F436450

General Info

Members Datasets Scaffolds Average Seq Length
407 378 106 384

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10138279|Ga0105243_101382792
Length 446
Sequence VANARPERYSSKAEINASILQRNKKRGFLLRCTKNVAMQQDLYYHSSGWANSERVLMLHVLYLVHDVSDPAVRRRIIMLRAGGARVTLAGFRRTANPIVDVEGLQPIDLGATRDGRFAQRLAAVAKAAVSIGAKLATMQRPDLIIARNLEMLALARRAKAAFQASVPIVYECLDIHRLVLRNDILGKAMRGAERYLARDVKLLVTSSPAFIANYFKPFGQVAAPVELIENKYFESAPALVDDRFKVENPVAPPWRIGWFGALRCRRSLALLAEFTRRLNGRFEIVLRGRPALSEFPDFHAFVESEPWLSFRGPYRNPEDMAAIYNEVHFSWAIDFFEEGQNSEWLLPNRLYEGCRFGAVPISMGNTETGRFLSQQDIGILLPQATPEALVAVLGKMEEERFGKLKARVLARNPRTWSYDRSDCRAFVDKLRGLAAVPNSFAAEALA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
9 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
10 2512875024 Mesorhizobium loti R88b Isolate Nodule
11 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
12 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
13 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
14 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
15 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
16 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
17 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
18 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
19 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
20 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
21 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
22 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
23 2643221557 Ensifer sp. Root558 Isolate Unclassified
24 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
25 2643221610 Ensifer sp. Root74 Isolate Unclassified
26 2643221618 Ensifer sp. Root231 Isolate Unclassified
27 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
28 2643221626 Ensifer sp. Root31 Isolate Unclassified
29 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
30 2643221655 Ensifer sp. Root1252 Isolate Unclassified
31 2643221659 Ensifer sp. Root127 Isolate Unclassified
32 2643221668 Ensifer sp. Root423 Isolate Unclassified
33 2643221675 Ensifer sp. Root1298 Isolate Unclassified
34 2643221680 Ensifer sp. Root1312 Isolate Unclassified
35 2643221698 Ensifer sp. Root142 Isolate Unclassified
36 2643221712 Ensifer sp. Root258 Isolate Unclassified
37 2643221723 Ensifer sp. Root278 Isolate Unclassified
38 2643221726 Ensifer sp. Root954 Isolate Unclassified
39 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
40 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
41 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
42 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
43 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
44 2738543024 Aminobacter sp. AP02 Isolate Unclassified
45 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
46 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
47 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
48 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
49 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
50 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
51 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
52 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
53 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
54 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
55 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
56 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
57 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
58 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
59 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
60 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
61 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
62 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
63 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
64 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
65 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
66 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
67 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
68 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
69 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
70 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
71 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
72 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
73 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
74 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
75 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
76 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
77 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
78 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
79 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
80 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
81 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
82 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
83 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
84 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
85 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
86 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
87 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
88 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
89 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
90 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
91 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
92 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
93 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
94 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
95 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
96 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
97 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
98 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
99 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
100 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
101 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
102 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
103 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
104 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
105 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
106 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
107 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
108 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
109 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
110 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
111 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
112 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
113 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
114 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
115 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
116 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
117 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
118 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
119 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
120 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
121 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
122 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
123 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
124 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
125 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
126 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
127 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
128 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
129 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
130 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
131 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
132 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
133 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
134 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
135 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
136 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
137 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
138 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
139 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
140 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
141 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
142 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
143 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
144 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
145 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
146 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
147 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
148 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
149 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
150 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
151 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
152 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
153 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
154 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
155 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
156 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
157 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
158 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
159 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
160 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
161 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
162 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
163 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
164 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
165 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
166 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
167 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
168 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
169 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
170 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
171 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
172 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
173 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
174 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
175 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
176 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
177 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
178 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
179 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
180 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
181 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
182 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
183 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
184 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
185 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
186 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
187 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
188 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
189 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
190 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
191 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
192 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
193 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
194 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
195 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
196 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
197 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
198 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
199 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
200 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
201 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
202 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
203 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
204 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
205 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
206 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
207 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
208 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
209 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
210 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
211 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
212 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
213 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
214 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
215 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
216 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
217 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
218 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
219 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
220 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
221 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
222 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
223 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
224 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
225 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
226 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
227 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
228 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
229 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
230 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
231 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
232 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
233 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
234 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
235 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
236 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
237 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
238 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
239 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
240 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
241 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
242 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
243 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
244 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
245 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
246 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
247 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
248 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
249 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
250 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
251 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
252 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
253 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
254 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
255 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
256 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
257 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
258 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
259 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
260 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
261 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
262 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
263 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
264 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
265 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
266 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
267 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
268 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
269 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
270 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
271 3004167301 Mesorhizobium loti 582 Isolate Unclassified
272 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
273 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
274 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
275 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
276 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
277 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
278 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
279 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
280 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
281 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
282 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
283 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
284 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
285 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
286 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
287 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
288 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
289 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
290 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
291 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
292 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
293 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
294 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
295 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
296 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
297 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
298 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
299 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
300 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
301 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
302 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
303 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
304 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
305 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
306 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
307 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
308 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
309 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
310 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
312 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
313 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
315 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
316 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
317 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
318 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
324 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
325 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
326 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
328 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
329 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
330 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
331 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
332 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
333 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
334 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
335 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
336 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
337 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
338 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
339 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
340 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
343 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
344 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
345 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
358 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
359 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
360 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
361 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
362 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
363 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
364 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
365 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
366 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
367 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
368 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
369 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
370 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
371 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
372 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
373 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
374 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
375 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
376 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
377 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
378 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 26.04
Metatranscriptomes 0
Isolates 73.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.13
Nodule 61.18
Rhizoplane 1.47
Rhizosphere 15.72
Stem 0
Stem Tuber 0
Unclassified 14.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10007040 3300001989 Bacteria 4231
2 JGI25157J39369_1001520 3300002741 Bacteria 8431
3 JGI25165J46597_1000019 3300003214 Bacteria 371528
4 rootL2_10068293 3300003322 Bacteria 2983
5 Ga0055542_1000439 3300003762 Bacteria 39835
6 Ga0055526_1014932 3300003771 Bacteria 3155
7 Ga0055524_1000600 3300003775 Bacteria 25886
8 Ga0055531_10036881 3300003794 Bacteria 1498
9 Ga0068867_100132644 3300005459 Bacteria 1938
10 Ga0068853_100291371 3300005539 Bacteria 1507
11 Ga0070665_100015404 3300005548 Bacteria 7677
12 Ga0070665_100016704 3300005548 Bacteria 7356
13 Ga0068855_100185343 3300005563 Bacteria 2351
14 Ga0075365_10004982 3300006038 Bacteria 7112
15 Ga0075365_10017420 3300006038 Bacteria 4395
16 Ga0075365_10043275 3300006038 Bacteria 2948
17 Ga0075365_10056853 3300006038 Bacteria 2602
18 Ga0075362_10050831 3300006177 Bacteria 1854
19 Ga0075367_10029435 3300006178 Bacteria 3141
20 Ga0075367_10041842 3300006178 Bacteria 2679
21 Ga0075367_10084766 3300006178 Bacteria 1922
22 Ga0075369_10053819 3300006186 Bacteria 1747
23 Ga0105240_10097063 3300009093 Bacteria 3591
24 Ga0105243_10138279 3300009148 Bacteria 2075
25 Ga0105237_10022199 3300009545 Bacteria 6513
26 Ga0105239_10136287 3300010375 Bacteria 2733
27 Ga0105239_10288627 3300010375 Bacteria 1847
28 Ga0105239_10355321 3300010375 Bacteria 1654
29 Ga0105239_10489573 3300010375 Bacteria 1398
30 Ga0171463_1009 3300013249 Bacteria 288284
31 Ga0183363_1189 3300015690 Bacteria 13015
32 Ga0163161_10086400 3300017792 Bacteria 2315
33 Ga0214544_1000419 3300021320 Bacteria 76083
34 Ga0214542_1000027 3300021321 Bacteria 175107
35 Ga0214542_1028727 3300021321 Bacteria 2368
36 Ga0214543_1000023 3300021327 Bacteria 240412
37 Ga0214543_1000047 3300021327 Bacteria 150894
38 Ga0209026_1000013 3300025250 Bacteria 415633
39 Ga0209148_1000032 3300025254 Bacteria 557660
40 Ga0209759_1000241 3300025256 Bacteria 81497
41 Ga0209233_1000034 3300025261 Bacteria 578898
42 Ga0209455_1000168 3300025272 Bacteria 111903
43 Ga0209025_1000177 3300025294 Bacteria 158173
44 Ga0209564_1000132 3300025295 Bacteria 191966
45 Ga0209564_1013314 3300025295 Bacteria 3506
46 Ga0209758_1007036 3300025297 Bacteria 7811
47 Ga0209256_1000122 3300025299 Bacteria 166746
48 Ga0209256_1000721 3300025299 Bacteria 43764
49 Ga0207647_10029411 3300025904 Bacteria 3557
50 Ga0207671_10019361 3300025914 Bacteria 5204
51 Ga0207639_10033956 3300026041 Bacteria 3767
52 Ga0207639_10194873 3300026041 Bacteria 1733
53 Ga0207648_10105672 3300026089 Bacteria 2470
54 Ga0207674_10305548 3300026116 Bacteria 1540
55 Ga0209281_1000297 3300027111 Bacteria 90447
56 Ga0209282_1000082 3300027666 Bacteria 71009
57 Ga0209813_10036497 3300027866 Bacteria 1477
58 Ga0268266_10018366 3300028379 Bacteria 5959
59 Ga0268266_10149117 3300028379 Bacteria 2106
60 Ga0307406_10040287 3300031901 Bacteria 2904
61 Ga0307412_10096479 3300031911 Bacteria 2081
62 Ga0315914_1000045 3300031967 Bacteria 91994
63 Ga0315913_1000848 3300033430 Bacteria 30365
64 Ga0315915_1000029 3300033464 Bacteria 92759
65 Ga0395900_0127114 3300037418 Bacteria 2614
66 Ga0395900_0175493 3300037418 Bacteria 2180
67 Ga0395900_0243472 3300037418 Bacteria 1803
68 Ga0395905_0186016 3300037471 Bacteria 1949
69 Ga0395905_0425975 3300037471 Bacteria 1223
70 Ga0395901_0109656 3300038443 Bacteria 2898
71 Ga0466972_0010562 3300044658 Bacteria 4634
72 Ga0466972_0077202 3300044658 Bacteria 1586
73 Ga0495632_0074748 3300046519 Bacteria 1623
74 Ga0495668_0027582 3300046616 Bacteria 3218
75 Ga0495625_0006647 3300046660 Bacteria 10260
76 Ga0496108_0203296 3300048911 Bacteria 1719
77 Ga0496112_0005133 3300048915 Bacteria 11255
78 Ga0496115_0095632 3300048918 Bacteria 2432
79 Ga0496119_0095012 3300048922 Bacteria 1685
80 Ga0496120_0001416 3300048923 Bacteria 28970
81 Ga0496121_0112920 3300048924 Bacteria 2069
82 Ga0501033_0008924 3300049570 Bacteria 7744
83 Ga0501033_0073628 3300049570 Bacteria 2508
84 Ga0501034_0162048 3300049571 Bacteria 2207
85 Ga0501036_0093172 3300049572 Bacteria 2545
86 Ga0501038_0044715 3300049574 Bacteria 3846
87 Ga0501038_0152021 3300049574 Bacteria 1886
88 Ga0501038_0294017 3300049574 Bacteria 1276
89 Ga0501043_0015029 3300049579 Bacteria 6062
90 Ga0501043_0146173 3300049579 Bacteria 1851
91 Ga0501046_0111170 3300049580 Bacteria 2093
92 Ga0501047_0034690 3300049581 Bacteria 4871
93 Ga0501047_0376556 3300049581 Bacteria 1254
94 Ga0501048_0057130 3300049582 Bacteria 2768
95 Ga0501048_0115566 3300049582 Bacteria 1896
96 Ga0501070_0085282 3300049586 Bacteria 2615
97 Ga0501083_0018802 3300049744 Bacteria 4812
98 Ga0501035_0000728 3300049822 Bacteria 35692
99 Ga0501035_0005425 3300049822 Bacteria 12056
100 Ga0501035_0185586 3300049822 Bacteria 1790
101 Ga0501044_0080104 3300049823 Bacteria 3308
102 nmdc:mga00v17_66843_c1 3300050491 Bacteria 2220
103 nmdc:mga0yw44_136287_c1 3300050492 Bacteria 1593
104 nmdc:mga07m45_115971_c1 3300050496 Bacteria 1544
105 Ga0500620_001409 3300053155 Bacteria 4419
106 Ga0500636_0000001 3300053177 Bacteria 324086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013249 Ga0171463_1009 Ga0171463_1009117 350
2 3300015690 Ga0183363_1189 Ga0183363_11892 350
3 3300003771 Ga0055526_1014932 Ga0055526_10149322 354
4 3300003794 Ga0055531_10036881 Ga0055531_100368811 354
5 3300006038 Ga0075365_10017420 Ga0075365_100174204 354
6 3300025294 Ga0209025_1000177 Ga0209025_100017729 354
7 3300025295 Ga0209564_1000132 Ga0209564_1000132114 354
8 3300025299 Ga0209256_1000721 Ga0209256_100072116 354
9 iso_pu_bacteria 2599185352 2600193605 354
10 iso_pu_bacteria 2643221723 2644673162 354
11 iso_pu_bacteria 2920822456 2920826183 354
12 3300049572 Ga0501036_0093172 Ga0501036_0093172_342_1547 355
13 3300049574 Ga0501038_0044715 Ga0501038_0044715_2075_3280 355
14 3300049582 Ga0501048_0057130 Ga0501048_0057130_145_1350 355
15 3300049744 Ga0501083_0018802 Ga0501083_0018802_342_1547 355
16 iso_pu_bacteria 2643221623 2644130894 355
17 iso_pu_bacteria 8002285264 8002290750 355
18 3300049574 Ga0501038_0294017 Ga0501038_0294017_156_1256 356
19 3300049579 Ga0501043_0015029 Ga0501043_0015029_4222_5385 356
20 3300049580 Ga0501046_0111170 Ga0501046_0111170_54_1217 356
21 3300049581 Ga0501047_0034690 Ga0501047_0034690_1265_2428 356
22 3300049582 Ga0501048_0115566 Ga0501048_0115566_41_1204 356
23 iso_pu_bacteria 3003930520 3003935360 356
24 3300031901 Ga0307406_10040287 Ga0307406_100402873 357
25 3300053177 Ga0500636_0000001 Ga0500636_0000001_119370_120554 357
26 iso_pu_bacteria 2738543024 2739306669 357
27 iso_pu_bacteria 2989771324 2989773008 357
28 3300021320 Ga0214544_1000419 Ga0214544_100041911 358
29 3300021321 Ga0214542_1000027 Ga0214542_1000027125 358
30 3300021321 Ga0214542_1028727 Ga0214542_10287272 358
31 3300021327 Ga0214543_1000023 Ga0214543_1000023172 358
32 3300021327 Ga0214543_1000047 Ga0214543_100004799 358
33 3300027111 Ga0209281_1000297 Ga0209281_100029753 358
34 3300027666 Ga0209282_1000082 Ga0209282_100008231 358
35 3300031967 Ga0315914_1000045 Ga0315914_100004538 358
36 3300033430 Ga0315913_1000848 Ga0315913_100084816 358
37 3300033464 Ga0315915_1000029 Ga0315915_100002952 358
38 iso_pu_bacteria 2508501122 2509109295 358
39 iso_pu_bacteria 2509276019 2509377791 358
40 iso_pu_bacteria 2512875026 2512969276 358
41 iso_pu_bacteria 2513237089 2513605354 358
42 iso_pu_bacteria 2513237160 2514007269 358
43 iso_pu_bacteria 2558860100 2558860797 358
44 iso_pu_bacteria 2643221618 2644104615 358
45 iso_pu_bacteria 2643221626 2644146261 358
46 iso_pu_bacteria 2643221655 2644308003 358
47 iso_pu_bacteria 2643221659 2644333218 358
48 iso_pu_bacteria 2643221698 2644541995 358
49 iso_pu_bacteria 2643221712 2644614157 358
50 iso_pu_bacteria 2657244999 2657685063 358
51 iso_pu_bacteria 2791355082 2792583627 358
52 iso_pu_bacteria 2802428858 2802720503 358
53 iso_pu_bacteria 2802428859 2802727657 358
54 iso_pu_bacteria 2802428860 2802732758 358
55 iso_pu_bacteria 2802428861 2802740043 358
56 iso_pu_bacteria 2802428862 2802746602 358
57 iso_pu_bacteria 2802429268 2804754896 358
58 iso_pu_bacteria 2838074704 2838079055 358
59 iso_pu_bacteria 2839993093 2839993958 358
60 iso_pu_bacteria 2850079185 2850085046 358
61 iso_pu_bacteria 2896384573 2896385810 358
62 iso_pu_bacteria 2913295892 2913295929 358
63 iso_pu_bacteria 2915980308 2915983335 358
64 iso_pu_bacteria 2920760137 2920766483 358
65 iso_pu_bacteria 2937029754 2937030734 358
66 iso_pu_bacteria 2937036028 2937042381 358
67 iso_pu_bacteria 2937078374 2937081050 358
68 iso_pu_bacteria 2937084907 2937086874 358
69 iso_pu_bacteria 2937843397 2937846491 358
70 iso_pu_bacteria 2941499720 2941503819 358
71 iso_pu_bacteria 2957375807 2957378195 358
72 iso_pu_bacteria 2957437181 2957438652 358
73 iso_pu_bacteria 2960591022 2960593614 358
74 iso_pu_bacteria 2960631154 2960635752 358
75 iso_pu_bacteria 2960680706 2960683605 358
76 iso_pu_bacteria 2967728569 2967734201 358
77 iso_pu_bacteria 2970026789 2970029213 358
78 iso_pu_bacteria 2970122695 2970123610 358
79 iso_pu_bacteria 2970143518 2970145067 358
80 iso_pu_bacteria 2977530762 2977532136 358
81 iso_pu_bacteria 2977544691 2977549808 358
82 iso_pu_bacteria 8003999396 8004004440 358
83 iso_pu_bacteria 8049293176 8049298020 358
84 3300049581 Ga0501047_0376556 Ga0501047_0376556_31_1143 359
85 iso_pu_bacteria 2791355091 2792621615 359
86 iso_pu_bacteria 2791355092 2792627698 359
87 iso_pu_bacteria 2791355094 2792640344 359
88 iso_pu_bacteria 2847417321 2847422434 359
89 iso_pu_bacteria 2848992105 2848998158 359
90 iso_pu_bacteria 643692032 643823689 359
91 3300003775 Ga0055524_1000600 Ga0055524_100060019 360
92 3300025295 Ga0209564_1013314 Ga0209564_10133142 360
93 3300025299 Ga0209256_1000122 Ga0209256_1000122115 360
94 3300037418 Ga0395900_0243472 Ga0395900_0243472_131_1306 360
95 3300049570 Ga0501033_0008924 Ga0501033_0008924_3518_4693 360
96 3300049570 Ga0501033_0073628 Ga0501033_0073628_336_1526 360
97 3300049571 Ga0501034_0162048 Ga0501034_0162048_62_1237 360
98 3300049574 Ga0501038_0152021 Ga0501038_0152021_27_1139 360
99 3300049579 Ga0501043_0146173 Ga0501043_0146173_64_1239 360
100 3300049586 Ga0501070_0085282 Ga0501070_0085282_684_1859 360
101 3300049822 Ga0501035_0000728 Ga0501035_0000728_9492_10667 360
102 3300049822 Ga0501035_0005425 Ga0501035_0005425_10591_11781 360
103 3300049822 Ga0501035_0185586 Ga0501035_0185586_205_1380 360
104 3300049823 Ga0501044_0080104 Ga0501044_0080104_949_2124 360
105 iso_pu_bacteria 2513237351 2514586027 360
106 iso_pu_bacteria 2643221557 2643805034 360
107 iso_pu_bacteria 2643221610 2644068350 360
108 iso_pu_bacteria 2643221668 2644379065 360
109 iso_pu_bacteria 2643221675 2644419276 360
110 iso_pu_bacteria 2643221680 2644452633 360
111 iso_pu_bacteria 2643221726 2644691407 360
112 iso_pu_bacteria 2996310559 2996312855 360
113 3300005548 Ga0070665_100015404 Ga0070665_1000154048 361
114 3300028379 Ga0268266_10018366 Ga0268266_100183664 361
115 iso_pu_bacteria 2765235802 2765464014 361
116 iso_pu_bacteria 2899803654 2899808435 361
117 iso_pu_bacteria 2904578770 2904579336 361
118 iso_pu_bacteria 2919119836 2919121837 361
119 3300002741 JGI25157J39369_1001520 JGI25157J39369_10015202 362
120 3300025250 Ga0209026_1000013 Ga0209026_1000013384 362
121 3300025256 Ga0209759_1000241 Ga0209759_10002419 362
122 3300048911 Ga0496108_0203296 Ga0496108_0203296_49_1257 363
123 iso_pu_bacteria 2856364286 2856371434 363
124 iso_pu_bacteria 2857349434 2857352507 363
125 iso_pu_bacteria 2869285874 2869292657 363
126 iso_pu_bacteria 2871429161 2871429472 363
127 iso_pu_bacteria 2874146452 2874154380 363
128 iso_pu_bacteria 2874155637 2874161880 363
129 iso_pu_bacteria 2876413966 2876420062 363
130 iso_pu_bacteria 2878745973 2878753000 363
131 iso_pu_bacteria 2888350351 2888352695 363
132 iso_pu_bacteria 2889010040 2889014468 363
133 iso_pu_bacteria 2889016732 2889020546 363
134 iso_pu_bacteria 2903492973 2903504935 363
135 iso_pu_bacteria 2906308376 2906315391 363
136 iso_pu_bacteria 2906321335 2906321647 363
137 iso_pu_bacteria 2922130491 2922135149 363
138 iso_pu_bacteria 2937813078 2937821935 363
139 iso_pu_bacteria 2958041894 2958055491 363
140 iso_pu_bacteria 2958130278 2958137057 363
141 iso_pu_bacteria 2958179912 2958186940 363
142 iso_pu_bacteria 2961077736 2961085441 363
143 iso_pu_bacteria 2977843712 2977849842 363
144 iso_pu_bacteria 2977942078 2977950584 363
145 iso_pu_bacteria 2987636660 2987641099 363
146 iso_pu_bacteria 2987652177 2987652257 363
147 iso_pu_bacteria 3004203850 3004209911 363
148 iso_pu_bacteria 8004387939 8004395331 363
149 iso_pu_bacteria 8004640170 8004644386 363
150 iso_pu_bacteria 8004714634 8004721652 363
151 iso_pu_bacteria 2513237090 2513609704 364
152 iso_pu_bacteria 2599185301 2599935557 364
153 iso_pu_bacteria 2871435913 2871440755 364
154 iso_pu_bacteria 2513237305 2514421875 365
155 iso_pu_bacteria 2721755686 2723572761 365
156 iso_pu_bacteria 2841734538 2841736004 365
157 iso_pu_bacteria 2847686936 2847689620 365
158 iso_pu_bacteria 2856342000 2856348202 365
159 iso_pu_bacteria 2856349417 2856350344 365
160 iso_pu_bacteria 2856356410 2856361406 365
161 iso_pu_bacteria 2871444079 2871449325 365
162 iso_pu_bacteria 2871474448 2871480077 365
163 iso_pu_bacteria 2871488783 2871490989 365
164 iso_pu_bacteria 2871495908 2871499566 365
165 iso_pu_bacteria 2874102143 2874105051 365
166 iso_pu_bacteria 2878753008 2878755395 365
167 iso_pu_bacteria 2878760144 2878763756 365
168 iso_pu_bacteria 2878767105 2878770754 365
169 iso_pu_bacteria 2881147464 2881147810 365
170 iso_pu_bacteria 2881155292 2881158899 365
171 iso_pu_bacteria 2881845957 2881849996 365
172 iso_pu_bacteria 2881853255 2881859915 365
173 iso_pu_bacteria 2881861095 2881864870 365
174 iso_pu_bacteria 2882632389 2882634882 365
175 iso_pu_bacteria 2885305155 2885306446 365
176 iso_pu_bacteria 2885312484 2885314538 365
177 iso_pu_bacteria 2885334103 2885340387 365
178 iso_pu_bacteria 2885342637 2885350660 365
179 iso_pu_bacteria 2885350715 2885354033 365
180 iso_pu_bacteria 2888343758 2888343982 365
181 iso_pu_bacteria 2903492973 2903499126 365
182 iso_pu_bacteria 2903540706 2903544371 365
183 iso_pu_bacteria 2906328253 2906334814 365
184 iso_pu_bacteria 2922158528 2922164757 365
185 iso_pu_bacteria 2924726620 2924727646 365
186 iso_pu_bacteria 2924784321 2924791629 365
187 iso_pu_bacteria 2937994558 2937998215 365
188 iso_pu_bacteria 2958115193 2958119493 365
189 iso_pu_bacteria 2958165035 2958168690 365
190 iso_pu_bacteria 2961163497 2961167154 365
191 iso_pu_bacteria 2965018300 2965021978 365
192 iso_pu_bacteria 2965062239 2965062867 365
193 iso_pu_bacteria 2968091066 2968093927 365
194 iso_pu_bacteria 2968097103 2968099668 365
195 iso_pu_bacteria 2968128360 2968134203 365
196 iso_pu_bacteria 2968171901 2968175560 365
197 iso_pu_bacteria 2970554993 2970558598 365
198 iso_pu_bacteria 2977821940 2977824535 365
199 iso_pu_bacteria 2977828996 2977831739 365
200 iso_pu_bacteria 2977858184 2977859463 365
201 iso_pu_bacteria 2979779861 2979785228 365
202 iso_pu_bacteria 2987659509 2987663166 365
203 iso_pu_bacteria 2996341866 2996343267 365
204 iso_pu_bacteria 3004188549 3004192218 365
205 iso_pu_bacteria 8004374579 8004376975 365
206 iso_pu_bacteria 8004445564 8004449024 365
207 iso_pu_bacteria 8004703790 8004707077 365
208 iso_pu_bacteria 2876377896 2876380946 366
209 3300003322 rootL2_10068293 rootL2_100682932 367
210 3300037471 Ga0395905_0425975 Ga0395905_0425975_19_1122 367
211 iso_pu_bacteria 2958100919 2958106216 367
212 iso_pu_bacteria 2958172287 2958173088 367
213 iso_pu_bacteria 2965119406 2965120096 367
214 iso_pu_bacteria 2968117919 2968121850 367
215 iso_pu_bacteria 2977971508 2977975659 367
216 iso_pu_bacteria 2979710463 2979712050 367
217 3300026116 Ga0207674_10305548 Ga0207674_103055481 368
218 3300050496 nmdc:mga07m45_115971_c1 nmdc:mga07m45_115971_c1_50_1159 368
219 iso_pu_bacteria 2508501127 2509140149 368
220 iso_pu_bacteria 3000135777 3000142668 368
221 3300003762 Ga0055542_1000439 Ga0055542_100043924 369
222 3300005459 Ga0068867_100132644 Ga0068867_1001326442 369
223 3300005548 Ga0070665_100016704 Ga0070665_1000167042 369
224 3300006038 Ga0075365_10004982 Ga0075365_100049822 369
225 3300006038 Ga0075365_10043275 Ga0075365_100432752 369
226 3300006038 Ga0075365_10056853 Ga0075365_100568533 369
227 3300006177 Ga0075362_10050831 Ga0075362_100508312 369
228 3300006178 Ga0075367_10041842 Ga0075367_100418422 369
229 3300006178 Ga0075367_10084766 Ga0075367_100847662 369
230 3300006186 Ga0075369_10053819 Ga0075369_100538192 369
231 3300009093 Ga0105240_10097063 Ga0105240_100970631 369
232 3300009148 Ga0105243_10138279 Ga0105243_101382792 369
233 3300009545 Ga0105237_10022199 Ga0105237_100221993 369
234 3300010375 Ga0105239_10136287 Ga0105239_101362871 369
235 3300010375 Ga0105239_10288627 Ga0105239_102886271 369
236 3300010375 Ga0105239_10355321 Ga0105239_103553212 369
237 3300010375 Ga0105239_10489573 Ga0105239_104895732 369
238 3300017792 Ga0163161_10086400 Ga0163161_100864002 369
239 3300025254 Ga0209148_1000032 Ga0209148_1000032250 369
240 3300025272 Ga0209455_1000168 Ga0209455_100016892 369
241 3300025914 Ga0207671_10019361 Ga0207671_100193614 369
242 3300026041 Ga0207639_10033956 Ga0207639_100339563 369
243 3300026089 Ga0207648_10105672 Ga0207648_101056722 369
244 3300027866 Ga0209813_10036497 Ga0209813_100364972 369
245 3300028379 Ga0268266_10149117 Ga0268266_101491172 369
246 3300031911 Ga0307412_10096479 Ga0307412_100964792 369
247 3300037418 Ga0395900_0175493 Ga0395900_0175493_814_1986 369
248 3300037471 Ga0395905_0186016 Ga0395905_0186016_317_1489 369
249 3300044658 Ga0466972_0010562 Ga0466972_0010562_1381_2553 369
250 3300046519 Ga0495632_0074748 Ga0495632_0074748_94_1269 369
251 3300046616 Ga0495668_0027582 Ga0495668_0027582_233_1405 369
252 3300046660 Ga0495625_0006647 Ga0495625_0006647_2080_3252 369
253 3300048915 Ga0496112_0005133 Ga0496112_0005133_9575_10747 369
254 3300048918 Ga0496115_0095632 Ga0496115_0095632_602_1711 369
255 3300048924 Ga0496121_0112920 Ga0496121_0112920_266_1438 369
256 3300050491 nmdc:mga00v17_66843_c1 nmdc:mga00v17_66843_c1_658_1830 369
257 3300050492 nmdc:mga0yw44_136287_c1 nmdc:mga0yw44_136287_c1_251_1378 369
258 3300053155 Ga0500620_001409 Ga0500620_001409_2021_3193 369
259 iso_pu_bacteria 2503198000 2503198235 369
260 iso_pu_bacteria 2508501123 2509114515 369
261 iso_pu_bacteria 2509276018 2509368279 369
262 iso_pu_bacteria 2509276022 2509393161 369
263 iso_pu_bacteria 2510065059 2510314570 369
264 iso_pu_bacteria 2512875016 2512934283 369
265 iso_pu_bacteria 2512875024 2512962620 369
266 iso_pu_bacteria 2513237164 2514039792 369
267 iso_pu_bacteria 2588253730 2588520450 369
268 iso_pu_bacteria 2597489875 2597810601 369
269 iso_pu_bacteria 2643221595 2643984058 369
270 iso_pu_bacteria 2643221627 2644156186 369
271 iso_pu_bacteria 2687453392 2688595535 369
272 iso_pu_bacteria 2756170246 2756674377 369
273 iso_pu_bacteria 2757320392 2757570625 369
274 iso_pu_bacteria 2791355123 2792746744 369
275 iso_pu_bacteria 2844002411 2844003935 369
276 iso_pu_bacteria 2844009547 2844010334 369
277 iso_pu_bacteria 2847670302 2847673092 369
278 iso_pu_bacteria 2856314179 2856319875 369
279 iso_pu_bacteria 2856320880 2856321865 369
280 iso_pu_bacteria 2856334872 2856336206 369
281 iso_pu_bacteria 2857367948 2857373029 369
282 iso_pu_bacteria 2869234852 2869236513 369
283 iso_pu_bacteria 2869256925 2869261738 369
284 iso_pu_bacteria 2869278585 2869280043 369
285 iso_pu_bacteria 2871451962 2871457847 369
286 iso_pu_bacteria 2871466892 2871472385 369
287 iso_pu_bacteria 2871481445 2871487269 369
288 iso_pu_bacteria 2874109183 2874110821 369
289 iso_pu_bacteria 2874123672 2874131354 369
290 iso_pu_bacteria 2874139085 2874143405 369
291 iso_pu_bacteria 2874168670 2874171942 369
292 iso_pu_bacteria 2876363079 2876363456 369
293 iso_pu_bacteria 2876392853 2876397412 369
294 iso_pu_bacteria 2876420981 2876425433 369
295 iso_pu_bacteria 2878035449 2878035696 369
296 iso_pu_bacteria 2878730984 2878732370 369
297 iso_pu_bacteria 2878738818 2878740525 369
298 iso_pu_bacteria 2878781027 2878783617 369
299 iso_pu_bacteria 2881161766 2881164593 369
300 iso_pu_bacteria 2885326080 2885327817 369
301 iso_pu_bacteria 2888337043 2888342901 369
302 iso_pu_bacteria 2903448605 2903454461 369
303 iso_pu_bacteria 2903513507 2903516665 369
304 iso_pu_bacteria 2903521522 2903525406 369
305 iso_pu_bacteria 2903528002 2903531849 369
306 iso_pu_bacteria 2904659560 2904664166 369
307 iso_pu_bacteria 2906378014 2906383748 369
308 iso_pu_bacteria 2906401398 2906401608 369
309 iso_pu_bacteria 2906414383 2906420651 369
310 iso_pu_bacteria 2922151315 2922153728 369
311 iso_pu_bacteria 2924710171 2924717902 369
312 iso_pu_bacteria 2924733363 2924736784 369
313 iso_pu_bacteria 2924741084 2924744355 369
314 iso_pu_bacteria 2924762789 2924763043 369
315 iso_pu_bacteria 2924776078 2924778126 369
316 iso_pu_bacteria 2937822353 2937826181 369
317 iso_pu_bacteria 2937836603 2937836763 369
318 iso_pu_bacteria 2937848649 2937854764 369
319 iso_pu_bacteria 2937861824 2937863748 369
320 iso_pu_bacteria 2937877337 2937877924 369
321 iso_pu_bacteria 2937972304 2937973912 369
322 iso_pu_bacteria 2937980651 2937988362 369
323 iso_pu_bacteria 2958034702 2958035909 369
324 iso_pu_bacteria 2958041894 2958045215 369
325 iso_pu_bacteria 2958064165 2958068104 369
326 iso_pu_bacteria 2958071322 2958076130 369
327 iso_pu_bacteria 2958084443 2958085035 369
328 iso_pu_bacteria 2958108152 2958111562 369
329 iso_pu_bacteria 2958122699 2958129849 369
330 iso_pu_bacteria 2958137437 2958140131 369
331 iso_pu_bacteria 2958144490 2958148133 369
332 iso_pu_bacteria 2961114664 2961118694 369
333 iso_pu_bacteria 2961127735 2961130087 369
334 iso_pu_bacteria 2961136820 2961143006 369
335 iso_pu_bacteria 2961170736 2961176659 369
336 iso_pu_bacteria 2961183825 2961188324 369
337 iso_pu_bacteria 2963644680 2963644916 369
338 iso_pu_bacteria 2965025482 2965028670 369
339 iso_pu_bacteria 2965032056 2965033104 369
340 iso_pu_bacteria 2965040258 2965046427 369
341 iso_pu_bacteria 2965047637 2965051032 369
342 iso_pu_bacteria 2965089291 2965091028 369
343 iso_pu_bacteria 2965102966 2965109886 369
344 iso_pu_bacteria 2967996073 2968001326 369
345 iso_pu_bacteria 2968003550 2968007379 369
346 iso_pu_bacteria 2968016561 2968016995 369
347 iso_pu_bacteria 2968083720 2968088802 369
348 iso_pu_bacteria 2968110612 2968115305 369
349 iso_pu_bacteria 2968138860 2968139752 369
350 iso_pu_bacteria 2970469710 2970470152 369
351 iso_pu_bacteria 2970489779 2970493968 369
352 iso_pu_bacteria 2970503327 2970509330 369
353 iso_pu_bacteria 2970510686 2970518232 369
354 iso_pu_bacteria 2970524798 2970525684 369
355 iso_pu_bacteria 2970547951 2970549015 369
356 iso_pu_bacteria 2970593180 2970594640 369
357 iso_pu_bacteria 2970619444 2970622990 369
358 iso_pu_bacteria 2970627176 2970629687 369
359 iso_pu_bacteria 2977851361 2977853382 369
360 iso_pu_bacteria 2977864932 2977866579 369
361 iso_pu_bacteria 2977872689 2977879122 369
362 iso_pu_bacteria 2977907340 2977914469 369
363 iso_pu_bacteria 2977922695 2977925954 369
364 iso_pu_bacteria 2977935797 2977938459 369
365 iso_pu_bacteria 2977950692 2977954976 369
366 iso_pu_bacteria 2977957713 2977963205 369
367 iso_pu_bacteria 2979764755 2979765900 369
368 iso_pu_bacteria 2979793036 2979798535 369
369 iso_pu_bacteria 2979808191 2979814009 369
370 iso_pu_bacteria 2987645492 2987648369 369
371 iso_pu_bacteria 2987666974 2987667234 369
372 iso_pu_bacteria 2987673487 2987678431 369
373 iso_pu_bacteria 2996348954 2996349060 369
374 iso_pu_bacteria 2996386984 2996387966 369
375 iso_pu_bacteria 3004167301 3004172741 369
376 iso_pu_bacteria 3004195979 3004199112 369
377 iso_pu_bacteria 3004211236 3004216507 369
378 iso_pu_bacteria 3004218560 3004218718 369
379 iso_pu_bacteria 3004232784 3004234717 369
380 iso_pu_bacteria 3004239961 3004244145 369
381 iso_pu_bacteria 3004248173 3004253977 369
382 iso_pu_bacteria 3004268573 3004272670 369
383 iso_pu_bacteria 3004275668 3004275772 369
384 iso_pu_bacteria 3004334049 3004337863 369
385 iso_pu_bacteria 637000159 637077435 369
386 iso_pu_bacteria 649633066 649870104 369
387 iso_pu_bacteria 8004300914 8004301987 369
388 iso_pu_bacteria 8004312739 8004316010 369
389 iso_pu_bacteria 8004633249 8004633536 369
390 iso_pu_bacteria 8004727605 8004730409 369
391 iso_pu_bacteria 8055617313 8055617498 369
392 3300001989 JGI24739J22299_10007040 JGI24739J22299_100070402 370
393 3300003214 JGI25165J46597_1000019 JGI25165J46597_100001927 370
394 3300005539 Ga0068853_100291371 Ga0068853_1002913711 370
395 3300005563 Ga0068855_100185343 Ga0068855_1001853432 370
396 3300006178 Ga0075367_10029435 Ga0075367_100294353 370
397 3300025261 Ga0209233_1000034 Ga0209233_1000034212 370
398 3300025297 Ga0209758_1007036 Ga0209758_10070365 370
399 3300025904 Ga0207647_10029411 Ga0207647_100294112 370
400 3300026041 Ga0207639_10194873 Ga0207639_101948731 370
401 3300037418 Ga0395900_0127114 Ga0395900_0127114_704_1816 370
402 3300038443 Ga0395901_0109656 Ga0395901_0109656_728_1840 370
403 3300044658 Ga0466972_0077202 Ga0466972_0077202_211_1386 370
404 3300048922 Ga0496119_0095012 Ga0496119_0095012_352_1464 370
405 3300048923 Ga0496120_0001416 Ga0496120_0001416_23053_24165 370
406 iso_pu_bacteria 2693429783 2694628316 370
407 iso_pu_bacteria 2693429784 2694640827 370

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kih-assembly2.cif.gz_B sucrose-phosphate synthase (tll1590) from thermosynechococcus elongatus 0.7522 2 360
6kih-assembly2.cif.gz_B sucrose-phosphate synthase (tll1590) from thermosynechococcus elongatus 0.7307 2 360
3c4q-assembly1.cif.gz_A structure of the retaining glycosyltransferase msha : the first step in mycothiol biosynthesis. organism : corynebacterium glutamicum- complex with udp 0.7267 2 357
7vfk-assembly1.cif.gz_B crystal structure of sdgb (ligand-free form) 0.7105 53 357
5d00-assembly1.cif.gz_A crystal structure of bsha from b. subtilis complexed with n-acetylglucosaminyl-malate and ump 0.7039 47 359
ID Description Score Start End Superfamily
af_Q2G1K0_190_352_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8031 177 332 3.40.50.2000
af_Q2G1K0_190_352_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7681 177 332 3.40.50.2000
af_Q59002_1_190_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7449 2 152 3.40.50.2000
af_P9WMY5_198_350_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7412 177 331 3.40.50.2000
af_O13933_225_406_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7321 177 332 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A2N7SCT5-F1-model_v4 deleted 0.9881 2 146
AF-A0A529HPG0-F1-model_v4 deleted 0.9801 129 350
AF-A0A529HPG0-F1-model_v4 deleted 0.9715 129 350
AF-A0A529PJY3-F1-model_v4 Glycosyltransferase family 4 protein 0.9641 2 335 GO:0016757
AF-A0A529LEL6-F1-model_v4 Glycosyl transferase family 1 0.9585 29 133 GO:0016740

Feature Viewer

pLDDT pTM Quality
88.07 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map