F436601

General Info

Members Datasets Scaffolds Average Seq Length
407 284 814 436

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2831864461|2831865648
Length 414
Sequence LYKGTIGPDVIDIRKLYAQTGKFTYDPGFLSTASCNSTITYIDGDKGELLYRGYPIEQLATNCDYLETCYLLLYGELPSPSQKEEFVNRVTNHTMVNEQMQFFLRGFRRDAHPMAVMTGLVGALSAFYHDSTDINNPEHREIAAIRLIAKMPTLVAMAYKYTIGQPYIYPKNDLSYAGNFMRMMFATPCEEYKPNDVLVRAMDRIFTLHADHEQNASTSTVRLCGSSGTNPFAAIAAGVACLWGPAHGGANEACLNMLNDIQQMGGVAKIGEFIKQVKDKNSNVKLMGFGHRVYKNYDPRAKLMRETCHEVLNELGLHDDPLFKLAMELEKIALEDEYFVARKLYPNVDFYSGIVQRAIGIPVPLFTAIFALARTVGWIAQLNEMIGDPEYKIGRPRQLFVGATPRNVTPIAQR

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
58 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
136 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
177 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
178 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
179 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
188 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
189 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
190 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
191 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
192 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
205 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
245 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
246 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
247 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
248 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
249 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
250 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
251 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
252 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
253 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
254 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
255 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
256 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
260 2831864461 Roseateles noduli HZ7 Isolate Nodule
261 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
262 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
263 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
264 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
265 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
266 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
267 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
268 2738541297 Duganella sp. GV083 Isolate Unclassified
269 2738541357 Duganella sp. GV053 Isolate Unclassified
270 2738543003 Duganella sp. GV066 Isolate Unclassified
271 2738543026 Duganella sp. GV089 Isolate Unclassified
272 2738543029 Duganella sp. GV039 Isolate Unclassified
273 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
274 2842711865 Duganella sp. R-73148 Isolate Unclassified
275 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
276 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
277 2857564685 Duganella sp. R-74599 Isolate Unclassified
278 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
279 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
280 2904424332 Duganella sp. 1411 Isolate Rhizosphere
281 2919476304 Duganella sp. 3397 Isolate Unclassified
282 2932401849 Devosia sp. 2618 Isolate Rhizosphere
283 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
284 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.61
Metatranscriptomes 0.25
Isolates 6.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.5
Nodule 1.23
Rhizoplane 1.97
Rhizosphere 75.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000011 3300001904 Bacteria 34573
2 JGI24752J21851_1000112 3300001976 Bacteria 10993
3 JGI24740J21852_10002751 3300001979 Bacteria 7865
4 JGI24739J22299_10006088 3300001989 Bacteria 4559
5 JGI24737J22298_10011408 3300001990 Bacteria 2912
6 JGI24735J21928_10001554 3300002067 Bacteria 8133
7 JGI24750J21931_1000644 3300002070 Bacteria 5214
8 JGI24748J21848_1000056 3300002074 Bacteria 46790
9 JGI24738J21930_10002898 3300002075 Bacteria 4391
10 JGI24738J21930_10003429 3300002075 Bacteria 4000
11 JGI24034J26672_10000019 3300002239 Bacteria 125073
12 JGI24751J29686_10001524 3300002459 Bacteria 4808
13 JGI25159J45721_1002651 3300002987 Bacteria 6666
14 JGI25159J45721_1011594 3300002987 Bacteria 2149
15 JGI25151J46595_10000330 3300003187 Bacteria 51252
16 JGI25153J46596_10000012 3300003215 Bacteria 308056
17 Ga0007410J51695_1019775 3300003574 Bacteria 1736
18 Ga0055525_1000001 3300003759 Bacteria 1016948
19 Ga0055529_1000095 3300003763 Bacteria 134030
20 Ga0055526_1003765 3300003771 Bacteria 9466
21 Ga0055526_1004314 3300003771 Bacteria 8592
22 Ga0055526_1015776 3300003771 Bacteria 3009
23 Ga0055537_1001037 3300003773 Bacteria 12494
24 Ga0055524_1001075 3300003775 Bacteria 16780
25 Ga0055524_1005947 3300003775 Bacteria 5368
26 Ga0055534_1001729 3300003784 Bacteria 8261
27 Ga0055528_1000089 3300003790 Bacteria 72690
28 Ga0065165_1003501 3300005262 Bacteria 10918
29 Ga0065707_10093317 3300005295 Bacteria 3644
30 Ga0065707_10129311 3300005295 Bacteria 1950
31 Ga0070690_100000165 3300005330 Bacteria 33565
32 Ga0070670_100000074 3300005331 Bacteria 97530
33 Ga0070666_10000002 3300005335 Bacteria 478684
34 Ga0070666_10054067 3300005335 Bacteria 2709
35 Ga0070660_100101994 3300005339 Bacteria 2274
36 Ga0070689_100001960 3300005340 Bacteria 13349
37 Ga0070661_100099578 3300005344 Bacteria 2160
38 Ga0070668_100010928 3300005347 Bacteria 6755
39 Ga0070668_100021085 3300005347 Bacteria 4925
40 Ga0070669_100000058 3300005353 Bacteria 110162
41 Ga0070669_100000256 3300005353 Bacteria 43745
42 Ga0070674_100033657 3300005356 Bacteria 3414
43 Ga0070673_100011322 3300005364 Bacteria 6083
44 Ga0070688_100001682 3300005365 Bacteria 11043
45 Ga0070659_100042800 3300005366 Bacteria 3541
46 Ga0070659_100082849 3300005366 Bacteria 2563
47 Ga0070667_100000131 3300005367 Bacteria 94986
48 Ga0070667_100008651 3300005367 Bacteria 8436
49 Ga0070667_100018572 3300005367 Bacteria 5768
50 Ga0070714_100019208 3300005435 Bacteria 5563
51 Ga0070697_100183404 3300005536 Bacteria 1775
52 Ga0070686_100000003 3300005544 Bacteria 308397
53 Ga0070665_100000025 3300005548 Bacteria 367488
54 Ga0070665_100000334 3300005548 Bacteria 72297
55 Ga0070665_100002313 3300005548 Bacteria 21152
56 Ga0068859_100000812 3300005617 Bacteria 31775
57 Ga0068859_100004220 3300005617 Bacteria 14662
58 Ga0068859_100006071 3300005617 Bacteria 12265
59 Ga0068864_100000411 3300005618 Bacteria 37180
60 Ga0068864_100003013 3300005618 Bacteria 13924
61 Ga0068861_100005442 3300005719 Bacteria 8619
62 Ga0068861_100007135 3300005719 Bacteria 7650
63 Ga0068851_10005940 3300005834 Bacteria 5556
64 Ga0068863_100000085 3300005841 Bacteria 104154
65 Ga0068863_100059776 3300005841 Bacteria 3606
66 Ga0068858_100014539 3300005842 Bacteria 7416
67 Ga0068860_100000001 3300005843 Bacteria 703043
68 Ga0068860_100000013 3300005843 Bacteria 323055
69 Ga0068860_100013463 3300005843 Bacteria 8020
70 Ga0068862_100000020 3300005844 Bacteria 219516
71 Ga0068862_100000081 3300005844 Bacteria 113133
72 Ga0081538_10008528 3300005981 Bacteria 8685
73 Ga0081540_1019372 3300005983 Bacteria 4139
74 Ga0081539_10011264 3300005985 Bacteria 7107
75 Ga0075362_10019204 3300006177 Bacteria 2840
76 Ga0097621_100153321 3300006237 Bacteria 1976
77 Ga0075428_100162867 3300006844 Bacteria 2420
78 Ga0097620_100000812 3300006931 Bacteria 31775
79 Ga0097620_100004220 3300006931 Bacteria 14662
80 Ga0097620_100006070 3300006931 Bacteria 12265
81 Ga0079104_1006487 3300006946 Bacteria 4415
82 Ga0099826_10000001 3300006948 Bacteria 1155201
83 Ga0099795_10011126 3300007788 Bacteria 2676
84 Ga0105244_10007907 3300009036 Bacteria 6703
85 Ga0105240_10000684 3300009093 Bacteria 62418
86 Ga0105240_10000814 3300009093 Bacteria 56628
87 Ga0111539_10000331 3300009094 Bacteria 57983
88 Ga0114129_10025430 3300009147 Bacteria 8389
89 Ga0105241_10056192 3300009174 Bacteria 3018
90 Ga0105242_10065149 3300009176 Bacteria 3005
91 Ga0105248_10000510 3300009177 Bacteria 44084
92 Ga0105248_10002217 3300009177 Bacteria 21487
93 Ga0105248_10013219 3300009177 Bacteria 9086
94 Ga0105248_10043864 3300009177 Bacteria 5016
95 Ga0105249_10000114 3300009553 Bacteria 108599
96 Ga0105249_10101981 3300009553 Bacteria 2700
97 Ga0105148_101033 3300009978 Bacteria 1991
98 Ga0099796_10002776 3300010159 Bacteria 3930
99 Ga0105239_10181760 3300010375 Bacteria 2353
100 Ga0157369_10018702 3300013105 Bacteria 7768
101 Ga0163162_10095634 3300013306 Bacteria 3058
102 Ga0163162_10202086 3300013306 Bacteria 2116
103 Ga0163163_10043261 3300014325 Bacteria 4415
104 Ga0163163_10050408 3300014325 Bacteria 4099
105 Ga0157380_10000035 3300014326 Bacteria 81910
106 Ga0157379_10043617 3300014968 Bacteria 4005
107 Ga0182006_1000117 3300015261 Bacteria 85963
108 Ga0182005_1000041 3300015265 Bacteria 150123
109 Ga0163161_10000067 3300017792 Bacteria 106359
110 Ga0213872_10000026 3300021361 Bacteria 149852
111 Ga0213872_10002205 3300021361 Bacteria 11672
112 Ga0213872_10005109 3300021361 Bacteria 6808
113 Ga0213876_10000963 3300021384 Bacteria 18949
114 Ga0213875_10000329 3300021388 Bacteria 45094
115 Ga0213875_10006171 3300021388 Bacteria 6323
116 Ga0209436_101177 3300025208 Bacteria 9625
117 Ga0207672_1000441 3300025223 Bacteria 5272
118 Ga0209563_100007 3300025230 Bacteria 1579402
119 Ga0207425_1000001 3300025245 Bacteria 2525432
120 Ga0209026_1002212 3300025250 Bacteria 7510
121 Ga0209677_107941 3300025253 Bacteria 2145
122 Ga0209148_1000465 3300025254 Bacteria 43292
123 Ga0209129_1000001 3300025258 Bacteria 1452436
124 Ga0209565_1000009 3300025263 Bacteria 751701
125 Ga0209565_1001770 3300025263 Bacteria 8775
126 Ga0209455_1000121 3300025272 Bacteria 173350
127 Ga0209455_1002252 3300025272 Bacteria 7583
128 Ga0209673_1000019 3300025273 Bacteria 449094
129 Ga0209130_1000771 3300025284 Bacteria 27646
130 Ga0209130_1003458 3300025284 Bacteria 6683
131 Ga0209675_1000028 3300025291 Bacteria 281253
132 Ga0209675_1001513 3300025291 Bacteria 13295
133 Ga0209025_1000327 3300025294 Bacteria 106055
134 Ga0209564_1000009 3300025295 Bacteria 950196
135 Ga0209564_1000033 3300025295 Bacteria 446200
136 Ga0209564_1000058 3300025295 Bacteria 332955
137 Ga0209564_1002185 3300025295 Bacteria 16412
138 Ga0209758_1000059 3300025297 Bacteria 328458
139 Ga0209758_1000116 3300025297 Bacteria 198356
140 Ga0209758_1005403 3300025297 Bacteria 9869
141 Ga0209050_1020900 3300025298 Bacteria 2413
142 Ga0209256_1000005 3300025299 Bacteria 1315082
143 Ga0209256_1000052 3300025299 Bacteria 299374
144 Ga0207426_1000080 3300025302 Bacteria 304917
145 Ga0207426_1002443 3300025302 Bacteria 11859
146 Ga0209257_1000107 3300025304 Bacteria 240937
147 Ga0209257_1001001 3300025304 Bacteria 38273
148 Ga0207655_1008330 3300025728 Bacteria 6596
149 Ga0207655_1011670 3300025728 Bacteria 5205
150 Ga0207680_10000004 3300025903 Bacteria 827324
151 Ga0207647_10000122 3300025904 Bacteria 60435
152 Ga0207654_10005302 3300025911 Bacteria 6508
153 Ga0207654_10013390 3300025911 Bacteria 4220
154 Ga0207695_10001037 3300025913 Bacteria 48830
155 Ga0207695_10002263 3300025913 Bacteria 28821
156 Ga0207695_10002865 3300025913 Bacteria 25052
157 Ga0207671_10000319 3300025914 Bacteria 70977
158 Ga0207657_10008925 3300025919 Bacteria 10130
159 Ga0207681_10000003 3300025923 Bacteria 713245
160 Ga0207681_10000079 3300025923 Bacteria 87683
161 Ga0207694_10011166 3300025924 Bacteria 6781
162 Ga0207650_10000038 3300025925 Bacteria 206081
163 Ga0207650_10123537 3300025925 Bacteria 2018
164 Ga0207687_10094304 3300025927 Bacteria 2190
165 Ga0207664_10034808 3300025929 Bacteria 3882
166 Ga0207644_10000499 3300025931 Bacteria 25258
167 Ga0207706_10008554 3300025933 Bacteria 9431
168 Ga0207706_10029812 3300025933 Bacteria 4869
169 Ga0207670_10002793 3300025936 Bacteria 9204
170 Ga0207704_10021397 3300025938 Bacteria 3443
171 Ga0207691_10162120 3300025940 Bacteria 1961
172 Ga0207711_10000138 3300025941 Bacteria 77609
173 Ga0207711_10010989 3300025941 Bacteria 7522
174 Ga0207711_10013195 3300025941 Bacteria 6863
175 Ga0207679_10180180 3300025945 Bacteria 1747
176 Ga0207667_10001469 3300025949 Bacteria 29563
177 Ga0207712_10000001 3300025961 Bacteria 750309
178 Ga0207668_10008717 3300025972 Bacteria 6057
179 Ga0207668_10012983 3300025972 Bacteria 5118
180 Ga0207668_10072145 3300025972 Bacteria 2469
181 Ga0207640_10006714 3300025981 Bacteria 6324
182 Ga0207658_10000067 3300025986 Bacteria 116584
183 Ga0207658_10002491 3300025986 Bacteria 13423
184 Ga0207658_10026955 3300025986 Bacteria 4033
185 Ga0207703_10001673 3300026035 Bacteria 19937
186 Ga0207639_10151054 3300026041 Bacteria 1945
187 Ga0207678_10007153 3300026067 Bacteria 9902
188 Ga0207702_10031590 3300026078 Bacteria 4413
189 Ga0207641_10000142 3300026088 Bacteria 102850
190 Ga0207641_10004518 3300026088 Bacteria 12024
191 Ga0207641_10052998 3300026088 Bacteria 3437
192 Ga0207676_10000034 3300026095 Bacteria 206058
193 Ga0207676_10017370 3300026095 Bacteria 5213
194 Ga0207674_10066214 3300026116 Bacteria 3639
195 Ga0207675_100007697 3300026118 Bacteria 10166
196 Ga0207675_100077260 3300026118 Bacteria 3119
197 Ga0207698_10155685 3300026142 Bacteria 1990
198 Ga0209281_1005969 3300027111 Bacteria 3255
199 Ga0209282_1000001 3300027666 Bacteria 2450367
200 Ga0209974_10032035 3300027876 Bacteria 1742
201 Ga0207428_10000208 3300027907 Bacteria 81781
202 Ga0268266_10000028 3300028379 Bacteria 425294
203 Ga0268266_10000103 3300028379 Bacteria 179736
204 Ga0268266_10001922 3300028379 Bacteria 23363
205 Ga0268265_10000030 3300028380 Bacteria 228157
206 Ga0268265_10083662 3300028380 Bacteria 2527
207 Ga0268265_10107314 3300028380 Bacteria 2270
208 Ga0268265_10183980 3300028380 Bacteria 1798
209 Ga0268264_10000006 3300028381 Bacteria 827324
210 Ga0268264_10000039 3300028381 Bacteria 376641
211 Ga0268264_10016743 3300028381 Bacteria 5999
212 Ga0316177_1021517 3300030731 Bacteria 3440
213 Ga0307408_100002829 3300031548 Bacteria 12033
214 Ga0307408_100008901 3300031548 Bacteria 6632
215 Ga0307408_100027345 3300031548 Bacteria 3929
216 Ga0307408_100276920 3300031548 Bacteria 1395
217 Ga0307508_10184298 3300031616 Bacteria 1690
218 Ga0307405_10012457 3300031731 Bacteria 4503
219 Ga0307405_10033131 3300031731 Bacteria 3061
220 Ga0307405_10043035 3300031731 Bacteria 2752
221 Ga0307405_10069404 3300031731 Bacteria 2259
222 Ga0307405_10081261 3300031731 Bacteria 2118
223 Ga0307413_10007373 3300031824 Bacteria 5103
224 Ga0307413_10016849 3300031824 Bacteria 3790
225 Ga0307413_10024797 3300031824 Bacteria 3276
226 Ga0307413_10031966 3300031824 Bacteria 2977
227 Ga0307413_10053660 3300031824 Bacteria 2441
228 Ga0307410_10008406 3300031852 Bacteria 5720
229 Ga0307410_10048165 3300031852 Bacteria 2852
230 Ga0307406_10002370 3300031901 Bacteria 10256
231 Ga0307406_10150917 3300031901 Bacteria 1657
232 Ga0307407_10005753 3300031903 Bacteria 5420
233 Ga0307407_10009966 3300031903 Bacteria 4454
234 Ga0307412_10004282 3300031911 Bacteria 7963
235 Ga0307412_10004810 3300031911 Bacteria 7532
236 Ga0307412_10014130 3300031911 Bacteria 4702
237 Ga0307412_10154454 3300031911 Bacteria 1697
238 Ga0307409_100034055 3300031995 Bacteria 3715
239 Ga0307409_100044452 3300031995 Bacteria 3346
240 Ga0307409_100058361 3300031995 Bacteria 2997
241 Ga0307409_100075488 3300031995 Bacteria 2699
242 Ga0307416_100014264 3300032002 Bacteria 5435
243 Ga0307416_100019992 3300032002 Bacteria 4764
244 Ga0307416_100040828 3300032002 Bacteria 3609
245 Ga0307416_100041208 3300032002 Bacteria 3594
246 Ga0307416_100174170 3300032002 Bacteria 2007
247 Ga0307414_10028503 3300032004 Bacteria 3623
248 Ga0307414_10141627 3300032004 Bacteria 1883
249 Ga0307414_10252343 3300032004 Bacteria 1467
250 Ga0307411_10013682 3300032005 Bacteria 4487
251 Ga0307411_10058977 3300032005 Bacteria 2543
252 Ga0307411_10129872 3300032005 Bacteria 1839
253 Ga0307415_100038727 3300032126 Bacteria 3144
254 Ga0307415_100086869 3300032126 Bacteria 2251
255 Ga0373953_0001354 3300035117 Bacteria 7049
256 Ga0373954_0019569 3300035118 Bacteria 3054
257 Ga0373956_0014537 3300035119 Bacteria 3290
258 Ga0373955_0011501 3300035172 Bacteria 4221
259 Ga0373962_0001843 3300035242 Bacteria 5054
260 Ga0316574_0098175 3300035398 Bacteria 1873
261 Ga0373933_0013122 3300035724 Bacteria 4588
262 Ga0373947_0061793 3300035725 Bacteria 2277
263 Ga0395900_0076684 3300037418 Bacteria 3435
264 Ga0395898_0140722 3300037466 Bacteria 2310
265 Ga0395905_0030939 3300037471 Bacteria 5041
266 Ga0436364_0223731 3300037853 Bacteria 59268
267 Ga0395901_0000217 3300038443 Bacteria 72615
268 Ga0436365_1740297 3300039437 Bacteria 19110
269 Ga0436361_0655565 3300039447 Bacteria 17054
270 Ga0436361_0974268 3300039447 Bacteria 66829
271 Ga0436361_1216357 3300039447 Bacteria 8153
272 Ga0436362_0935205 3300039453 Bacteria 2223
273 Ga0436362_1162131 3300039453 Bacteria 2755
274 Ga0439453_0011064 3300041408 Bacteria 1499
275 Ga0466964_0015333 3300044706 Bacteria 2915
276 Ga0466957_0000259 3300044842 Bacteria 25418
277 Ga0451576_0193422 3300045051 Bacteria 2125
278 Ga0495617_000029 3300046452 Bacteria 153239
279 Ga0495627_000055 3300046453 Bacteria 149482
280 Ga0495590_0009675 3300046457 Bacteria 3655
281 Ga0495591_000240 3300046458 Bacteria 52636
282 Ga0495638_0000091 3300046460 Bacteria 146548
283 Ga0495650_0000844 3300046471 Bacteria 36858
284 Ga0495580_0112616 3300046472 Bacteria 1889
285 Ga0495639_0039192 3300046475 Bacteria 2130
286 Ga0495584_0000680 3300046491 Bacteria 22627
287 Ga0495583_0000549 3300046506 Bacteria 52554
288 Ga0495610_0000003 3300046512 Bacteria 1203910
289 Ga0495610_0007246 3300046512 Bacteria 7432
290 Ga0495632_0031627 3300046519 Bacteria 2733
291 Ga0495637_0000004 3300046520 Bacteria 589740
292 Ga0495648_0004948 3300046524 Bacteria 11199
293 Ga0495663_0017627 3300046525 Bacteria 2028
294 Ga0495642_0000149 3300046528 Bacteria 40735
295 Ga0495654_0000795 3300046530 Bacteria 24293
296 Ga0495640_0072368 3300046533 Bacteria 2310
297 Ga0495597_0005079 3300046542 Bacteria 7026
298 Ga0495667_0019271 3300046559 Bacteria 4604
299 Ga0495668_0000368 3300046616 Bacteria 59517
300 Ga0495668_0002602 3300046616 Bacteria 14617
301 Ga0495668_0002731 3300046616 Bacteria 14134
302 Ga0495623_0006061 3300046679 Bacteria 7858
303 Ga0495671_0000001 3300046692 Bacteria 1169494
304 Ga0495649_0006126 3300046694 Bacteria 7516
305 Ga0495660_0003282 3300046810 Bacteria 10035
306 Ga0495672_0000176 3300047320 Bacteria 92728
307 Ga0495672_0000632 3300047320 Bacteria 39290
308 Ga0495683_0000884 3300047323 Bacteria 21141
309 Ga0495687_000149 3300047443 Bacteria 106301
310 Ga0495679_034223 3300047446 Bacteria 1618
311 Ga0495673_0000024 3300047469 Bacteria 521349
312 Ga0495673_0000049 3300047469 Bacteria 265878
313 Ga0495686_0001510 3300047472 Bacteria 25040
314 Ga0495626_0037901 3300048091 Bacteria 2288
315 Ga0496102_0000463 3300048905 Bacteria 45105
316 Ga0496102_0018026 3300048905 Bacteria 6195
317 Ga0496103_0001502 3300048906 Bacteria 15617
318 Ga0496103_0002220 3300048906 Bacteria 12303
319 Ga0496103_0009590 3300048906 Bacteria 5731
320 Ga0496108_0003442 3300048911 Bacteria 12697
321 Ga0496110_0060662 3300048913 Bacteria 3336
322 Ga0496116_0112248 3300048919 Bacteria 1598
323 Ga0496117_0007623 3300048920 Bacteria 10508
324 Ga0496118_0000677 3300048921 Bacteria 55423
325 Ga0496118_0005853 3300048921 Bacteria 13785
326 Ga0496121_0237210 3300048924 Bacteria 1273
327 Ga0501032_0002142 3300049569 Bacteria 15539
328 Ga0501033_0003493 3300049570 Bacteria 12887
329 Ga0501036_0029442 3300049572 Bacteria 4638
330 Ga0501037_0001900 3300049573 Bacteria 15174
331 Ga0501038_0071051 3300049574 Bacteria 2953
332 Ga0501038_0139400 3300049574 Bacteria 1985
333 Ga0501043_0049604 3300049579 Bacteria 3300
334 Ga0501046_0005555 3300049580 Bacteria 11263
335 Ga0501046_0111515 3300049580 Bacteria 2089
336 Ga0501047_0074526 3300049581 Bacteria 3267
337 Ga0501048_0017671 3300049582 Bacteria 5250
338 Ga0501067_0029543 3300049583 Bacteria 3038
339 Ga0501069_0008711 3300049585 Bacteria 5343
340 Ga0501070_0035421 3300049586 Bacteria 4171
341 Ga0501070_0057680 3300049586 Bacteria 3219
342 Ga0501071_0067198 3300049587 Bacteria 2607
343 Ga0501072_0098077 3300049588 Bacteria 2329
344 Ga0501073_0007054 3300049589 Bacteria 8370
345 Ga0501073_0007219 3300049589 Bacteria 8272
346 Ga0501073_0010631 3300049589 Bacteria 6735
347 Ga0501073_0026449 3300049589 Bacteria 4158
348 Ga0501073_0052746 3300049589 Bacteria 2847
349 Ga0501074_0003572 3300049590 Bacteria 11030
350 Ga0501074_0023209 3300049590 Bacteria 4512
351 Ga0501076_0026594 3300049592 Bacteria 4483
352 Ga0501077_0011126 3300049593 Bacteria 5614
353 Ga0501257_000074 3300049686 Bacteria 25196
354 Ga0501079_0026494 3300049741 Bacteria 4444
355 Ga0501080_0037191 3300049742 Bacteria 4544
356 Ga0501080_0055822 3300049742 Bacteria 3678
357 Ga0501080_0218206 3300049742 Bacteria 1746
358 Ga0501083_0035856 3300049744 Bacteria 3387
359 Ga0501035_0003352 3300049822 Bacteria 15356
360 Ga0501035_0180424 3300049822 Bacteria 1819
361 Ga0501044_0025202 3300049823 Bacteria 6306
362 Ga0501044_0031298 3300049823 Bacteria 5601
363 Ga0501045_0009107 3300049824 Bacteria 6934
364 nmdc:mga08y16_35_c1 3300050511 Bacteria 157578
365 Ga0495601_0028874 3300053077 Bacteria 3438
366 Ga0495619_0041551 3300053085 Bacteria 3008
367 Ga0500641_0003985 3300053096 Bacteria 5220
368 Ga0500555_002362 3300053103 Bacteria 5492
369 Ga0500595_008348 3300053119 Bacteria 4236
370 Ga0500607_001017 3300053121 Bacteria 26626
371 Ga0500642_0007049 3300053130 Bacteria 3749
372 Ga0500590_000341 3300053148 Bacteria 15276
373 Ga0500604_0000445 3300053151 Bacteria 11363
374 Ga0500624_000001 3300053157 Bacteria 284974
375 Ga0500627_0000206 3300053158 Bacteria 17074
376 Ga0500637_0000860 3300053178 Bacteria 12168
377 Ga0500570_000264 3300053724 Bacteria 17893
378 Ga0500645_002852 3300053730 Bacteria 7421
379 Ga0500609_000613 3300053731 Bacteria 5432
380 Ga0501084_0038177 3300054114 Bacteria 4015
381 Ga0501082_0037897 3300060353 Bacteria 4157
382 Ga0530510_0007280 3300061734 Bacteria 7698
383 2831865648 2831864461 Bacteria 6502356
384 2585261891 2582581305 Bacteria 4895574
385 2601667363 2600255292 Bacteria 6300551
386 2643730980 2643221541 Bacteria 5498788
387 2644028902 2643221603 Bacteria 6147767
388 2644040498 2643221605 Bacteria 4772303
389 2644044367 2643221606 Bacteria 5588032
390 2644391709 2643221671 Bacteria 5496681
391 2738829591 2738541297 Bacteria 6549566
392 2739153387 2738541357 Bacteria 6549408
393 2739195307 2738543003 Bacteria 6549560
394 2739321783 2738543026 Bacteria 6549408
395 2739339661 2738543029 Bacteria 6549249
396 2821447879 2821443989 Bacteria 7658172
397 2842714422 2842711865 Bacteria 7155354
398 2844539924 2844533157 Bacteria 7517899
399 2857551913 2857547612 Bacteria 6179999
400 2857565088 2857564685 Bacteria 6290584
401 2883294352 2883291878 Bacteria 5894118
402 2883357125 2883354860 Bacteria 5865246
403 2904426408 2904424332 Bacteria 7633521
404 2919478738 2919476304 Bacteria 5888696
405 2932403162 2932401849 Bacteria 4262978
406 643389591 643348555 Bacteria 3914947
407 8047674166 8047673197 Bacteria 7395230
408 JGI24736J21556_1000011
409 JGI24752J21851_1000112
410 JGI24740J21852_10002751
411 JGI24739J22299_10006088
412 JGI24737J22298_10011408
413 JGI24735J21928_10001554
414 JGI24750J21931_1000644
415 JGI24748J21848_1000056
416 JGI24738J21930_10002898
417 JGI24738J21930_10003429
418 JGI24034J26672_10000019
419 JGI24751J29686_10001524
420 JGI25159J45721_1002651
421 JGI25159J45721_1011594
422 JGI25151J46595_10000330
423 JGI25153J46596_10000012
424 Ga0007410J51695_1019775
425 Ga0055525_1000001
426 Ga0055529_1000095
427 Ga0055526_1003765
428 Ga0055526_1004314
429 Ga0055526_1015776
430 Ga0055537_1001037
431 Ga0055524_1001075
432 Ga0055524_1005947
433 Ga0055534_1001729
434 Ga0055528_1000089
435 Ga0065165_1003501
436 Ga0065707_10093317
437 Ga0065707_10129311
438 Ga0070690_100000165
439 Ga0070670_100000074
440 Ga0070666_10000002
441 Ga0070666_10054067
442 Ga0070660_100101994
443 Ga0070689_100001960
444 Ga0070661_100099578
445 Ga0070668_100010928
446 Ga0070668_100021085
447 Ga0070669_100000058
448 Ga0070669_100000256
449 Ga0070674_100033657
450 Ga0070673_100011322
451 Ga0070688_100001682
452 Ga0070659_100042800
453 Ga0070659_100082849
454 Ga0070667_100000131
455 Ga0070667_100008651
456 Ga0070667_100018572
457 Ga0070714_100019208
458 Ga0070697_100183404
459 Ga0070686_100000003
460 Ga0070665_100000025
461 Ga0070665_100000334
462 Ga0070665_100002313
463 Ga0068859_100000812
464 Ga0068859_100004220
465 Ga0068859_100006071
466 Ga0068864_100000411
467 Ga0068864_100003013
468 Ga0068861_100005442
469 Ga0068861_100007135
470 Ga0068851_10005940
471 Ga0068863_100000085
472 Ga0068863_100059776
473 Ga0068858_100014539
474 Ga0068860_100000001
475 Ga0068860_100000013
476 Ga0068860_100013463
477 Ga0068862_100000020
478 Ga0068862_100000081
479 Ga0081538_10008528
480 Ga0081540_1019372
481 Ga0081539_10011264
482 Ga0075362_10019204
483 Ga0097621_100153321
484 Ga0075428_100162867
485 Ga0097620_100000812
486 Ga0097620_100004220
487 Ga0097620_100006070
488 Ga0079104_1006487
489 Ga0099826_10000001
490 Ga0099795_10011126
491 Ga0105244_10007907
492 Ga0105240_10000684
493 Ga0105240_10000814
494 Ga0111539_10000331
495 Ga0114129_10025430
496 Ga0105241_10056192
497 Ga0105242_10065149
498 Ga0105248_10000510
499 Ga0105248_10002217
500 Ga0105248_10013219
501 Ga0105248_10043864
502 Ga0105249_10000114
503 Ga0105249_10101981
504 Ga0105148_101033
505 Ga0099796_10002776
506 Ga0105239_10181760
507 Ga0157369_10018702
508 Ga0163162_10095634
509 Ga0163162_10202086
510 Ga0163163_10043261
511 Ga0163163_10050408
512 Ga0157380_10000035
513 Ga0157379_10043617
514 Ga0182006_1000117
515 Ga0182005_1000041
516 Ga0163161_10000067
517 Ga0213872_10000026
518 Ga0213872_10002205
519 Ga0213872_10005109
520 Ga0213876_10000963
521 Ga0213875_10000329
522 Ga0213875_10006171
523 Ga0209436_101177
524 Ga0207672_1000441
525 Ga0209563_100007
526 Ga0207425_1000001
527 Ga0209026_1002212
528 Ga0209677_107941
529 Ga0209148_1000465
530 Ga0209129_1000001
531 Ga0209565_1000009
532 Ga0209565_1001770
533 Ga0209455_1000121
534 Ga0209455_1002252
535 Ga0209673_1000019
536 Ga0209130_1000771
537 Ga0209130_1003458
538 Ga0209675_1000028
539 Ga0209675_1001513
540 Ga0209025_1000327
541 Ga0209564_1000009
542 Ga0209564_1000033
543 Ga0209564_1000058
544 Ga0209564_1002185
545 Ga0209758_1000059
546 Ga0209758_1000116
547 Ga0209758_1005403
548 Ga0209050_1020900
549 Ga0209256_1000005
550 Ga0209256_1000052
551 Ga0207426_1000080
552 Ga0207426_1002443
553 Ga0209257_1000107
554 Ga0209257_1001001
555 Ga0207655_1008330
556 Ga0207655_1011670
557 Ga0207680_10000004
558 Ga0207647_10000122
559 Ga0207654_10005302
560 Ga0207654_10013390
561 Ga0207695_10001037
562 Ga0207695_10002263
563 Ga0207695_10002865
564 Ga0207671_10000319
565 Ga0207657_10008925
566 Ga0207681_10000003
567 Ga0207681_10000079
568 Ga0207694_10011166
569 Ga0207650_10000038
570 Ga0207650_10123537
571 Ga0207687_10094304
572 Ga0207664_10034808
573 Ga0207644_10000499
574 Ga0207706_10008554
575 Ga0207706_10029812
576 Ga0207670_10002793
577 Ga0207704_10021397
578 Ga0207691_10162120
579 Ga0207711_10000138
580 Ga0207711_10010989
581 Ga0207711_10013195
582 Ga0207679_10180180
583 Ga0207667_10001469
584 Ga0207712_10000001
585 Ga0207668_10008717
586 Ga0207668_10012983
587 Ga0207668_10072145
588 Ga0207640_10006714
589 Ga0207658_10000067
590 Ga0207658_10002491
591 Ga0207658_10026955
592 Ga0207703_10001673
593 Ga0207639_10151054
594 Ga0207678_10007153
595 Ga0207702_10031590
596 Ga0207641_10000142
597 Ga0207641_10004518
598 Ga0207641_10052998
599 Ga0207676_10000034
600 Ga0207676_10017370
601 Ga0207674_10066214
602 Ga0207675_100007697
603 Ga0207675_100077260
604 Ga0207698_10155685
605 Ga0209281_1005969
606 Ga0209282_1000001
607 Ga0209974_10032035
608 Ga0207428_10000208
609 Ga0268266_10000028
610 Ga0268266_10000103
611 Ga0268266_10001922
612 Ga0268265_10000030
613 Ga0268265_10083662
614 Ga0268265_10107314
615 Ga0268265_10183980
616 Ga0268264_10000006
617 Ga0268264_10000039
618 Ga0268264_10016743
619 Ga0316177_1021517
620 Ga0307408_100002829
621 Ga0307408_100008901
622 Ga0307408_100027345
623 Ga0307408_100276920
624 Ga0307508_10184298
625 Ga0307405_10012457
626 Ga0307405_10033131
627 Ga0307405_10043035
628 Ga0307405_10069404
629 Ga0307405_10081261
630 Ga0307413_10007373
631 Ga0307413_10016849
632 Ga0307413_10024797
633 Ga0307413_10031966
634 Ga0307413_10053660
635 Ga0307410_10008406
636 Ga0307410_10048165
637 Ga0307406_10002370
638 Ga0307406_10150917
639 Ga0307407_10005753
640 Ga0307407_10009966
641 Ga0307412_10004282
642 Ga0307412_10004810
643 Ga0307412_10014130
644 Ga0307412_10154454
645 Ga0307409_100034055
646 Ga0307409_100044452
647 Ga0307409_100058361
648 Ga0307409_100075488
649 Ga0307416_100014264
650 Ga0307416_100019992
651 Ga0307416_100040828
652 Ga0307416_100041208
653 Ga0307416_100174170
654 Ga0307414_10028503
655 Ga0307414_10141627
656 Ga0307414_10252343
657 Ga0307411_10013682
658 Ga0307411_10058977
659 Ga0307411_10129872
660 Ga0307415_100038727
661 Ga0307415_100086869
662 Ga0373953_0001354
663 Ga0373954_0019569
664 Ga0373956_0014537
665 Ga0373955_0011501
666 Ga0373962_0001843
667 Ga0316574_0098175
668 Ga0373933_0013122
669 Ga0373947_0061793
670 Ga0395900_0076684
671 Ga0395898_0140722
672 Ga0395905_0030939
673 Ga0436364_0223731
674 Ga0395901_0000217
675 Ga0436365_1740297
676 Ga0436361_0655565
677 Ga0436361_0974268
678 Ga0436361_1216357
679 Ga0436362_0935205
680 Ga0436362_1162131
681 Ga0439453_0011064
682 Ga0466964_0015333
683 Ga0466957_0000259
684 Ga0451576_0193422
685 Ga0495617_000029
686 Ga0495627_000055
687 Ga0495590_0009675
688 Ga0495591_000240
689 Ga0495638_0000091
690 Ga0495650_0000844
691 Ga0495580_0112616
692 Ga0495639_0039192
693 Ga0495584_0000680
694 Ga0495583_0000549
695 Ga0495610_0000003
696 Ga0495610_0007246
697 Ga0495632_0031627
698 Ga0495637_0000004
699 Ga0495648_0004948
700 Ga0495663_0017627
701 Ga0495642_0000149
702 Ga0495654_0000795
703 Ga0495640_0072368
704 Ga0495597_0005079
705 Ga0495667_0019271
706 Ga0495668_0000368
707 Ga0495668_0002602
708 Ga0495668_0002731
709 Ga0495623_0006061
710 Ga0495671_0000001
711 Ga0495649_0006126
712 Ga0495660_0003282
713 Ga0495672_0000176
714 Ga0495672_0000632
715 Ga0495683_0000884
716 Ga0495687_000149
717 Ga0495679_034223
718 Ga0495673_0000024
719 Ga0495673_0000049
720 Ga0495686_0001510
721 Ga0495626_0037901
722 Ga0496102_0000463
723 Ga0496102_0018026
724 Ga0496103_0001502
725 Ga0496103_0002220
726 Ga0496103_0009590
727 Ga0496108_0003442
728 Ga0496110_0060662
729 Ga0496116_0112248
730 Ga0496117_0007623
731 Ga0496118_0000677
732 Ga0496118_0005853
733 Ga0496121_0237210
734 Ga0501032_0002142
735 Ga0501033_0003493
736 Ga0501036_0029442
737 Ga0501037_0001900
738 Ga0501038_0071051
739 Ga0501038_0139400
740 Ga0501043_0049604
741 Ga0501046_0005555
742 Ga0501046_0111515
743 Ga0501047_0074526
744 Ga0501048_0017671
745 Ga0501067_0029543
746 Ga0501069_0008711
747 Ga0501070_0035421
748 Ga0501070_0057680
749 Ga0501071_0067198
750 Ga0501072_0098077
751 Ga0501073_0007054
752 Ga0501073_0007219
753 Ga0501073_0010631
754 Ga0501073_0026449
755 Ga0501073_0052746
756 Ga0501074_0003572
757 Ga0501074_0023209
758 Ga0501076_0026594
759 Ga0501077_0011126
760 Ga0501257_000074
761 Ga0501079_0026494
762 Ga0501080_0037191
763 Ga0501080_0055822
764 Ga0501080_0218206
765 Ga0501083_0035856
766 Ga0501035_0003352
767 Ga0501035_0180424
768 Ga0501044_0025202
769 Ga0501044_0031298
770 Ga0501045_0009107
771 nmdc:mga08y16_35_c1
772 Ga0495601_0028874
773 Ga0495619_0041551
774 Ga0500641_0003985
775 Ga0500555_002362
776 Ga0500595_008348
777 Ga0500607_001017
778 Ga0500642_0007049
779 Ga0500590_000341
780 Ga0500604_0000445
781 Ga0500624_000001
782 Ga0500627_0000206
783 Ga0500637_0000860
784 Ga0500570_000264
785 Ga0500645_002852
786 Ga0500609_000613
787 Ga0501084_0038177
788 Ga0501082_0037897
789 Ga0530510_0007280
790 2831865648
791 2585261891
792 2601667363
793 2643730980
794 2644028902
795 2644040498
796 2644044367
797 2644391709
798 2738829591
799 2739153387
800 2739195307
801 2739321783
802 2739339661
803 2821447879
804 2842714422
805 2844539924
806 2857551913
807 2857565088
808 2883294352
809 2883357125
810 2904426408
811 2919478738
812 2932403162
813 643389591
814 8047674166

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00285

Citrate_synt

Citrate synthase, C-terminal domain

28

397

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e6y-assembly1.cif.gz_A type ii citrate synthase from vibrio vulnificus. 0.9276 3 428
4e6y-assembly1.cif.gz_A type ii citrate synthase from vibrio vulnificus. 0.9254 3 428
6zu0-assembly1.cif.gz_E crystal structure of citrate synthase (glta) from pseudomonas aeruginosa 0.9178 3 425
6zu0-assembly1.cif.gz_B crystal structure of citrate synthase (glta) from pseudomonas aeruginosa 0.9167 3 428
6zu0-assembly1.cif.gz_A crystal structure of citrate synthase (glta) from pseudomonas aeruginosa 0.9155 3 428
ID Description Score Start End Superfamily
4e6yA03 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.9666 267 376 1.10.230.10
2h12A01 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.9636 4 46 2.20.28.60
4xghA02 Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 0.9493 51 414 1.10.580.10
4e6yA03 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.9492 267 376 1.10.230.10
4xghA02 Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 0.9456 51 414 1.10.580.10
ID Description Score Start End GO Terms
AF-A0A0D5NVA7-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.9871 269 376 GO:0006099
GO:0036440
AF-A0A4P8DJD7-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.978 264 389 GO:0006099
GO:0036440
AF-T1PRF3-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.9758 262 386 GO:0006099
GO:0036440
AF-A0A7H1CRX7-F1-model_v4 Citrate synthase 0.9754 84 264 GO:0046912
AF-A0A3C2BHA3-F1-model_v4 deleted 0.9741 113 234

Map