacteria 1446
306 Ga0395900_0557171 3300037418 Bacteria 1090
307 Ga0395900_0767880 3300037418 Bacteria 893
308 Ga0395900_0974116 3300037418 Bacteria 769
309 Ga0395898_0001096 3300037466 Bacteria 41791
310 Ga0395898_0044106 3300037466 Bacteria 4392
311 Ga0395898_0151978 3300037466 Bacteria 2214
312 Ga0395898_0533604 3300037466 Unclassified 1115
313 Ga0395898_0562666 3300037466 Bacteria 1082
314 Ga0395898_0834692 3300037466 Unclassified 861
315 Ga0395898_0926232 3300037466 Bacteria 809
316 Ga0395905_0000005 3300037471 Bacteria 557808
317 Ga0395905_0004102 3300037471 Bacteria 15259
318 Ga0395905_0006135 3300037471 Bacteria 12132
319 Ga0395905_0016339 3300037471 Bacteria 7052
320 Ga0395905_0035614 3300037471 Bacteria 4674
321 Ga0395905_0057078 3300037471 Bacteria 3651
322 Ga0395905_0060506 3300037471 Bacteria 3541
323 Ga0395905_0062625 3300037471 Bacteria 3479
324 Ga0395905_0106386 3300037471 Bacteria 2634
325 Ga0395905_0134598 3300037471 Bacteria 2324
326 Ga0395905_0309603 3300037471 Bacteria 1468
327 Ga0395905_0314997 3300037471 Bacteria 1453
328 Ga0395905_0417218 3300037471 Bacteria 1238
329 Ga0395905_0788219 3300037471 Unclassified 853
330 Ga0395905_0850179 3300037471 Bacteria 815
331 Ga0395905_1254127 3300037471 Bacteria 645
332 Ga0395905_1295203 3300037471 Unclassified 632
333 Ga0395905_1429371 3300037471 Unclassified 596
334 Ga0395901_0006031 3300038443 Bacteria 12280
335 Ga0395901_0025527 3300038443 Bacteria 6068
336 Ga0395901_0078245 3300038443 Bacteria 3453
337 Ga0395901_0116411 3300038443 Bacteria 2807
338 Ga0395901_0127009 3300038443 Bacteria 2679
339 Ga0395901_0132458 3300038443 Bacteria 2619
340 Ga0395901_0259888 3300038443 Bacteria 1807
341 Ga0395901_0454393 3300038443 Unclassified 1310
342 Ga0395901_0464111 3300038443 Bacteria 1293
343 Ga0395901_0610440 3300038443 Unclassified 1099
344 Ga0395901_0734108 3300038443 Bacteria 982
345 Ga0395901_0795324 3300038443 Bacteria 935
346 Ga0395901_1115704 3300038443 Unclassified 758
347 Ga0395901_1130078 3300038443 Bacteria 752
348 Ga0395901_1424325 3300038443 Unclassified 651
349 Ga0395901_1461130 3300038443 Bacteria 640
350 Ga0439448_0000189 3300042005 Bacteria 12696
351 Ga0450898_001292 3300042134 Bacteria 3265
352 Ga0439458_0000480 3300042157 Bacteria 10247
353 Ga0466969_0013908 3300044656 Bacteria 4236
354 Ga0466966_0012955 3300044684 Bacteria 5521
355 Ga0466966_0638502 3300044684 Unclassified 641
356 Ga0466961_0072649 3300044693 Unclassified 2182
357 Ga0466963_0007507 3300044694 Bacteria 6505
358 Ga0466963_0026210 3300044694 Bacteria 3727
359 Ga0466964_0285126 3300044706 Unclassified 827
360 Ga0466971_0145889 3300044719 Bacteria 1103
361 Ga0466970_0147180 3300044765 Bacteria 1300
362 Ga0466957_0000589 3300044842 Bacteria 18425
363 Ga0466957_0115242 3300044842 Unclassified 1708
364 Ga0466957_0326210 3300044842 Bacteria 1037
365 Ga0466960_0091591 3300044901 Bacteria 1551
366 Ga0451576_1085596 3300045051 Bacteria 838
367 Ga0466958_0057085 3300045836 Bacteria 2372
368 Ga0466958_0106306 3300045836 Bacteria 1750
369 Ga0466958_0857400 3300045836 Unclassified 592
370 Ga0466967_0117448 3300045976 Bacteria 2452
371 Ga0466967_0477928 3300045976 Bacteria 1220
372 Ga0466967_0767945 3300045976 Bacteria 956
373 Ga0495629_0089019 3300046459 Bacteria 2154
374 Ga0495585_0525794 3300046492 Unclassified 560
375 Ga0495642_0020078 3300046528 Bacteria 2621
376 Ga0495621_0229798 3300046539 Unclassified 753
377 Ga0495645_0372507 3300046543 Unclassified 915
378 Ga0495668_0018235 3300046616 Bacteria 4056
379 Ga0495669_0000607 3300046684 Bacteria 15668
380 Ga0495669_0025495 3300046684 Bacteria 2579
381 Ga0495670_0215626 3300046691 Bacteria 1019
382 Ga0495683_0089283 3300047323 Bacteria 1495
383 Ga0495677_0072370 3300047445 Unclassified 1286
384 Ga0496100_0003577 3300048903 Bacteria 8123
385 Ga0496101_0116825 3300048904 Bacteria 2013
386 Ga0496101_0223743 3300048904 Bacteria 1461
387 Ga0496102_0719862 3300048905 Bacteria 921
388 Ga0496106_0001313 3300048909 Bacteria 18647
389 Ga0496106_0873136 3300048909 Unclassified 711
390 Ga0496107_0003295 3300048910 Bacteria 10778
391 Ga0496108_0032890 3300048911 Bacteria 4308
392 Ga0496109_0008889 3300048912 Bacteria 8555
393 Ga0496109_0171258 3300048912 Unclassified 2037
394 Ga0496109_1286543 3300048912 Unclassified 667
395 Ga0496110_0003539 3300048913 Bacteria 11996
396 Ga0496110_0015532 3300048913 Bacteria 6339
397 Ga0496111_0000496 3300048914 Bacteria 20302
398 Ga0496112_0000275 3300048915 Bacteria 33348
399 Ga0496113_0012890 3300048916 Bacteria 5637
400 Ga0496113_0549714 3300048916 Bacteria 926
401 Ga0496114_0037663 3300048917 Bacteria 4001
402 Ga0501223_066116 3300049663 Unclassified 710
403 Ga0501229_039394 3300049706 Bacteria 670
404 Ga0501268_060303 3300049765 Bacteria 750
405 Ga0495655_0026922 3300053083 Bacteria 1359
406 Ga0466962_0061075 3300061719 Bacteria 1799
407 Ga0466962_0142346 3300061719 Bacteria 1162

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_10463424 Ga0070681_104634243 83
2 3300031731 Ga0307405_10822138 Ga0307405_108221381 98
3 3300031995 Ga0307409_100643252 Ga0307409_1006432522 98
4 3300049663 Ga0501223_066116 Ga0501223_066116_388_684 98
5 3300049706 Ga0501229_039394 Ga0501229_039394_146_442 98
6 3300049765 Ga0501268_060303 Ga0501268_060303_55_351 98
7 3300005339 Ga0070660_100201054 Ga0070660_1002010543 99
8 3300005547 Ga0070693_100625875 Ga0070693_1006258752 99
9 3300025928 Ga0207700_10224717 Ga0207700_102247173 99
10 3300031995 Ga0307409_101387900 Ga0307409_1013879002 99
11 3300032005 Ga0307411_12202328 Ga0307411_122023282 99
12 3300032126 Ga0307415_101316709 Ga0307415_1013167091 99
13 3300037312 Ga0395899_0076242 Ga0395899_0076242_655_960 99
14 3300037418 Ga0395900_0351890 Ga0395900_0351890_957_1262 99
15 3300037466 Ga0395898_0834692 Ga0395898_0834692_184_489 99
16 3300037471 Ga0395905_0016339 Ga0395905_0016339_1975_2280 99
17 3300038443 Ga0395901_0464111 Ga0395901_0464111_501_806 99
18 3300044684 Ga0466966_0638502 Ga0466966_0638502_121_420 99
19 3300005335 Ga0070666_10234083 Ga0070666_102340833 100
20 3300005338 Ga0068868_100376408 Ga0068868_1003764082 100
21 3300005355 Ga0070671_100124552 Ga0070671_1001245523 100
22 3300005367 Ga0070667_100214108 Ga0070667_1002141083 100
23 3300005459 Ga0068867_100107757 Ga0068867_1001077572 100
24 3300005578 Ga0068854_100026854 Ga0068854_1000268545 100
25 3300005614 Ga0068856_101307783 Ga0068856_1013077832 100
26 3300006237 Ga0097621_100326615 Ga0097621_1003266153 100
27 3300006358 Ga0068871_100137773 Ga0068871_1001377733 100
28 3300025907 Ga0207645_10163837 Ga0207645_101638373 100
29 3300025919 Ga0207657_10048793 Ga0207657_100487934 100
30 3300025932 Ga0207690_10478842 Ga0207690_104788422 100
31 3300025981 Ga0207640_10022431 Ga0207640_100224315 100
32 3300026067 Ga0207678_10097690 Ga0207678_100976903 100
33 3300026078 Ga0207702_12087376 Ga0207702_120873762 100
34 3300026089 Ga0207648_10032350 Ga0207648_100323502 100
35 3300045976 Ga0466967_0767945 Ga0466967_0767945_473_778 101
36 3300005331 Ga0070670_100000632 Ga0070670_10000063224 102
37 3300005335 Ga0070666_10048126 Ga0070666_100481264 102
38 3300005354 Ga0070675_100001534 Ga0070675_10000153416 102
39 3300005355 Ga0070671_100001248 Ga0070671_10000124816 102
40 3300013102 Ga0157371_10164355 Ga0157371_101643552 102
41 3300013102 Ga0157371_11040857 Ga0157371_110408571 102
42 3300013297 Ga0157378_10869101 Ga0157378_108691012 102
43 3300013308 Ga0157375_10269112 Ga0157375_102691123 102
44 3300014325 Ga0163163_10305619 Ga0163163_103056193 102
45 3300014326 Ga0157380_10305258 Ga0157380_103052582 102
46 3300020082 Ga0206353_11009223 Ga0206353_110092233 102
47 3300026023 Ga0207677_10522926 Ga0207677_105229262 102
48 3300037312 Ga0395899_0040737 Ga0395899_0040737_2955_3263 102
49 3300037418 Ga0395900_0067021 Ga0395900_0067021_2579_2887 102
50 3300037466 Ga0395898_0151978 Ga0395898_0151978_658_966 102
51 3300037471 Ga0395905_0309603 Ga0395905_0309603_661_969 102
52 3300038443 Ga0395901_0127009 Ga0395901_0127009_1123_1431 102
53 3300038443 Ga0395901_0795324 Ga0395901_0795324_126_434 102
54 3300046616 Ga0495668_0018235 Ga0495668_0018235_2720_3040 102
55 3300046684 Ga0495669_0000607 Ga0495669_0000607_11107_11421 102
56 3300048904 Ga0496101_0223743 Ga0496101_0223743_950_1264 102
57 3300048909 Ga0496106_0873136 Ga0496106_0873136_36_350 102
58 3300048912 Ga0496109_0171258 Ga0496109_0171258_1398_1712 102
59 3300048912 Ga0496109_1286543 Ga0496109_1286543_134_454 102
60 3300048913 Ga0496110_0015532 Ga0496110_0015532_4005_4319 102
61 3300048916 Ga0496113_0549714 Ga0496113_0549714_146_460 102
62 3300048917 Ga0496114_0037663 Ga0496114_0037663_987_1301 102
63 3300005335 Ga0070666_10988977 Ga0070666_109889772 103
64 3300009101 Ga0105247_10723020 Ga0105247_107230202 103
65 3300010375 Ga0105239_11302570 Ga0105239_113025702 103
66 3300013100 Ga0157373_10077788 Ga0157373_100777883 103
67 3300013102 Ga0157371_11214574 Ga0157371_112145741 103
68 3300013104 Ga0157370_10002746 Ga0157370_100027466 103
69 3300013105 Ga0157369_10004619 Ga0157369_100046196 103
70 3300013296 Ga0157374_10506832 Ga0157374_105068321 103
71 3300013297 Ga0157378_12906695 Ga0157378_129066951 103
72 3300014326 Ga0157380_12025762 Ga0157380_120257621 103
73 3300025903 Ga0207680_11286162 Ga0207680_112861622 103
74 3300031995 Ga0307409_100623123 Ga0307409_1006231232 103
75 3300038443 Ga0395901_0025527 Ga0395901_0025527_1499_1828 103
76 3300047323 Ga0495683_0089283 Ga0495683_0089283_1117_1428 103
77 3300047445 Ga0495677_0072370 Ga0495677_0072370_233_544 103
78 3300053083 Ga0495655_0026922 Ga0495655_0026922_990_1301 103
79 3300005293 Ga0065715_10107705 Ga0065715_101077052 104
80 3300005327 Ga0070658_10016931 Ga0070658_100169313 104
81 3300005327 Ga0070658_10018413 Ga0070658_100184132 104
82 3300005329 Ga0070683_101514052 Ga0070683_1015140521 104
83 3300005333 Ga0070677_10019228 Ga0070677_100192282 104
84 3300005338 Ga0068868_100295147 Ga0068868_1002951471 104
85 3300005339 Ga0070660_100088988 Ga0070660_1000889883 104
86 3300005339 Ga0070660_100146630 Ga0070660_1001466302 104
87 3300005344 Ga0070661_100043858 Ga0070661_1000438583 104
88 3300005353 Ga0070669_100051039 Ga0070669_1000510391 104
89 3300005355 Ga0070671_100002414 Ga0070671_1000024146 104
90 3300005356 Ga0070674_100108630 Ga0070674_1001086304 104
91 3300005364 Ga0070673_100033460 Ga0070673_1000334604 104
92 3300005364 Ga0070673_100356014 Ga0070673_1003560142 104
93 3300005367 Ga0070667_100014441 Ga0070667_1000144418 104
94 3300005367 Ga0070667_100030943 Ga0070667_1000309434 104
95 3300005455 Ga0070663_100250582 Ga0070663_1002505823 104
96 3300005457 Ga0070662_100012651 Ga0070662_1000126516 104
97 3300005457 Ga0070662_100031229 Ga0070662_1000312294 104
98 3300005457 Ga0070662_100274533 Ga0070662_1002745331 104
99 3300005466 Ga0070685_11563349 Ga0070685_115633491 104
100 3300005543 Ga0070672_100002117 Ga0070672_1000021173 104
101 3300005543 Ga0070672_100033519 Ga0070672_1000335194 104
102 3300005563 Ga0068855_100111205 Ga0068855_1001112053 104
103 3300005563 Ga0068855_100722767 Ga0068855_1007227672 104
104 3300005564 Ga0070664_100009094 Ga0070664_1000090944 104
105 3300005564 Ga0070664_100055970 Ga0070664_1000559705 104
106 3300005578 Ga0068854_101023634 Ga0068854_1010236341 104
107 3300005616 Ga0068852_100813009 Ga0068852_1008130091 104
108 3300005617 Ga0068859_101011035 Ga0068859_1010110351 104
109 3300005618 Ga0068864_100001058 Ga0068864_10000105814 104
110 3300005618 Ga0068864_100019310 Ga0068864_1000193104 104
111 3300005841 Ga0068863_100736438 Ga0068863_1007364383 104
112 3300006237 Ga0097621_100661468 Ga0097621_1006614682 104
113 3300006931 Ga0097620_101010801 Ga0097620_1010108011 104
114 3300009177 Ga0105248_10000862 Ga0105248_1000086229 104
115 3300013296 Ga0157374_12302003 Ga0157374_123020031 104
116 3300017792 Ga0163161_10097401 Ga0163161_100974013 104
117 3300025893 Ga0207682_10063398 Ga0207682_100633983 104
118 3300025901 Ga0207688_10730384 Ga0207688_107303841 104
119 3300025903 Ga0207680_10088596 Ga0207680_100885962 104
120 3300025909 Ga0207705_10041576 Ga0207705_100415765 104
121 3300025919 Ga0207657_10111591 Ga0207657_101115913 104
122 3300025919 Ga0207657_10130083 Ga0207657_101300833 104
123 3300025920 Ga0207649_10022640 Ga0207649_100226403 104
124 3300025923 Ga0207681_10257257 Ga0207681_102572571 104
125 3300025925 Ga0207650_10002896 Ga0207650_100028969 104
126 3300025926 Ga0207659_10001181 Ga0207659_1000118110 104
127 3300025931 Ga0207644_10003512 Ga0207644_100035123 104
128 3300025931 Ga0207644_10008225 Ga0207644_100082252 104
129 3300025933 Ga0207706_10041113 Ga0207706_100411134 104
130 3300025933 Ga0207706_10054214 Ga0207706_100542143 104
131 3300025933 Ga0207706_10237772 Ga0207706_102377724 104
132 3300025937 Ga0207669_10009821 Ga0207669_100098217 104
133 3300025940 Ga0207691_10000143 Ga0207691_1000014360 104
134 3300025940 Ga0207691_10387260 Ga0207691_103872602 104
135 3300025941 Ga0207711_10000344 Ga0207711_1000034433 104
136 3300025941 Ga0207711_10019510 Ga0207711_100195105 104
137 3300025944 Ga0207661_10521981 Ga0207661_105219812 104
138 3300025945 Ga0207679_10019763 Ga0207679_100197635 104
139 3300025949 Ga0207667_10606589 Ga0207667_106065893 104
140 3300025949 Ga0207667_10966733 Ga0207667_109667332 104
141 3300025960 Ga0207651_10104503 Ga0207651_101045033 104
142 3300025960 Ga0207651_10326139 Ga0207651_103261393 104
143 3300025981 Ga0207640_10115759 Ga0207640_101157593 104
144 3300025986 Ga0207658_10004545 Ga0207658_100045456 104
145 3300025986 Ga0207658_10008580 Ga0207658_100085809 104
146 3300026035 Ga0207703_11685995 Ga0207703_116859951 104
147 3300026067 Ga0207678_10311139 Ga0207678_103111392 104
148 3300026067 Ga0207678_11093980 Ga0207678_110939802 104
149 3300026088 Ga0207641_10242090 Ga0207641_102420903 104
150 3300026095 Ga0207676_10003831 Ga0207676_100038319 104
151 3300026095 Ga0207676_10032996 Ga0207676_100329964 104
152 3300026142 Ga0207698_10755853 Ga0207698_107558531 104
153 3300031548 Ga0307408_100497752 Ga0307408_1004977522 104
154 3300031731 Ga0307405_10418880 Ga0307405_104188802 104
155 3300031731 Ga0307405_10472781 Ga0307405_104727812 104
156 3300031824 Ga0307413_10016663 Ga0307413_100166633 104
157 3300031852 Ga0307410_10008560 Ga0307410_100085605 104
158 3300031852 Ga0307410_10050311 Ga0307410_100503114 104
159 3300031901 Ga0307406_10587676 Ga0307406_105876761 104
160 3300031903 Ga0307407_10035075 Ga0307407_100350751 104
161 3300031911 Ga0307412_10305529 Ga0307412_103055292 104
162 3300031995 Ga0307409_100022858 Ga0307409_1000228585 104
163 3300032004 Ga0307414_10002648 Ga0307414_100026489 104
164 3300032004 Ga0307414_10788409 Ga0307414_107884092 104
165 3300032005 Ga0307411_10099086 Ga0307411_100990861 104
166 3300032005 Ga0307411_10352361 Ga0307411_103523613 104
167 3300032126 Ga0307415_100004164 Ga0307415_1000041644 104
168 3300037312 Ga0395899_0000255 Ga0395899_0000255_67131_67445 104
169 3300037312 Ga0395899_0336910 Ga0395899_0336910_169_483 104
170 3300037312 Ga0395899_0592849 Ga0395899_0592849_332_661 104
171 3300037418 Ga0395900_0000308 Ga0395900_0000308_15923_16237 104
172 3300037418 Ga0395900_0086807 Ga0395900_0086807_1525_1839 104
173 3300037418 Ga0395900_0115619 Ga0395900_0115619_406_735 104
174 3300037418 Ga0395900_0143218 Ga0395900_0143218_386_700 104
175 3300037418 Ga0395900_0146573 Ga0395900_0146573_1079_1408 104
176 3300037418 Ga0395900_0557171 Ga0395900_0557171_505_834 104
177 3300037466 Ga0395898_0001096 Ga0395898_0001096_17238_17552 104
178 3300037466 Ga0395898_0533604 Ga0395898_0533604_403_717 104
179 3300037471 Ga0395905_0000005 Ga0395905_0000005_489696_490010 104
180 3300037471 Ga0395905_0106386 Ga0395905_0106386_225_554 104
181 3300037471 Ga0395905_0134598 Ga0395905_0134598_1475_1804 104
182 3300037471 Ga0395905_0417218 Ga0395905_0417218_148_462 104
183 3300037471 Ga0395905_1295203 Ga0395905_1295203_123_452 104
184 3300038443 Ga0395901_0116411 Ga0395901_0116411_1269_1598 104
185 3300038443 Ga0395901_0259888 Ga0395901_0259888_1392_1706 104
186 3300038443 Ga0395901_0454393 Ga0395901_0454393_186_515 104
187 3300038443 Ga0395901_0734108 Ga0395901_0734108_473_802 104
188 3300038443 Ga0395901_1424325 Ga0395901_1424325_198_512 104
189 3300038443 Ga0395901_1461130 Ga0395901_1461130_169_483 104
190 3300044694 Ga0466963_0007507 Ga0466963_0007507_2732_3046 104
191 3300044694 Ga0466963_0026210 Ga0466963_0026210_2817_3131 104
192 3300044706 Ga0466964_0285126 Ga0466964_0285126_440_754 104
193 3300044719 Ga0466971_0145889 Ga0466971_0145889_739_1053 104
194 3300044765 Ga0466970_0147180 Ga0466970_0147180_393_722 104
195 3300044842 Ga0466957_0000589 Ga0466957_0000589_14371_14685 104
196 3300044842 Ga0466957_0115242 Ga0466957_0115242_1188_1502 104
197 3300044842 Ga0466957_0326210 Ga0466957_0326210_388_702 104
198 3300044901 Ga0466960_0091591 Ga0466960_0091591_1130_1444 104
199 3300045836 Ga0466958_0057085 Ga0466958_0057085_1709_2023 104
200 3300045836 Ga0466958_0106306 Ga0466958_0106306_692_1006 104
201 3300045836 Ga0466958_0857400 Ga0466958_0857400_196_510 104
202 3300045976 Ga0466967_0117448 Ga0466967_0117448_1997_2311 104
203 3300045976 Ga0466967_0477928 Ga0466967_0477928_523_837 104
204 3300046492 Ga0495585_0525794 Ga0495585_0525794_138_464 104
205 3300046528 Ga0495642_0020078 Ga0495642_0020078_2272_2586 104
206 3300046539 Ga0495621_0229798 Ga0495621_0229798_203_529 104
207 3300046684 Ga0495669_0025495 Ga0495669_0025495_265_591 104
208 3300046691 Ga0495670_0215626 Ga0495670_0215626_410_736 104
209 3300048903 Ga0496100_0003577 Ga0496100_0003577_1963_2277 104
210 3300048904 Ga0496101_0116825 Ga0496101_0116825_499_813 104
211 3300048905 Ga0496102_0719862 Ga0496102_0719862_502_816 104
212 3300048909 Ga0496106_0001313 Ga0496106_0001313_8654_8968 104
213 3300048910 Ga0496107_0003295 Ga0496107_0003295_10221_10535 104
214 3300048911 Ga0496108_0032890 Ga0496108_0032890_1073_1387 104
215 3300048912 Ga0496109_0008889 Ga0496109_0008889_7328_7642 104
216 3300048913 Ga0496110_0003539 Ga0496110_0003539_5150_5464 104
217 3300048914 Ga0496111_0000496 Ga0496111_0000496_13141_13455 104
218 3300048915 Ga0496112_0000275 Ga0496112_0000275_10300_10614 104
219 3300048916 Ga0496113_0012890 Ga0496113_0012890_5202_5516 104
220 3300061719 Ga0466962_0061075 Ga0466962_0061075_1108_1422 104
221 3300061719 Ga0466962_0142346 Ga0466962_0142346_293_607 104
222 3300001979 JGI24740J21852_10024782 JGI24740J21852_100247823 105
223 3300001989 JGI24739J22299_10077166 JGI24739J22299_100771661 105
224 3300001990 JGI24737J22298_10065238 JGI24737J22298_100652382 105
225 3300002067 JGI24735J21928_10017911 JGI24735J21928_100179112 105
226 3300002067 JGI24735J21928_10024998 JGI24735J21928_100249983 105
227 3300002075 JGI24738J21930_10036059 JGI24738J21930_100360593 105
228 3300005327 Ga0070658_10090040 Ga0070658_100900402 105
229 3300005327 Ga0070658_10341593 Ga0070658_103415933 105
230 3300005327 Ga0070658_10632193 Ga0070658_106321932 105
231 3300005327 Ga0070658_11179015 Ga0070658_111790151 105
232 3300005328 Ga0070676_10030317 Ga0070676_100303174 105
233 3300005329 Ga0070683_100248530 Ga0070683_1002485302 105
234 3300005331 Ga0070670_100089916 Ga0070670_1000899163 105
235 3300005331 Ga0070670_100511229 Ga0070670_1005112292 105
236 3300005336 Ga0070680_100236464 Ga0070680_1002364643 105
237 3300005337 Ga0070682_100062334 Ga0070682_1000623343 105
238 3300005338 Ga0068868_101603019 Ga0068868_1016030191 105
239 3300005339 Ga0070660_100035657 Ga0070660_1000356573 105
240 3300005339 Ga0070660_100334877 Ga0070660_1003348772 105
241 3300005339 Ga0070660_100816961 Ga0070660_1008169611 105
242 3300005344 Ga0070661_100015064 Ga0070661_1000150646 105
243 3300005344 Ga0070661_100032874 Ga0070661_1000328743 105
244 3300005344 Ga0070661_100224798 Ga0070661_1002247981 105
245 3300005344 Ga0070661_100277337 Ga0070661_1002773372 105
246 3300005345 Ga0070692_10066178 Ga0070692_100661781 105
247 3300005355 Ga0070671_100811494 Ga0070671_1008114941 105
248 3300005355 Ga0070671_101186707 Ga0070671_1011867071 105
249 3300005366 Ga0070659_100022023 Ga0070659_1000220234 105
250 3300005366 Ga0070659_100076306 Ga0070659_1000763063 105
251 3300005366 Ga0070659_100894669 Ga0070659_1008946692 105
252 3300005366 Ga0070659_101461452 Ga0070659_1014614521 105
253 3300005434 Ga0070709_10926167 Ga0070709_109261672 105
254 3300005435 Ga0070714_100051350 Ga0070714_1000513505 105
255 3300005436 Ga0070713_100002001 Ga0070713_10000200114 105
256 3300005455 Ga0070663_100070508 Ga0070663_1000705081 105
257 3300005455 Ga0070663_100210500 Ga0070663_1002105003 105
258 3300005455 Ga0070663_100230942 Ga0070663_1002309423 105
259 3300005455 Ga0070663_100308600 Ga0070663_1003086003 105
260 3300005455 Ga0070663_102055959 Ga0070663_1020559591 105
261 3300005457 Ga0070662_100098494 Ga0070662_1000984943 105
262 3300005457 Ga0070662_100135304 Ga0070662_1001353041 105
263 3300005458 Ga0070681_10089236 Ga0070681_100892363 105
264 3300005458 Ga0070681_10619531 Ga0070681_106195313 105
265 3300005458 Ga0070681_11879162 Ga0070681_118791621 105
266 3300005530 Ga0070679_100059591 Ga0070679_1000595915 105
267 3300005530 Ga0070679_100306106 Ga0070679_1003061061 105
268 3300005530 Ga0070679_100353216 Ga0070679_1003532163 105
269 3300005530 Ga0070679_100579608 Ga0070679_1005796081 105
270 3300005535 Ga0070684_100404572 Ga0070684_1004045723 105
271 3300005535 Ga0070684_102140134 Ga0070684_1021401341 105
272 3300005539 Ga0068853_100674328 Ga0068853_1006743281 105
273 3300005539 Ga0068853_100784972 Ga0068853_1007849723 105
274 3300005539 Ga0068853_101070707 Ga0068853_1010707072 105
275 3300005543 Ga0070672_100144107 Ga0070672_1001441073 105
276 3300005543 Ga0070672_100530796 Ga0070672_1005307962 105
277 3300005563 Ga0068855_100200509 Ga0068855_1002005093 105
278 3300005564 Ga0070664_100003263 Ga0070664_10000326314 105
279 3300005564 Ga0070664_100098080 Ga0070664_1000980803 105
280 3300005564 Ga0070664_100188980 Ga0070664_1001889802 105
281 3300005577 Ga0068857_100055724 Ga0068857_1000557243 105
282 3300005577 Ga0068857_100093265 Ga0068857_1000932653 105
283 3300005578 Ga0068854_100023845 Ga0068854_1000238453 105
284 3300005614 Ga0068856_100291930 Ga0068856_1002919302 105
285 3300005614 Ga0068856_100947140 Ga0068856_1009471401 105
286 3300005616 Ga0068852_100696751 Ga0068852_1006967512 105
287 3300005616 Ga0068852_101336596 Ga0068852_1013365961 105
288 3300005618 Ga0068864_100064886 Ga0068864_1000648863 105
289 3300005985 Ga0081539_10013845 Ga0081539_100138458 105
290 3300005985 Ga0081539_10014180 Ga0081539_100141807 105
291 3300006028 Ga0070717_10012042 Ga0070717_100120428 105
292 3300009174 Ga0105241_10911431 Ga0105241_109114313 105
293 3300009177 Ga0105248_10785686 Ga0105248_107856863 105
294 3300009551 Ga0105238_10141685 Ga0105238_101416853 105
295 3300010375 Ga0105239_11033893 Ga0105239_110338932 105
296 3300013102 Ga0157371_10060078 Ga0157371_100600783 105
297 3300013102 Ga0157371_10343363 Ga0157371_103433631 105
298 3300013102 Ga0157371_10484513 Ga0157371_104845132 105
299 3300013104 Ga0157370_10054290 Ga0157370_100542904 105
300 3300013104 Ga0157370_10647329 Ga0157370_106473292 105
301 3300013105 Ga0157369_10176929 Ga0157369_101769293 105
302 3300013105 Ga0157369_10793196 Ga0157369_107931962 105
303 3300013296 Ga0157374_10247883 Ga0157374_102478833 105
304 3300013307 Ga0157372_10241623 Ga0157372_102416232 105
305 3300013307 Ga0157372_10772165 Ga0157372_107721652 105
306 3300013307 Ga0157372_10776699 Ga0157372_107766993 105
307 3300014326 Ga0157380_10415368 Ga0157380_104153683 105
308 3300025321 Ga0207656_10088463 Ga0207656_100884632 105
309 3300025901 Ga0207688_10028788 Ga0207688_100287882 105
310 3300025904 Ga0207647_10010028 Ga0207647_100100283 105
311 3300025904 Ga0207647_10035437 Ga0207647_100354374 105
312 3300025907 Ga0207645_10078913 Ga0207645_100789133 105
313 3300025909 Ga0207705_10018056 Ga0207705_100180566 105
314 3300025909 Ga0207705_10028544 Ga0207705_100285444 105
315 3300025909 Ga0207705_10102955 Ga0207705_101029554 105
316 3300025909 Ga0207705_10587143 Ga0207705_105871431 105
317 3300025909 Ga0207705_11082238 Ga0207705_110822381 105
318 3300025909 Ga0207705_11280870 Ga0207705_112808701 105
319 3300025911 Ga0207654_11288093 Ga0207654_112880931 105
320 3300025912 Ga0207707_11162400 Ga0207707_111624001 105
321 3300025917 Ga0207660_10139716 Ga0207660_101397162 105
322 3300025919 Ga0207657_10049875 Ga0207657_100498754 105
323 3300025919 Ga0207657_10050720 Ga0207657_100507203 105
324 3300025919 Ga0207657_10117313 Ga0207657_101173131 105
325 3300025919 Ga0207657_10162657 Ga0207657_101626573 105
326 3300025919 Ga0207657_10618787 Ga0207657_106187871 105
327 3300025920 Ga0207649_10022116 Ga0207649_100221163 105
328 3300025920 Ga0207649_10035554 Ga0207649_100355543 105
329 3300025920 Ga0207649_10122652 Ga0207649_101226523 105
330 3300025920 Ga0207649_10153416 Ga0207649_101534163 105
331 3300025921 Ga0207652_10365549 Ga0207652_103655493 105
332 3300025924 Ga0207694_10168424 Ga0207694_101684242 105
333 3300025925 Ga0207650_10656511 Ga0207650_106565112 105
334 3300025925 Ga0207650_10942972 Ga0207650_109429722 105
335 3300025926 Ga0207659_10275557 Ga0207659_102755572 105
336 3300025928 Ga0207700_10240629 Ga0207700_102406293 105
337 3300025929 Ga0207664_10071682 Ga0207664_100716822 105
338 3300025929 Ga0207664_10195638 Ga0207664_101956383 105
339 3300025932 Ga0207690_10019381 Ga0207690_100193814 105
340 3300025932 Ga0207690_10114656 Ga0207690_101146561 105
341 3300025932 Ga0207690_10169766 Ga0207690_101697663 105
342 3300025932 Ga0207690_10945263 Ga0207690_109452632 105
343 3300025933 Ga0207706_10031454 Ga0207706_100314544 105
344 3300025933 Ga0207706_10346728 Ga0207706_103467281 105
345 3300025933 Ga0207706_11645712 Ga0207706_116457121 105
346 3300025937 Ga0207669_11449256 Ga0207669_114492561 105
347 3300025940 Ga0207691_10100932 Ga0207691_101009324 105
348 3300025941 Ga0207711_10923662 Ga0207711_109236622 105
349 3300025944 Ga0207661_11846141 Ga0207661_118461412 105
350 3300025945 Ga0207679_10002993 Ga0207679_100029937 105
351 3300025949 Ga0207667_11184701 Ga0207667_111847012 105
352 3300025972 Ga0207668_10846538 Ga0207668_108465382 105
353 3300025981 Ga0207640_11876798 Ga0207640_118767982 105
354 3300026041 Ga0207639_10059967 Ga0207639_100599671 105
355 3300026041 Ga0207639_11392294 Ga0207639_113922941 105
356 3300026067 Ga0207678_10017937 Ga0207678_100179374 105
357 3300026067 Ga0207678_10041064 Ga0207678_100410644 105
358 3300026067 Ga0207678_10355737 Ga0207678_103557371 105
359 3300026078 Ga0207702_10321660 Ga0207702_103216602 105
360 3300026078 Ga0207702_10676963 Ga0207702_106769633 105
361 3300026095 Ga0207676_10412061 Ga0207676_104120612 105
362 3300026116 Ga0207674_10001507 Ga0207674_1000150734 105
363 3300026116 Ga0207674_10136491 Ga0207674_101364913 105
364 3300026121 Ga0207683_10111288 Ga0207683_101112884 105
365 3300026142 Ga0207698_10185279 Ga0207698_101852791 105
366 3300026142 Ga0207698_10871717 Ga0207698_108717172 105
367 3300031911 Ga0307412_10612253 Ga0307412_106122532 105
368 3300032002 Ga0307416_103267821 Ga0307416_1032678212 105
369 3300032004 Ga0307414_10159763 Ga0307414_101597632 105
370 3300037312 Ga0395899_0106624 Ga0395899_0106624_376_693 105
371 3300037312 Ga0395899_0131953 Ga0395899_0131953_1273_1590 105
372 3300037312 Ga0395899_0686358 Ga0395899_0686358_145_465 105
373 3300037418 Ga0395900_0001779 Ga0395900_0001779_10751_11068 105
374 3300037418 Ga0395900_0003085 Ga0395900_0003085_8316_8636 105
375 3300037418 Ga0395900_0153157 Ga0395900_0153157_215_532 105
376 3300037418 Ga0395900_0271773 Ga0395900_0271773_194_511 105
377 3300037418 Ga0395900_0767880 Ga0395900_0767880_78_395 105
378 3300037418 Ga0395900_0974116 Ga0395900_0974116_124_447 105
379 3300037466 Ga0395898_0044106 Ga0395898_0044106_2996_3313 105
380 3300037466 Ga0395898_0562666 Ga0395898_0562666_193_510 105
381 3300037466 Ga0395898_0926232 Ga0395898_0926232_347_664 105
382 3300037471 Ga0395905_0004102 Ga0395905_0004102_10160_10477 105
383 3300037471 Ga0395905_0006135 Ga0395905_0006135_6779_7096 105
384 3300037471 Ga0395905_0035614 Ga0395905_0035614_255_572 105
385 3300037471 Ga0395905_0057078 Ga0395905_0057078_3086_3406 105
386 3300037471 Ga0395905_0060506 Ga0395905_0060506_115_432 105
387 3300037471 Ga0395905_0062625 Ga0395905_0062625_2861_3178 105
388 3300037471 Ga0395905_0314997 Ga0395905_0314997_302_622 105
389 3300037471 Ga0395905_0788219 Ga0395905_0788219_172_489 105
390 3300037471 Ga0395905_0850179 Ga0395905_0850179_295_612 105
391 3300037471 Ga0395905_1254127 Ga0395905_1254127_46_369 105
392 3300037471 Ga0395905_1429371 Ga0395905_1429371_123_443 105
393 3300038443 Ga0395901_0006031 Ga0395901_0006031_8598_8915 105
394 3300038443 Ga0395901_0078245 Ga0395901_0078245_1718_2035 105
395 3300038443 Ga0395901_0132458 Ga0395901_0132458_1137_1454 105
396 3300038443 Ga0395901_0610440 Ga0395901_0610440_653_973 105
397 3300038443 Ga0395901_1115704 Ga0395901_1115704_240_560 105
398 3300038443 Ga0395901_1130078 Ga0395901_1130078_242_559 105
399 3300042005 Ga0439448_0000189 Ga0439448_0000189_10952_11269 105
400 3300042134 Ga0450898_001292 Ga0450898_001292_451_771 105
401 3300042157 Ga0439458_0000480 Ga0439458_0000480_5766_6083 105
402 3300044656 Ga0466969_0013908 Ga0466969_0013908_1819_2136 105
403 3300044684 Ga0466966_0012955 Ga0466966_0012955_1518_1835 105
404 3300044693 Ga0466961_0072649 Ga0466961_0072649_181_498 105
405 3300045051 Ga0451576_1085596 Ga0451576_1085596_457_774 105
406 3300046459 Ga0495629_0089019 Ga0495629_0089019_1443_1760 105
407 3300046543 Ga0495645_0372507 Ga0495645_0372507_513_830 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07238

PilZ

PilZ domain

19

105

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8igv-assembly1.cif.gz_E hexameric ring complex of engineered v1-atpase bound to 5 adps: a3(de)3_(adp-pi)1cat(adp)2cat,2non-cat 0.8916 46 94
5zea-assembly1.cif.gz_F crystal structure of the nucleotide-free mutant a3b3 0.8892 52 94
8igw-assembly1.cif.gz_D hexameric ring complex of engineered v1-atpase bound to 4 adps: a3(de)3_(adp)3cat,1non-cat, hexameric ring complex of engineered v1-atpase bound to 5 adps: a3(de)3_(adp)3cat,2non-cat 0.8883 46 94
8igv-assembly1.cif.gz_D hexameric ring complex of engineered v1-atpase bound to 5 adps: a3(de)3_(adp-pi)1cat(adp)2cat,2non-cat 0.8881 46 94
8igw-assembly2.cif.gz_J hexameric ring complex of engineered v1-atpase bound to 4 adps: a3(de)3_(adp)3cat,1non-cat, hexameric ring complex of engineered v1-atpase bound to 5 adps: a3(de)3_(adp)3cat,2non-cat 0.8859 46 94
ID Description Score Start End Superfamily
af_Q54SC0_1_67_2.40.240.20 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 0.8681 62 94 2.40.240.20
5o95A01 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 0.8628 62 98 2.40.240.20
af_A0A1D6GI91_64_262_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8339 62 99 3.40.1280.10
af_Q57670_3_72_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.8152 44 99 2.40.30.20
6b8hn01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.8038 44 101 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A4P7RY20-F1-model_v4 PilZ domain-containing protein 0.9689 27 105 GO:0035438
AF-A0A0E9MUN2-F1-model_v4 PilZ domain-containing protein 0.9578 22 105
AF-A0A418WNS5-F1-model_v4 PilZ domain-containing protein 0.957 27 105 GO:0035438
AF-A0A318B6W0-F1-model_v4 deleted 0.9535 25 103
AF-A0A7W0HWB0-F1-model_v4 PilZ domain-containing protein 0.9528 22 105

Feature Viewer

pLDDT pTM Quality
70.99 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map