F436485

General Info

Members Datasets Scaffolds Average Seq Length
407 240 400 224

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10390438|Ga0207712_103904381
Length 261
Sequence MNGAPRPMDTSDDPPRGCGPAWERPGARPVDAPNDEQAQLEVTRVLAVRHGETAWNVENRIQGQLDVPLNERGRWQAQRLALAMGDEAIDAIYTSDLRRTVETAAPTARGCGIAYVTDRGLRERGFGVFEGLTFTEIEQRWPEQSARWRRRDPEFGAEGGETLNDFYARSVASVSRLAAVHPGQTIVIVTHGGVLDCLYRAASRITLDAPRSWQIGNAGINRLLHTPQGFTLIGWSDDHHLEDAPLDEGADGDAAPQARRA

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2643221585 Pelomonas sp. Root662 Isolate Unclassified
3 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
4 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
5 2643221656 Pelomonas sp. Root405 Isolate Unclassified
6 2738541337 Pelomonas sp. BT06 Isolate Unclassified
7 2831864461 Roseateles noduli HZ7 Isolate Nodule
8 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
66 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
67 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
78 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
130 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
131 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
168 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
169 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
204 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
205 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
217 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
218 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
228 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
229 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
230 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
231 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
232 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
233 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
236 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
237 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
238 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
239 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
240 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 0
Isolates 1.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.87
Nodule 1.47
Rhizoplane 1.72
Rhizosphere 58.97
Stem 0
Stem Tuber 0
Unclassified 15.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10012341 3300003316 Bacteria 4310
2 rootH1_10012341 3300003323 Bacteria 22709
3 rootH2_10223726 3300003320 Bacteria 1116
4 rootH2_10235263 3300003320 Bacteria 1932
5 rootL2_10000529 3300003322 Bacteria 63830
6 rootL2_10052786 3300003322 Bacteria 6146
7 rootH1_10031455 3300003323 Bacteria 7535
8 rootH1_10034938 3300003323 Bacteria 3359
9 rootH1_10179877 3300003323 Bacteria 1005
10 Ga0055526_1045870 3300003771 Bacteria 1041
11 Ga0055524_1000563 3300003775 Bacteria 27781
12 Ga0055524_1001509 3300003775 Bacteria 13182
13 Ga0055540_1000090 3300003792 Bacteria 99454
14 Ga0055540_1000091 3300003792 Bacteria 99089
15 Ga0055531_10001723 3300003794 Bacteria 15664
16 Ga0055531_10014159 3300003794 Bacteria 3615
17 Ga0055531_10016188 3300003794 Bacteria 3234
18 Ga0055543_1003885 3300004625 Bacteria 4226
19 Ga0055543_1017733 3300004625 Bacteria 1335
20 Ga0065165_1000275 3300005262 Bacteria 87709
21 Ga0065165_1000462 3300005262 Bacteria 63667
22 Ga0065707_10083353 3300005295 Bacteria 9453
23 Ga0070676_10018515 3300005328 Bacteria 3862
24 Ga0070676_10349062 3300005328 Bacteria 1017
25 Ga0070670_100102567 3300005331 Bacteria 2464
26 Ga0070670_100230649 3300005331 Bacteria 1611
27 Ga0068869_100236078 3300005334 Bacteria 1455
28 Ga0068868_100017165 3300005338 Bacteria 5386
29 Ga0068868_100031177 3300005338 Bacteria 4093
30 Ga0070660_100323289 3300005339 Bacteria 1267
31 Ga0070669_100348215 3300005353 Bacteria 1202
32 Ga0070671_100310246 3300005355 Bacteria 1344
33 Ga0070673_100015282 3300005364 Bacteria 5386
34 Ga0070673_100100385 3300005364 Bacteria 2382
35 Ga0070667_100000344 3300005367 Bacteria 52009
36 Ga0070667_100029834 3300005367 Bacteria 4547
37 Ga0070667_100120604 3300005367 Bacteria 2281
38 Ga0070708_100089294 3300005445 Bacteria 2804
39 Ga0070678_100108830 3300005456 Bacteria 2164
40 Ga0070678_100378622 3300005456 Bacteria 1224
41 Ga0070678_100648194 3300005456 Bacteria 947
42 Ga0070662_100004754 3300005457 Bacteria 8600
43 Ga0070662_100174200 3300005457 Bacteria 1692
44 Ga0068867_100007973 3300005459 Bacteria 7483
45 Ga0068867_100017339 3300005459 Bacteria 5114
46 Ga0068867_100204678 3300005459 Bacteria 1582
47 Ga0068867_100588599 3300005459 Bacteria 969
48 Ga0070685_10493818 3300005466 Bacteria 865
49 Ga0070706_100000367 3300005467 Bacteria 54314
50 Ga0070707_100146807 3300005468 Bacteria 2296
51 Ga0070698_100292231 3300005471 Bacteria 1561
52 Ga0068853_100485451 3300005539 Bacteria 1165
53 Ga0070672_100050004 3300005543 Bacteria 3255
54 Ga0070665_100194241 3300005548 Bacteria 2030
55 Ga0070664_100521432 3300005564 Bacteria 1097
56 Ga0068857_100021329 3300005577 Bacteria 5702
57 Ga0068857_100189136 3300005577 Bacteria 1875
58 Ga0068857_100867220 3300005577 Bacteria 864
59 Ga0068852_100019388 3300005616 Bacteria 5381
60 Ga0068852_100398429 3300005616 Bacteria 1354
61 Ga0068859_100031012 3300005617 Bacteria 5365
62 Ga0068859_100042793 3300005617 Bacteria 4550
63 Ga0068864_100130849 3300005618 Bacteria 2254
64 Ga0068864_100822770 3300005618 Bacteria 914
65 Ga0068866_10002740 3300005718 Bacteria 7264
66 Ga0068861_100005508 3300005719 Bacteria 8577
67 Ga0068861_100611508 3300005719 Bacteria 1002
68 Ga0068870_10012553 3300005840 Bacteria 3962
69 Ga0068863_100209499 3300005841 Bacteria 1877
70 Ga0068858_100462613 3300005842 Bacteria 1223
71 Ga0068860_100017835 3300005843 Bacteria 6913
72 Ga0068860_100184019 3300005843 Bacteria 2020
73 Ga0068860_101031537 3300005843 Bacteria 841
74 Ga0075365_10215950 3300006038 Bacteria 1345
75 Ga0075363_100133096 3300006048 Bacteria 1396
76 Ga0075364_10126319 3300006051 Bacteria 1715
77 Ga0075362_10005056 3300006177 Bacteria 4792
78 Ga0075367_10002445 3300006178 Bacteria 8492
79 Ga0075367_10040266 3300006178 Bacteria 2727
80 Ga0075367_10079530 3300006178 Bacteria 1981
81 Ga0075367_10136325 3300006178 Bacteria 1519
82 Ga0075369_10233721 3300006186 Bacteria 852
83 Ga0075366_10007983 3300006195 Bacteria 5861
84 Ga0075366_10009192 3300006195 Bacteria 5512
85 Ga0075366_10013107 3300006195 Bacteria 4714
86 Ga0075366_10042296 3300006195 Bacteria 2697
87 Ga0075366_10068193 3300006195 Bacteria 2117
88 Ga0075366_10127628 3300006195 Bacteria 1534
89 Ga0097621_100046439 3300006237 Bacteria 3514
90 Ga0075370_10000151 3300006353 Bacteria 23643
91 Ga0075370_10002757 3300006353 Bacteria 8231
92 Ga0075370_10014469 3300006353 Bacteria 4209
93 Ga0075370_10014810 3300006353 Bacteria 4164
94 Ga0075370_10015123 3300006353 Bacteria 4124
95 Ga0075370_10028618 3300006353 Bacteria 3098
96 Ga0075370_10122226 3300006353 Bacteria 1516
97 Ga0075370_10141830 3300006353 Bacteria 1405
98 Ga0075370_10246020 3300006353 Bacteria 1059
99 Ga0068871_100325890 3300006358 Bacteria 1354
100 Ga0068871_100438469 3300006358 Bacteria 1169
101 Ga0075428_100590104 3300006844 Bacteria 1187
102 Ga0075430_100217068 3300006846 Bacteria 1587
103 Ga0075429_100006177 3300006880 Bacteria 10353
104 Ga0075429_100335573 3300006880 Bacteria 1323
105 Ga0097620_100031012 3300006931 Bacteria 5365
106 Ga0097620_100042793 3300006931 Bacteria 4550
107 Ga0099824_1043087 3300006942 Bacteria 1016
108 Ga0099823_1000063 3300006944 Bacteria 50892
109 Ga0079104_1000916 3300006946 Bacteria 23741
110 Ga0105240_10116351 3300009093 Bacteria 3226
111 Ga0105240_11007991 3300009093 Bacteria 890
112 Ga0105245_10606084 3300009098 Bacteria 1122
113 Ga0114129_10084121 3300009147 Bacteria 4418
114 Ga0105243_10129404 3300009148 Bacteria 2140
115 Ga0105243_10236437 3300009148 Bacteria 1624
116 Ga0105237_10113055 3300009545 Bacteria 2707
117 Ga0105238_10412082 3300009551 Bacteria 1345
118 Ga0105249_10017892 3300009553 Bacteria 6297
119 Ga0105249_10199094 3300009553 Bacteria 1959
120 Ga0105239_10909072 3300010375 Bacteria 1010
121 Ga0105246_10139724 3300011119 Bacteria 1820
122 Ga0157317_1000847 3300012475 Bacteria 1496
123 Ga0157319_1000020 3300012497 Bacteria 97019
124 Ga0157374_10263635 3300013296 Bacteria 1698
125 Ga0157378_10003330 3300013297 Bacteria 14290
126 Ga0157378_10704692 3300013297 Bacteria 1029
127 Ga0163162_10005003 3300013306 Bacteria 12767
128 Ga0157375_10062210 3300013308 Bacteria 3708
129 Ga0157375_10109167 3300013308 Bacteria 2863
130 Ga0157375_10223126 3300013308 Bacteria 2043
131 Ga0163163_10796540 3300014325 Bacteria 1008
132 Ga0157380_10061404 3300014326 Bacteria 3007
133 Ga0157379_10029042 3300014968 Bacteria 4917
134 Ga0157379_10071065 3300014968 Bacteria 3114
135 Ga0157379_10154964 3300014968 Unclassified 2066
136 Ga0163161_10345040 3300017792 Bacteria 1182
137 Ga0209563_108879 3300025230 Bacteria 1557
138 Ga0209759_1002570 3300025256 Bacteria 7859
139 Ga0209673_1008924 3300025273 Bacteria 4407
140 Ga0209673_1014804 3300025273 Bacteria 3000
141 Ga0209564_1000131 3300025295 Bacteria 192177
142 Ga0209050_1000326 3300025298 Bacteria 95495
143 Ga0209050_1000967 3300025298 Bacteria 36985
144 Ga0209050_1012676 3300025298 Bacteria 3836
145 Ga0209256_1000019 3300025299 Bacteria 558627
146 Ga0209256_1000416 3300025299 Bacteria 66977
147 Ga0209256_1000913 3300025299 Bacteria 36128
148 Ga0209051_1000133 3300025303 Bacteria 139014
149 Ga0209051_1000925 3300025303 Bacteria 29147
150 Ga0209257_1000038 3300025304 Bacteria 609032
151 Ga0209257_1000444 3300025304 Bacteria 78076
152 Ga0209257_1000519 3300025304 Bacteria 66900
153 Ga0207645_10016510 3300025907 Bacteria 4885
154 Ga0207705_10025142 3300025909 Bacteria 4251
155 Ga0207684_10005313 3300025910 Bacteria 11914
156 Ga0207695_10089435 3300025913 Bacteria 3096
157 Ga0207695_10685395 3300025913 Bacteria 905
158 Ga0207657_10034351 3300025919 Bacteria 4561
159 Ga0207646_10085399 3300025922 Bacteria 2824
160 Ga0207681_10075448 3300025923 Bacteria 2365
161 Ga0207650_10100712 3300025925 Bacteria 2223
162 Ga0207687_10081914 3300025927 Bacteria 2333
163 Ga0207687_10198089 3300025927 Bacteria 1568
164 Ga0207644_10019344 3300025931 Bacteria 4619
165 Ga0207690_10096078 3300025932 Bacteria 2106
166 Ga0207706_10009005 3300025933 Bacteria 9185
167 Ga0207706_10069730 3300025933 Bacteria 3092
168 Ga0207706_10110351 3300025933 Bacteria 2420
169 Ga0207709_10099871 3300025935 Bacteria 1916
170 Ga0207709_10137305 3300025935 Bacteria 1676
171 Ga0207709_10176209 3300025935 Bacteria 1506
172 Ga0207669_10008918 3300025937 Bacteria 4740
173 Ga0207704_10003481 3300025938 Bacteria 7159
174 Ga0207704_10344523 3300025938 Bacteria 1158
175 Ga0207691_10044864 3300025940 Bacteria 4067
176 Ga0207711_10489527 3300025941 Bacteria 1146
177 Ga0207689_10011087 3300025942 Bacteria 7746
178 Ga0207667_10141801 3300025949 Bacteria 2474
179 Ga0207667_10376540 3300025949 Bacteria 1447
180 Ga0207651_10028684 3300025960 Bacteria 3515
181 Ga0207651_10030702 3300025960 Bacteria 3426
182 Ga0207712_10165533 3300025961 Bacteria 1723
183 Ga0207712_10390438 3300025961 Bacteria 1167
184 Ga0207640_10238364 3300025981 Bacteria 1404
185 Ga0207658_10217401 3300025986 Bacteria 1605
186 Ga0207658_10223944 3300025986 Bacteria 1584
187 Ga0207677_10011356 3300026023 Bacteria 5074
188 Ga0207677_10588741 3300026023 Bacteria 975
189 Ga0207677_10765658 3300026023 Bacteria 862
190 Ga0207639_10244495 3300026041 Bacteria 1562
191 Ga0207639_10554606 3300026041 Bacteria 1055
192 Ga0207678_10009464 3300026067 Bacteria 8571
193 Ga0207678_10817910 3300026067 Bacteria 823
194 Ga0207708_10013014 3300026075 Bacteria 6207
195 Ga0207641_10135494 3300026088 Bacteria 2216
196 Ga0207648_10000419 3300026089 Bacteria 46680
197 Ga0207648_10008564 3300026089 Bacteria 9894
198 Ga0207648_10025866 3300026089 Bacteria 5221
199 Ga0207648_10560433 3300026089 Bacteria 1050
200 Ga0207676_10180200 3300026095 Bacteria 1849
201 Ga0207676_10413807 3300026095 Bacteria 1263
202 Ga0207674_10017608 3300026116 Bacteria 7793
203 Ga0207674_10067526 3300026116 Bacteria 3600
204 Ga0207674_10285585 3300026116 Bacteria 1598
205 Ga0207675_100000693 3300026118 Bacteria 33301
206 Ga0207683_10129327 3300026121 Bacteria 2271
207 Ga0207683_10306558 3300026121 Bacteria 1453
208 Ga0207683_10524930 3300026121 Bacteria 1094
209 Ga0207698_10253516 3300026142 Bacteria 1612
210 Ga0209281_1000935 3300027111 Bacteria 24025
211 Ga0209389_1001755 3300027296 Bacteria 15762
212 Ga0209371_1007462 3300027312 Bacteria 3806
213 Ga0209974_10002440 3300027876 Bacteria 6719
214 Ga0268266_10087101 3300028379 Bacteria 2731
215 Ga0268264_10039249 3300028381 Bacteria 3912
216 Ga0268264_10618225 3300028381 Bacteria 1069
217 Ga0307517_10008875 3300028786 Bacteria 14359
218 Ga0307517_10050520 3300028786 Bacteria 4225
219 Ga0307517_10108410 3300028786 Bacteria 2132
220 Ga0307517_10145490 3300028786 Bacteria 1646
221 Ga0307517_10205283 3300028786 Bacteria 1224
222 Ga0307515_10000911 3300028794 Bacteria 68106
223 Ga0307515_10001761 3300028794 Bacteria 48250
224 Ga0307515_10006828 3300028794 Bacteria 22701
225 Ga0307515_10007106 3300028794 Bacteria 22238
226 Ga0307515_10016911 3300028794 Bacteria 13333
227 Ga0307515_10018987 3300028794 Bacteria 12405
228 Ga0307515_10026981 3300028794 Bacteria 9849
229 Ga0307515_10048525 3300028794 Bacteria 6418
230 Ga0307515_10095814 3300028794 Bacteria 3647
231 Ga0307515_10213307 3300028794 Bacteria 1769
232 Ga0307512_10014540 3300030522 Bacteria 7330
233 Ga0307512_10025838 3300030522 Bacteria 5195
234 Ga0307513_10004737 3300031456 Bacteria 18072
235 Ga0307513_10015681 3300031456 Bacteria 9172
236 Ga0307513_10049401 3300031456 Bacteria 4557
237 Ga0307513_10281459 3300031456 Bacteria 1440
238 Ga0307509_10000405 3300031507 Bacteria 72472
239 Ga0307509_10012181 3300031507 Bacteria 10315
240 Ga0307509_10163333 3300031507 Bacteria 2120
241 Ga0307509_10354203 3300031507 Bacteria 1190
242 Ga0307408_100000012 3300031548 Bacteria 408153
243 Ga0307408_100060574 3300031548 Bacteria 2759
244 Ga0307408_100166064 3300031548 Bacteria 1758
245 Ga0307408_100658781 3300031548 Bacteria 937
246 Ga0307508_10000440 3300031616 Bacteria 49668
247 Ga0307508_10000690 3300031616 Bacteria 40442
248 Ga0307508_10025484 3300031616 Bacteria 5361
249 Ga0307508_10035330 3300031616 Bacteria 4504
250 Ga0307508_10049882 3300031616 Bacteria 3727
251 Ga0307514_10000200 3300031649 Bacteria 167194
252 Ga0307514_10002593 3300031649 Bacteria 18522
253 Ga0307514_10042646 3300031649 Bacteria 3567
254 Ga0307514_10095935 3300031649 Bacteria 2144
255 Ga0307516_10000614 3300031730 Bacteria 48089
256 Ga0307516_10000952 3300031730 Bacteria 39918
257 Ga0307516_10001028 3300031730 Bacteria 38713
258 Ga0307516_10004145 3300031730 Bacteria 18077
259 Ga0307516_10008674 3300031730 Bacteria 11443
260 Ga0307516_10146672 3300031730 Bacteria 2125
261 Ga0307518_10279686 3300031838 Bacteria 1034
262 Ga0307410_10210010 3300031852 Bacteria 1491
263 Ga0307406_10126366 3300031901 Bacteria 1788
264 Ga0307412_10277626 3300031911 Bacteria 1314
265 Ga0307412_10322894 3300031911 Bacteria 1229
266 Ga0307416_100118853 3300032002 Bacteria 2350
267 Ga0307416_100431816 3300032002 Bacteria 1365
268 Ga0307416_101016924 3300032002 Bacteria 932
269 Ga0307414_10203251 3300032004 Bacteria 1613
270 Ga0307411_10115421 3300032005 Bacteria 1931
271 Ga0307411_10212681 3300032005 Bacteria 1494
272 Ga0307507_10026762 3300033179 Bacteria 6205
273 Ga0307507_10083848 3300033179 Bacteria 2783
274 Ga0307507_10150752 3300033179 Bacteria 1750
275 Ga0307510_10001950 3300033180 Bacteria 23220
276 Ga0307510_10012041 3300033180 Bacteria 10251
277 Ga0307510_10092760 3300033180 Bacteria 2854
278 Ga0373938_0049104 3300034957 Bacteria 959
279 Ga0373926_0157599 3300035083 Bacteria 866
280 Ga0373940_0074775 3300035088 Bacteria 992
281 Ga0373944_0026454 3300035089 Bacteria 1714
282 Ga0373939_0000081 3300035114 Bacteria 30535
283 Ga0373939_0013863 3300035114 Bacteria 2081
284 Ga0373960_0008035 3300035121 Bacteria 2517
285 Ga0373961_0014629 3300035241 Bacteria 1995
286 Ga0373931_0022461 3300035691 Bacteria 3175
287 Ga0373927_0051260 3300035695 Bacteria 2669
288 Ga0373925_0014382 3300037068 Bacteria 5723
289 Ga0373925_0046026 3300037068 Bacteria 3243
290 Ga0395898_0002912 3300037466 Bacteria 19475
291 Ga0395905_0083762 3300037471 Bacteria 2987
292 Ga0395905_0294763 3300037471 Bacteria 1509
293 Ga0451787_091873 3300041441 Bacteria 1315
294 Ga0451853_0711155 3300041512 Bacteria 933
295 Ga0439455_0012859 3300042012 Bacteria 1886
296 Ga0450890_006164 3300042127 Bacteria 1537
297 Ga0439459_0010443 3300042438 Bacteria 1619
298 Ga0451577_0015259 3300042876 Bacteria 7149
299 Ga0451577_0123545 3300042876 Bacteria 2319
300 Ga0466969_0032988 3300044656 Bacteria 2631
301 Ga0466972_0000934 3300044658 Bacteria 14050
302 Ga0466965_0002514 3300044683 Bacteria 7814
303 Ga0466966_0001809 3300044684 Bacteria 13868
304 Ga0466963_0035158 3300044694 Bacteria 3263
305 Ga0466963_0094697 3300044694 Bacteria 2037
306 Ga0466964_0002118 3300044706 Bacteria 6992
307 Ga0453684_0020398 3300044712 Bacteria 9998
308 Ga0466968_0082383 3300044735 Bacteria 1416
309 Ga0466970_0069504 3300044765 Bacteria 1893
310 Ga0466957_0023920 3300044842 Bacteria 3614
311 Ga0466957_0397127 3300044842 Bacteria 942
312 Ga0466960_0069154 3300044901 Bacteria 1754
313 Ga0466959_0013986 3300045049 Bacteria 5826
314 Ga0451576_0081080 3300045051 Bacteria 3375
315 Ga0466958_0048471 3300045836 Bacteria 2567
316 Ga0495592_0000182 3300046454 Bacteria 55441
317 Ga0495590_0021045 3300046457 Bacteria 2314
318 Ga0495638_0065746 3300046460 Bacteria 2231
319 Ga0495651_0383626 3300046462 Unclassified 921
320 Ga0495650_0053197 3300046471 Bacteria 1659
321 Ga0495582_0145836 3300046473 Bacteria 1343
322 Ga0495583_0043833 3300046506 Bacteria 2081
323 Ga0495610_0059610 3300046512 Bacteria 1821
324 Ga0495610_0088509 3300046512 Bacteria 1407
325 Ga0495620_0042916 3300046515 Bacteria 1973
326 Ga0495632_0070299 3300046519 Bacteria 1684
327 Ga0495632_0072848 3300046519 Bacteria 1648
328 Ga0495648_0154786 3300046524 Bacteria 1192
329 Ga0495648_0162480 3300046524 Bacteria 1153
330 Ga0495642_0115916 3300046528 Bacteria 1148
331 Ga0495597_0008859 3300046542 Bacteria 5018
332 Ga0495597_0131186 3300046542 Bacteria 1039
333 Ga0495668_0081790 3300046616 Bacteria 1772
334 Ga0495611_0268785 3300046648 Bacteria 789
335 Ga0495625_0010408 3300046660 Bacteria 7701
336 Ga0495625_0019559 3300046660 Bacteria 5247
337 Ga0495646_0040113 3300046680 Bacteria 2885
338 Ga0495658_0014662 3300046683 Bacteria 4009
339 Ga0495671_0036716 3300046692 Bacteria 2482
340 Ga0495671_0104723 3300046692 Bacteria 1382
341 Ga0495649_0001813 3300046694 Bacteria 15681
342 Ga0495589_0072897 3300046794 Bacteria 1677
343 Ga0495687_000454 3300047443 Bacteria 50500
344 Ga0495687_027085 3300047443 Bacteria 2686
345 Ga0495686_0333718 3300047472 Bacteria 828
346 Ga0495602_0223374 3300048088 Bacteria 1420
347 Ga0496102_0027006 3300048905 Bacteria 5126
348 Ga0496102_0042876 3300048905 Bacteria 4101
349 Ga0496106_0445563 3300048909 Bacteria 1040
350 Ga0496113_0112344 3300048916 Bacteria 2122
351 Ga0496114_0006581 3300048917 Bacteria 9162
352 Ga0496114_0657996 3300048917 Bacteria 921
353 Ga0496124_0003412 3300048927 Bacteria 19487
354 Ga0496124_0009779 3300048927 Bacteria 9814
355 Ga0496125_0006401 3300048928 Bacteria 12754
356 Ga0501034_0167463 3300049571 Bacteria 2166
357 Ga0501211_000031 3300049658 Bacteria 10035
358 Ga0501252_001210 3300049682 Bacteria 2320
359 nmdc:mga03683_17300_c1 3300050489 Bacteria 2727
360 nmdc:mga00v17_84823_c1 3300050491 Bacteria 1983
361 nmdc:mga0yw44_46296_c1 3300050492 Bacteria 2611
362 nmdc:mga0k408_10283_c1 3300050493 Bacteria 5057
363 nmdc:mga0k408_15354_c1 3300050493 Bacteria 4234
364 nmdc:mga0k408_205812_c1 3300050493 Bacteria 1175
365 nmdc:mga0k408_215824_c1 3300050493 Bacteria 1146
366 nmdc:mga0k408_30264_c1 3300050493 Bacteria 3086
367 nmdc:mga0k408_4653_c1 3300050493 Bacteria 7271
368 nmdc:mga06z11_105478_c1 3300050494 Bacteria 1553
369 nmdc:mga06z11_156609_c1 3300050494 Bacteria 1299
370 nmdc:mga06z11_57191_c1 3300050494 Bacteria 2020
371 nmdc:mga07m45_109397_c1 3300050496 Bacteria 1591
372 nmdc:mga07m45_116788_c1 3300050496 Bacteria 1539
373 nmdc:mga07m45_179936_c1 3300050496 Bacteria 1230
374 nmdc:mga07m45_3277_c1 3300050496 Bacteria 7785
375 nmdc:mga07m45_38869_c1 3300050496 Bacteria 2657
376 nmdc:mga07m45_468_c1 3300050496 Bacteria 16990
377 nmdc:mga07m45_494_c1 3300050496 Bacteria 16679
378 nmdc:mga07m45_5219_c1 3300050496 Bacteria 6445
379 nmdc:mga05p37_190020_c1 3300050507 Bacteria 2494
380 nmdc:mga09592_1109_c1 3300050508 Bacteria 21409
381 nmdc:mga0qj67_199487_c1 3300050509 Bacteria 1626
382 Ga0500644_0005185 3300053088 Bacteria 3282
383 Ga0500651_0018731 3300053093 Bacteria 4288
384 Ga0500650_0180016 3300053098 Bacteria 969
385 Ga0500593_000267 3300053117 Bacteria 21261
386 Ga0500594_0010529 3300053118 Bacteria 2148
387 Ga0500658_0001951 3300053134 Bacteria 8075
388 Ga0500658_0019875 3300053134 Bacteria 2531
389 Ga0500559_0001012 3300053136 Bacteria 17282
390 Ga0500559_0002928 3300053136 Bacteria 8586
391 Ga0500559_0111546 3300053136 Bacteria 1267
392 Ga0500568_0007658 3300053139 Bacteria 5276
393 Ga0500568_0071560 3300053139 Bacteria 1327
394 Ga0500604_0048749 3300053151 Bacteria 1301
395 Ga0500619_050704 3300053154 Bacteria 1342
396 Ga0500622_0001901 3300053156 Bacteria 15758
397 Ga0500622_0005145 3300053156 Bacteria 7933
398 Ga0500627_0039830 3300053158 Bacteria 2014
399 Ga0500587_008683 3300053739 Bacteria 1305
400 Ga0466962_0004378 3300061719 Bacteria 6774

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005456 Ga0070678_100108830 Ga0070678_1001088302 206
2 3300005459 Ga0068867_100007973 Ga0068867_1000079735 206
3 3300005539 Ga0068853_100485451 Ga0068853_1004854512 206
4 3300026089 Ga0207648_10025866 Ga0207648_100258665 206
5 3300028794 Ga0307515_10018987 Ga0307515_100189872 206
6 3300042876 Ga0451577_0123545 Ga0451577_0123545_440_1069 206
7 3300037471 Ga0395905_0083762 Ga0395905_0083762_1438_2100 207
8 3300031456 Ga0307513_10004737 Ga0307513_100047374 208
9 3300006048 Ga0075363_100133096 Ga0075363_1001330962 209
10 3300006178 Ga0075367_10079530 Ga0075367_100795302 209
11 3300006353 Ga0075370_10122226 Ga0075370_101222262 209
12 3300006353 Ga0075370_10246020 Ga0075370_102460202 209
13 3300026067 Ga0207678_10817910 Ga0207678_108179101 209
14 3300028794 Ga0307515_10001761 Ga0307515_1000176142 209
15 3300031730 Ga0307516_10008674 Ga0307516_100086746 209
16 3300041441 Ga0451787_091873 Ga0451787_091873_282_944 209
17 3300041512 Ga0451853_0711155 Ga0451853_0711155_60_722 209
18 3300046515 Ga0495620_0042916 Ga0495620_0042916_235_897 209
19 3300046519 Ga0495632_0070299 Ga0495632_0070299_310_972 209
20 3300046660 Ga0495625_0019559 Ga0495625_0019559_2944_3606 209
21 3300050493 nmdc:mga0k408_215824_c1 nmdc:mga0k408_215824_c1_242_919 209
22 3300050496 nmdc:mga07m45_179936_c1 nmdc:mga07m45_179936_c1_97_774 209
23 3300053134 Ga0500658_0019875 Ga0500658_0019875_12_674 209
24 iso_pu_bacteria 2643221646 2644256888 209
25 3300006353 Ga0075370_10141830 Ga0075370_101418302 210
26 3300017792 Ga0163161_10345040 Ga0163161_103450402 210
27 3300028794 Ga0307515_10016911 Ga0307515_100169116 210
28 3300031548 Ga0307408_100658781 Ga0307408_1006587812 210
29 3300031730 Ga0307516_10000952 Ga0307516_1000095213 210
30 3300031911 Ga0307412_10322894 Ga0307412_103228942 210
31 3300037471 Ga0395905_0294763 Ga0395905_0294763_760_1416 210
32 3300042876 Ga0451577_0015259 Ga0451577_0015259_1685_2335 210
33 3300044656 Ga0466969_0032988 Ga0466969_0032988_153_794 210
34 3300044683 Ga0466965_0002514 Ga0466965_0002514_2350_2991 210
35 3300044684 Ga0466966_0001809 Ga0466966_0001809_6265_6906 210
36 3300044694 Ga0466963_0035158 Ga0466963_0035158_559_1200 210
37 3300044706 Ga0466964_0002118 Ga0466964_0002118_2472_3113 210
38 3300044735 Ga0466968_0082383 Ga0466968_0082383_600_1241 210
39 3300044765 Ga0466970_0069504 Ga0466970_0069504_580_1221 210
40 3300044842 Ga0466957_0023920 Ga0466957_0023920_2580_3221 210
41 3300044842 Ga0466957_0397127 Ga0466957_0397127_10_648 210
42 3300045049 Ga0466959_0013986 Ga0466959_0013986_3858_4499 210
43 3300045836 Ga0466958_0048471 Ga0466958_0048471_1418_2059 210
44 3300048916 Ga0496113_0112344 Ga0496113_0112344_583_1230 210
45 3300061719 Ga0466962_0004378 Ga0466962_0004378_1318_1959 210
46 iso_pu_bacteria 2643221585 2643933897 210
47 iso_pu_bacteria 2643221654 2644303519 210
48 iso_pu_bacteria 2643221656 2644315384 210
49 iso_pu_bacteria 2738541337 2739054938 210
50 3300005457 Ga0070662_100004754 Ga0070662_1000047546 211
51 3300025933 Ga0207706_10009005 Ga0207706_100090057 211
52 3300031548 Ga0307408_100166064 Ga0307408_1001660642 211
53 3300031901 Ga0307406_10126366 Ga0307406_101263662 211
54 3300031911 Ga0307412_10277626 Ga0307412_102776262 211
55 3300032002 Ga0307416_100431816 Ga0307416_1004318162 211
56 3300032002 Ga0307416_101016924 Ga0307416_1010169242 211
57 3300037466 Ga0395898_0002912 Ga0395898_0002912_8454_9095 211
58 3300042012 Ga0439455_0012859 Ga0439455_0012859_137_778 211
59 3300044658 Ga0466972_0000934 Ga0466972_0000934_12688_13326 211
60 3300044901 Ga0466960_0069154 Ga0466960_0069154_926_1564 211
61 3300048927 Ga0496124_0003412 Ga0496124_0003412_10874_11512 211
62 3300048928 Ga0496125_0006401 Ga0496125_0006401_1309_1947 211
63 3300003320 rootH2_10235263 rootH2_102352632 212
64 3300003322 rootL2_10052786 rootL2_100527863 212
65 3300003323 rootH1_10179877 rootH1_101798771 212
66 3300005295 Ga0065707_10083353 Ga0065707_100833537 212
67 3300005617 Ga0068859_100042793 Ga0068859_1000427933 212
68 3300005618 Ga0068864_100822770 Ga0068864_1008227702 212
69 3300005718 Ga0068866_10002740 Ga0068866_100027407 212
70 3300005719 Ga0068861_100005508 Ga0068861_1000055085 212
71 3300005842 Ga0068858_100462613 Ga0068858_1004626132 212
72 3300005843 Ga0068860_100017835 Ga0068860_1000178355 212
73 3300005843 Ga0068860_100184019 Ga0068860_1001840192 212
74 3300006195 Ga0075366_10068193 Ga0075366_100681934 212
75 3300006844 Ga0075428_100590104 Ga0075428_1005901042 212
76 3300006931 Ga0097620_100042793 Ga0097620_1000427933 212
77 3300009148 Ga0105243_10236437 Ga0105243_102364372 212
78 3300009553 Ga0105249_10017892 Ga0105249_100178925 212
79 3300013297 Ga0157378_10003330 Ga0157378_100033304 212
80 3300013306 Ga0163162_10005003 Ga0163162_100050037 212
81 3300013308 Ga0157375_10062210 Ga0157375_100622104 212
82 3300014325 Ga0163163_10796540 Ga0163163_107965402 212
83 3300014326 Ga0157380_10061404 Ga0157380_100614044 212
84 3300014968 Ga0157379_10029042 Ga0157379_100290425 212
85 3300014968 Ga0157379_10154964 Ga0157379_101549643 212
86 3300025923 Ga0207681_10075448 Ga0207681_100754484 212
87 3300025935 Ga0207709_10137305 Ga0207709_101373052 212
88 3300025937 Ga0207669_10008918 Ga0207669_100089186 212
89 3300025938 Ga0207704_10003481 Ga0207704_100034816 212
90 3300025940 Ga0207691_10044864 Ga0207691_100448643 212
91 3300025961 Ga0207712_10165533 Ga0207712_101655331 212
92 3300026041 Ga0207639_10244495 Ga0207639_102444952 212
93 3300026075 Ga0207708_10013014 Ga0207708_100130145 212
94 3300026089 Ga0207648_10000419 Ga0207648_1000041933 212
95 3300026095 Ga0207676_10413807 Ga0207676_104138071 212
96 3300026118 Ga0207675_100000693 Ga0207675_10000069311 212
97 3300026142 Ga0207698_10253516 Ga0207698_102535161 212
98 3300028381 Ga0268264_10039249 Ga0268264_100392492 212
99 3300028786 Ga0307517_10108410 Ga0307517_101084102 212
100 3300028794 Ga0307515_10000911 Ga0307515_1000091115 212
101 3300028794 Ga0307515_10006828 Ga0307515_1000682812 212
102 3300028794 Ga0307515_10026981 Ga0307515_100269818 212
103 3300030522 Ga0307512_10025838 Ga0307512_100258383 212
104 3300031548 Ga0307408_100000012 Ga0307408_100000012360 212
105 3300031616 Ga0307508_10000440 Ga0307508_1000044011 212
106 3300031649 Ga0307514_10002593 Ga0307514_1000259316 212
107 3300031730 Ga0307516_10000614 Ga0307516_1000061416 212
108 3300033179 Ga0307507_10026762 Ga0307507_100267622 212
109 3300035083 Ga0373926_0157599 Ga0373926_0157599_88_729 212
110 3300035088 Ga0373940_0074775 Ga0373940_0074775_289_933 212
111 3300035089 Ga0373944_0026454 Ga0373944_0026454_552_1193 212
112 3300035114 Ga0373939_0000081 Ga0373939_0000081_28991_29635 212
113 3300035121 Ga0373960_0008035 Ga0373960_0008035_1250_1894 212
114 3300035241 Ga0373961_0014629 Ga0373961_0014629_1258_1902 212
115 3300035691 Ga0373931_0022461 Ga0373931_0022461_1305_1949 212
116 3300035695 Ga0373927_0051260 Ga0373927_0051260_64_705 212
117 3300037068 Ga0373925_0046026 Ga0373925_0046026_907_1548 212
118 3300044712 Ga0453684_0020398 Ga0453684_0020398_1319_1966 212
119 3300045051 Ga0451576_0081080 Ga0451576_0081080_1475_2122 212
120 3300046473 Ga0495582_0145836 Ga0495582_0145836_257_898 212
121 3300046683 Ga0495658_0014662 Ga0495658_0014662_1051_1692 212
122 3300049658 Ga0501211_000031 Ga0501211_000031_1163_1804 212
123 3300050496 nmdc:mga07m45_116788_c1 nmdc:mga07m45_116788_c1_462_1106 212
124 3300053158 Ga0500627_0039830 Ga0500627_0039830_865_1563 212
125 iso_pu_bacteria 2585428062 2587758956 214
126 3300046460 Ga0495638_0065746 Ga0495638_0065746_19_669 215
127 3300049571 Ga0501034_0167463 Ga0501034_0167463_1285_1950 215
128 3300006846 Ga0075430_100217068 Ga0075430_1002170681 216
129 3300006880 Ga0075429_100006177 Ga0075429_1000061773 216
130 3300006880 Ga0075429_100335573 Ga0075429_1003355731 216
131 3300009553 Ga0105249_10199094 Ga0105249_101990943 216
132 3300033180 Ga0307510_10001950 Ga0307510_100019509 216
133 3300050508 nmdc:mga09592_1109_c1 nmdc:mga09592_1109_c1_7374_8036 216
134 3300050509 nmdc:mga0qj67_199487_c1 nmdc:mga0qj67_199487_c1_44_706 216
135 3300027876 Ga0209974_10002440 Ga0209974_100024406 217
136 3300031456 Ga0307513_10015681 Ga0307513_100156815 217
137 3300031649 Ga0307514_10000200 Ga0307514_10000200104 217
138 3300031852 Ga0307410_10210010 Ga0307410_102100102 217
139 3300032005 Ga0307411_10212681 Ga0307411_102126811 217
140 3300048905 Ga0496102_0027006 Ga0496102_0027006_1445_2107 217
141 3300003320 rootH2_10223726 rootH2_102237262 219
142 3300005445 Ga0070708_100089294 Ga0070708_1000892942 219
143 3300006237 Ga0097621_100046439 Ga0097621_1000464394 219
144 3300009147 Ga0114129_10084121 Ga0114129_100841214 219
145 3300009545 Ga0105237_10113055 Ga0105237_101130553 219
146 3300025935 Ga0207709_10176209 Ga0207709_101762092 219
147 3300028786 Ga0307517_10008875 Ga0307517_100088759 219
148 3300028786 Ga0307517_10050520 Ga0307517_100505205 219
149 3300028786 Ga0307517_10145490 Ga0307517_101454901 219
150 3300028794 Ga0307515_10007106 Ga0307515_1000710622 219
151 3300028794 Ga0307515_10095814 Ga0307515_100958141 219
152 3300031507 Ga0307509_10012181 Ga0307509_100121815 219
153 3300031507 Ga0307509_10163333 Ga0307509_101633331 219
154 3300031616 Ga0307508_10000690 Ga0307508_1000069024 219
155 3300031616 Ga0307508_10035330 Ga0307508_100353302 219
156 3300031616 Ga0307508_10049882 Ga0307508_100498824 219
157 3300031649 Ga0307514_10042646 Ga0307514_100426462 219
158 3300031838 Ga0307518_10279686 Ga0307518_102796862 219
159 3300033179 Ga0307507_10083848 Ga0307507_100838482 219
160 3300033179 Ga0307507_10150752 Ga0307507_101507522 219
161 3300046524 Ga0495648_0154786 Ga0495648_0154786_140_811 219
162 3300046524 Ga0495648_0162480 Ga0495648_0162480_43_717 219
163 3300046648 Ga0495611_0268785 Ga0495611_0268785_57_731 219
164 3300049682 Ga0501252_001210 Ga0501252_001210_854_1519 219
165 3300050507 nmdc:mga05p37_190020_c1 nmdc:mga05p37_190020_c1_684_1355 219
166 3300053098 Ga0500650_0180016 Ga0500650_0180016_59_733 219
167 3300005331 Ga0070670_100230649 Ga0070670_1002306492 220
168 3300005338 Ga0068868_100031177 Ga0068868_1000311772 220
169 3300005353 Ga0070669_100348215 Ga0070669_1003482152 220
170 3300005355 Ga0070671_100310246 Ga0070671_1003102462 220
171 3300005456 Ga0070678_100378622 Ga0070678_1003786222 220
172 3300005466 Ga0070685_10493818 Ga0070685_104938182 220
173 3300005548 Ga0070665_100194241 Ga0070665_1001942412 220
174 3300005617 Ga0068859_100031012 Ga0068859_1000310122 220
175 3300005618 Ga0068864_100130849 Ga0068864_1001308492 220
176 3300005841 Ga0068863_100209499 Ga0068863_1002094992 220
177 3300006358 Ga0068871_100325890 Ga0068871_1003258902 220
178 3300006931 Ga0097620_100031012 Ga0097620_1000310122 220
179 3300014968 Ga0157379_10071065 Ga0157379_100710653 220
180 3300025925 Ga0207650_10100712 Ga0207650_101007124 220
181 3300025927 Ga0207687_10198089 Ga0207687_101980892 220
182 3300025931 Ga0207644_10019344 Ga0207644_100193445 220
183 3300025941 Ga0207711_10489527 Ga0207711_104895272 220
184 3300025986 Ga0207658_10223944 Ga0207658_102239442 220
185 3300026023 Ga0207677_10588741 Ga0207677_105887412 220
186 3300026088 Ga0207641_10135494 Ga0207641_101354943 220
187 3300026095 Ga0207676_10180200 Ga0207676_101802002 220
188 3300026121 Ga0207683_10306558 Ga0207683_103065582 220
189 3300026121 Ga0207683_10524930 Ga0207683_105249302 220
190 3300028379 Ga0268266_10087101 Ga0268266_100871014 220
191 3300028786 Ga0307517_10205283 Ga0307517_102052832 220
192 3300030522 Ga0307512_10014540 Ga0307512_100145405 220
193 3300031507 Ga0307509_10000405 Ga0307509_1000040535 220
194 3300031649 Ga0307514_10095935 Ga0307514_100959353 220
195 3300031730 Ga0307516_10001028 Ga0307516_1000102838 220
196 3300033180 Ga0307510_10012041 Ga0307510_100120418 220
197 3300033180 Ga0307510_10092760 Ga0307510_100927602 220
198 3300034957 Ga0373938_0049104 Ga0373938_0049104_173_847 220
199 3300035114 Ga0373939_0013863 Ga0373939_0013863_629_1303 220
200 3300046454 Ga0495592_0000182 Ga0495592_0000182_40999_41673 220
201 3300046512 Ga0495610_0059610 Ga0495610_0059610_858_1532 220
202 3300046519 Ga0495632_0072848 Ga0495632_0072848_424_1098 220
203 3300046616 Ga0495668_0081790 Ga0495668_0081790_430_1116 220
204 3300046680 Ga0495646_0040113 Ga0495646_0040113_476_1150 220
205 3300046692 Ga0495671_0036716 Ga0495671_0036716_624_1310 220
206 3300048088 Ga0495602_0223374 Ga0495602_0223374_147_821 220
207 3300053088 Ga0500644_0005185 Ga0500644_0005185_381_1055 220
208 3300053093 Ga0500651_0018731 Ga0500651_0018731_2052_2726 220
209 3300053118 Ga0500594_0010529 Ga0500594_0010529_565_1239 220
210 3300053136 Ga0500559_0001012 Ga0500559_0001012_15403_16077 220
211 3300053136 Ga0500559_0111546 Ga0500559_0111546_34_708 220
212 3300053139 Ga0500568_0071560 Ga0500568_0071560_495_1169 220
213 3300053151 Ga0500604_0048749 Ga0500604_0048749_490_1164 220
214 3300053154 Ga0500619_050704 Ga0500619_050704_241_915 220
215 3300053156 Ga0500622_0001901 Ga0500622_0001901_10683_11357 220
216 3300053739 Ga0500587_008683 Ga0500587_008683_479_1153 220
217 3300005328 Ga0070676_10018515 Ga0070676_100185152 221
218 3300005328 Ga0070676_10349062 Ga0070676_103490622 221
219 3300005331 Ga0070670_100102567 Ga0070670_1001025674 221
220 3300005334 Ga0068869_100236078 Ga0068869_1002360782 221
221 3300005338 Ga0068868_100017165 Ga0068868_1000171655 221
222 3300005364 Ga0070673_100015282 Ga0070673_1000152824 221
223 3300005367 Ga0070667_100029834 Ga0070667_1000298342 221
224 3300005367 Ga0070667_100120604 Ga0070667_1001206044 221
225 3300005456 Ga0070678_100648194 Ga0070678_1006481942 221
226 3300005457 Ga0070662_100174200 Ga0070662_1001742002 221
227 3300005459 Ga0068867_100017339 Ga0068867_1000173394 221
228 3300005459 Ga0068867_100204678 Ga0068867_1002046782 221
229 3300005459 Ga0068867_100588599 Ga0068867_1005885992 221
230 3300005467 Ga0070706_100000367 Ga0070706_10000036742 221
231 3300005468 Ga0070707_100146807 Ga0070707_1001468072 221
232 3300005471 Ga0070698_100292231 Ga0070698_1002922312 221
233 3300005543 Ga0070672_100050004 Ga0070672_1000500044 221
234 3300005577 Ga0068857_100021329 Ga0068857_1000213295 221
235 3300005577 Ga0068857_100189136 Ga0068857_1001891362 221
236 3300005577 Ga0068857_100867220 Ga0068857_1008672201 221
237 3300005616 Ga0068852_100019388 Ga0068852_1000193885 221
238 3300005719 Ga0068861_100611508 Ga0068861_1006115082 221
239 3300005840 Ga0068870_10012553 Ga0068870_100125533 221
240 3300005843 Ga0068860_101031537 Ga0068860_1010315371 221
241 3300006038 Ga0075365_10215950 Ga0075365_102159502 221
242 3300006051 Ga0075364_10126319 Ga0075364_101263192 221
243 3300006177 Ga0075362_10005056 Ga0075362_100050563 221
244 3300006178 Ga0075367_10002445 Ga0075367_100024453 221
245 3300006178 Ga0075367_10040266 Ga0075367_100402664 221
246 3300006178 Ga0075367_10136325 Ga0075367_101363252 221
247 3300006186 Ga0075369_10233721 Ga0075369_102337212 221
248 3300006195 Ga0075366_10007983 Ga0075366_100079837 221
249 3300006195 Ga0075366_10009192 Ga0075366_100091923 221
250 3300006195 Ga0075366_10042296 Ga0075366_100422964 221
251 3300006195 Ga0075366_10127628 Ga0075366_101276282 221
252 3300006353 Ga0075370_10000151 Ga0075370_100001512 221
253 3300006353 Ga0075370_10002757 Ga0075370_100027574 221
254 3300006353 Ga0075370_10014810 Ga0075370_100148103 221
255 3300006353 Ga0075370_10015123 Ga0075370_100151232 221
256 3300006353 Ga0075370_10028618 Ga0075370_100286183 221
257 3300009093 Ga0105240_10116351 Ga0105240_101163512 221
258 3300009098 Ga0105245_10606084 Ga0105245_106060842 221
259 3300009148 Ga0105243_10129404 Ga0105243_101294042 221
260 3300009551 Ga0105238_10412082 Ga0105238_104120822 221
261 3300011119 Ga0105246_10139724 Ga0105246_101397242 221
262 3300013297 Ga0157378_10704692 Ga0157378_107046922 221
263 3300013308 Ga0157375_10109167 Ga0157375_101091672 221
264 3300025907 Ga0207645_10016510 Ga0207645_100165102 221
265 3300025910 Ga0207684_10005313 Ga0207684_1000531311 221
266 3300025913 Ga0207695_10089435 Ga0207695_100894353 221
267 3300025922 Ga0207646_10085399 Ga0207646_100853994 221
268 3300025927 Ga0207687_10081914 Ga0207687_100819144 221
269 3300025933 Ga0207706_10069730 Ga0207706_100697302 221
270 3300025933 Ga0207706_10110351 Ga0207706_101103513 221
271 3300025935 Ga0207709_10099871 Ga0207709_100998712 221
272 3300025942 Ga0207689_10011087 Ga0207689_100110873 221
273 3300025960 Ga0207651_10028684 Ga0207651_100286844 221
274 3300025961 Ga0207712_10390438 Ga0207712_103904381 221
275 3300025981 Ga0207640_10238364 Ga0207640_102383642 221
276 3300026023 Ga0207677_10011356 Ga0207677_100113562 221
277 3300026041 Ga0207639_10554606 Ga0207639_105546062 221
278 3300026067 Ga0207678_10009464 Ga0207678_100094644 221
279 3300026089 Ga0207648_10008564 Ga0207648_100085644 221
280 3300026089 Ga0207648_10560433 Ga0207648_105604332 221
281 3300026116 Ga0207674_10017608 Ga0207674_100176085 221
282 3300026116 Ga0207674_10067526 Ga0207674_100675262 221
283 3300026116 Ga0207674_10285585 Ga0207674_102855852 221
284 3300026121 Ga0207683_10129327 Ga0207683_101293272 221
285 3300028381 Ga0268264_10618225 Ga0268264_106182251 221
286 3300028794 Ga0307515_10213307 Ga0307515_102133072 221
287 3300031456 Ga0307513_10281459 Ga0307513_102814592 221
288 3300031616 Ga0307508_10025484 Ga0307508_100254845 221
289 3300031730 Ga0307516_10146672 Ga0307516_101466723 221
290 3300046457 Ga0495590_0021045 Ga0495590_0021045_1330_2025 221
291 3300046506 Ga0495583_0043833 Ga0495583_0043833_359_1054 221
292 3300046512 Ga0495610_0088509 Ga0495610_0088509_179_874 221
293 3300046528 Ga0495642_0115916 Ga0495642_0115916_262_957 221
294 3300046542 Ga0495597_0008859 Ga0495597_0008859_1442_2137 221
295 3300046542 Ga0495597_0131186 Ga0495597_0131186_168_863 221
296 3300046660 Ga0495625_0010408 Ga0495625_0010408_3194_3889 221
297 3300046694 Ga0495649_0001813 Ga0495649_0001813_7961_8656 221
298 3300046794 Ga0495589_0072897 Ga0495589_0072897_815_1510 221
299 3300047443 Ga0495687_000454 Ga0495687_000454_40372_41067 221
300 3300047443 Ga0495687_027085 Ga0495687_027085_1185_1880 221
301 3300047472 Ga0495686_0333718 Ga0495686_0333718_106_801 221
302 3300050489 nmdc:mga03683_17300_c1 nmdc:mga03683_17300_c1_393_1088 221
303 3300050491 nmdc:mga00v17_84823_c1 nmdc:mga00v17_84823_c1_767_1462 221
304 3300050492 nmdc:mga0yw44_46296_c1 nmdc:mga0yw44_46296_c1_1089_1784 221
305 3300050493 nmdc:mga0k408_10283_c1 nmdc:mga0k408_10283_c1_2981_3682 221
306 3300050493 nmdc:mga0k408_15354_c1 nmdc:mga0k408_15354_c1_3261_3956 221
307 3300050493 nmdc:mga0k408_4653_c1 nmdc:mga0k408_4653_c1_5903_6598 221
308 3300050494 nmdc:mga06z11_105478_c1 nmdc:mga06z11_105478_c1_749_1444 221
309 3300050494 nmdc:mga06z11_156609_c1 nmdc:mga06z11_156609_c1_150_851 221
310 3300050494 nmdc:mga06z11_57191_c1 nmdc:mga06z11_57191_c1_136_831 221
311 3300050496 nmdc:mga07m45_109397_c1 nmdc:mga07m45_109397_c1_29_730 221
312 3300050496 nmdc:mga07m45_3277_c1 nmdc:mga07m45_3277_c1_1980_2675 221
313 3300050496 nmdc:mga07m45_38869_c1 nmdc:mga07m45_38869_c1_1446_2141 221
314 3300050496 nmdc:mga07m45_468_c1 nmdc:mga07m45_468_c1_16155_16847 221
315 3300050496 nmdc:mga07m45_494_c1 nmdc:mga07m45_494_c1_5445_6140 221
316 3300050496 nmdc:mga07m45_5219_c1 nmdc:mga07m45_5219_c1_2834_3529 221
317 3300053134 Ga0500658_0001951 Ga0500658_0001951_1155_1850 221
318 3300053139 Ga0500568_0007658 Ga0500568_0007658_1353_2048 221
319 iso_pu_bacteria 2831864461 2831870312 221
320 iso_pu_bacteria 2886848708 2886849025 221
321 3300003792 Ga0055540_1000090 Ga0055540_100009079 222
322 3300003792 Ga0055540_1000091 Ga0055540_100009177 222
323 3300003794 Ga0055531_10014159 Ga0055531_100141592 222
324 3300005367 Ga0070667_100000344 Ga0070667_10000034420 222
325 3300006358 Ga0068871_100438469 Ga0068871_1004384692 222
326 3300006946 Ga0079104_1000916 Ga0079104_10009168 222
327 3300013308 Ga0157375_10223126 Ga0157375_102231263 222
328 3300025298 Ga0209050_1000326 Ga0209050_100032611 222
329 3300025298 Ga0209050_1000967 Ga0209050_100096720 222
330 3300025299 Ga0209256_1000019 Ga0209256_1000019457 222
331 3300025303 Ga0209051_1000133 Ga0209051_100013380 222
332 3300025304 Ga0209257_1000038 Ga0209257_100003880 222
333 3300025938 Ga0207704_10344523 Ga0207704_103445232 222
334 3300025986 Ga0207658_10217401 Ga0207658_102174012 222
335 3300027111 Ga0209281_1000935 Ga0209281_100093518 222
336 3300037068 Ga0373925_0014382 Ga0373925_0014382_2654_3343 222
337 3300048917 Ga0496114_0006581 Ga0496114_0006581_2001_2678 222
338 3300048917 Ga0496114_0657996 Ga0496114_0657996_107_784 222
339 3300050493 nmdc:mga0k408_30264_c1 nmdc:mga0k408_30264_c1_1887_2579 222
340 3300026023 Ga0207677_10765658 Ga0207677_107656581 223
341 3300031507 Ga0307509_10354203 Ga0307509_103542032 223
342 3300004625 Ga0055543_1017733 Ga0055543_10177331 224
343 3300005262 Ga0065165_1000462 Ga0065165_100046216 224
344 3300005339 Ga0070660_100323289 Ga0070660_1003232892 224
345 3300005364 Ga0070673_100100385 Ga0070673_1001003852 224
346 3300005616 Ga0068852_100398429 Ga0068852_1003984292 224
347 3300010375 Ga0105239_10909072 Ga0105239_109090722 224
348 3300013296 Ga0157374_10263635 Ga0157374_102636352 224
349 3300025230 Ga0209563_108879 Ga0209563_1088792 224
350 3300025256 Ga0209759_1002570 Ga0209759_10025706 224
351 3300025909 Ga0207705_10025142 Ga0207705_100251425 224
352 3300025919 Ga0207657_10034351 Ga0207657_100343514 224
353 3300025932 Ga0207690_10096078 Ga0207690_100960783 224
354 3300025949 Ga0207667_10141801 Ga0207667_101418012 224
355 3300025949 Ga0207667_10376540 Ga0207667_103765403 224
356 3300025960 Ga0207651_10030702 Ga0207651_100307024 224
357 3300031730 Ga0307516_10004145 Ga0307516_1000414515 224
358 3300032002 Ga0307416_100118853 Ga0307416_1001188532 224
359 3300032005 Ga0307411_10115421 Ga0307411_101154212 224
360 3300046462 Ga0495651_0383626 Ga0495651_0383626_88_783 224
361 3300046471 Ga0495650_0053197 Ga0495650_0053197_615_1310 224
362 3300048909 Ga0496106_0445563 Ga0496106_0445563_289_984 224
363 3300053117 Ga0500593_000267 Ga0500593_000267_6429_7109 224
364 3300053136 Ga0500559_0002928 Ga0500559_0002928_7658_8353 224
365 3300003316 rootH1_10012341 rootH1_100123414 225
366 3300003322 rootL2_10000529 rootL2_1000052921 225
367 3300003323 rootH1_10031455 rootH1_100314554 225
368 3300003323 rootH1_10034938 rootH1_100349384 225
369 3300003771 Ga0055526_1045870 Ga0055526_10458701 225
370 3300003775 Ga0055524_1000563 Ga0055524_10005633 225
371 3300003775 Ga0055524_1001509 Ga0055524_100150910 225
372 3300003794 Ga0055531_10001723 Ga0055531_1000172311 225
373 3300003794 Ga0055531_10016188 Ga0055531_100161883 225
374 3300004625 Ga0055543_1003885 Ga0055543_10038854 225
375 3300005262 Ga0065165_1000275 Ga0065165_100027538 225
376 3300005564 Ga0070664_100521432 Ga0070664_1005214322 225
377 3300006195 Ga0075366_10013107 Ga0075366_100131073 225
378 3300006353 Ga0075370_10014469 Ga0075370_100144692 225
379 3300006942 Ga0099824_1043087 Ga0099824_10430871 225
380 3300006944 Ga0099823_1000063 Ga0099823_100006337 225
381 3300009093 Ga0105240_11007991 Ga0105240_110079911 225
382 3300012475 Ga0157317_1000847 Ga0157317_10008472 225
383 3300012497 Ga0157319_1000020 Ga0157319_100002047 225
384 3300025273 Ga0209673_1008924 Ga0209673_10089244 225
385 3300025273 Ga0209673_1014804 Ga0209673_10148043 225
386 3300025295 Ga0209564_1000131 Ga0209564_100013139 225
387 3300025298 Ga0209050_1012676 Ga0209050_10126763 225
388 3300025299 Ga0209256_1000416 Ga0209256_100041635 225
389 3300025299 Ga0209256_1000913 Ga0209256_100091324 225
390 3300025303 Ga0209051_1000925 Ga0209051_100092524 225
391 3300025304 Ga0209257_1000444 Ga0209257_100044435 225
392 3300025304 Ga0209257_1000519 Ga0209257_100051935 225
393 3300025913 Ga0207695_10685395 Ga0207695_106853952 225
394 3300027296 Ga0209389_1001755 Ga0209389_10017557 225
395 3300027312 Ga0209371_1007462 Ga0209371_10074622 225
396 3300028794 Ga0307515_10048525 Ga0307515_100485254 225
397 3300031456 Ga0307513_10049401 Ga0307513_100494015 225
398 3300031548 Ga0307408_100060574 Ga0307408_1000605743 225
399 3300032004 Ga0307414_10203251 Ga0307414_102032512 225
400 3300042127 Ga0450890_006164 Ga0450890_006164_109_786 225
401 3300042438 Ga0439459_0010443 Ga0439459_0010443_926_1603 225
402 3300044694 Ga0466963_0094697 Ga0466963_0094697_346_1023 225
403 3300046692 Ga0495671_0104723 Ga0495671_0104723_534_1232 225
404 3300048905 Ga0496102_0042876 Ga0496102_0042876_870_1556 225
405 3300048927 Ga0496124_0009779 Ga0496124_0009779_4027_4704 225
406 3300050493 nmdc:mga0k408_205812_c1 nmdc:mga0k408_205812_c1_245_922 225
407 3300053156 Ga0500622_0005145 Ga0500622_0005145_2915_3592 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

45

238

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ij5-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase from <i>hydrogenobacter thermophilus</i> tk-6 0.9418 4 208
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.9398 4 204
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.9266 4 204
1ebb-assembly1.cif.gz_A bacillus stearothermophilus yhfr 0.9264 4 202
6e4b-assembly2.cif.gz_C the crystal structure of a putative alpha-ribazole-5'-p phosphatase from escherichia coli str. k-12 substr. mg1655 0.914 4 198
ID Description Score Start End Superfamily
af_F4KI56_14_225_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9425 2 204 3.40.50.1240
4ij6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9398 4 204 3.40.50.1240
af_P9WLH5_165_364_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9312 5 202 3.40.50.1240
4ij6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9266 4 204 3.40.50.1240
1ebbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9264 4 202 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A502DUA0-F1-model_v4 Histidine phosphatase family protein 0.9984 3 202 GO:0005737
GO:0016791
AF-A0A1Y2Q6V6-F1-model_v4 Histidine phosphatase family protein 0.9937 2 202 GO:0004331
GO:0005829
GO:0043456
GO:0045820
AF-A0A8B2U5T9-F1-model_v4 deleted 0.9929 3 202
AF-A0A316F3V4-F1-model_v4 Phosphoglycerate mutase 0.9906 3 205 GO:0005737
GO:0016791
GO:0046537
AF-A0A1G6LPE2-F1-model_v4 Phosphoglycerate mutase 0.9899 2 205 GO:0005737
GO:0016791

Feature Viewer

pLDDT pTM Quality
91.25 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map