F436612

General Info

Members Datasets Scaffolds Average Seq Length
407 262 815 472

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006425503|3006430190
Length 564
Sequence DDGTGAGTGRGPAAGGAGRGGHVVVVGGGIAGLAAAHRLLAGGARVTLLEASPRLGGKLLAGELAGVPVDFGAESLLARRPEAIGLARAVGLAERLQAPATATAALWTRGALRPLPTGHVMGVPGDMAALAASGVLSPEGLERARREPELPVRPLPAGSNRSGTPGTPGGPGGAVPGEGREGRDGGEGEDPDVAVGAYVAERFGREVVDRLVEPLLGGVYAGDAYRLSLRAAVPQLYGAAREGRMLTGAVQELRRRSGAATGPVFLGIEGGVGTLPEAVAAACRAGGAEIVTGAAVRELRRAGAGWRLVAEGPGAGEAGAAAARAGAAVTRRSVLTADAVVLAVPAAAAARLLAGPAPAAAAELNTVEYASMALVSMAFRRADLGGPDALAGPAGPTSLAGPAGPAPGARGSGFLVPAVEGRAIKAATFASRKWGWIGAAAPELFVIRTSVGRHGEESELKRDDAGLVEVSLRDLGEATGLRARPVGTRVTRWRDGLPQYPVGHTGRVARIRAALADLPGLRVCGAAYDGVGIPACVAGGTAAAEDVLGGLATLAPGTAPGEGE

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
24 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
25 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
26 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
37 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
38 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
39 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
40 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
41 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
42 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
43 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
44 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
45 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
46 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
47 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
48 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
49 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
50 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
51 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
52 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
53 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
54 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
57 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
60 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
61 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
62 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
63 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
64 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
65 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
66 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
67 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
70 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
71 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
81 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
82 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
83 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
84 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
90 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
96 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
97 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
106 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
107 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
159 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
160 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
161 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
162 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
163 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
164 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
165 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
166 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
167 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
168 2643221548 Streptomyces sp. Root55 Isolate Unclassified
169 2643221578 Streptomyces sp. Root63 Isolate Unclassified
170 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
171 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
172 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
173 2643221647 Streptomyces sp. Root369 Isolate Unclassified
174 2643221670 Streptomyces sp. Root431 Isolate Unclassified
175 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
176 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
177 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
178 2643221679 Angustibacter sp. Root456 Isolate Unclassified
179 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
180 2643221714 Streptomyces sp. Root264 Isolate Unclassified
181 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
182 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
183 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
184 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
185 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
186 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
187 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
188 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
189 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
190 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
191 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
192 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
193 2808606448 Streptomyces sp. 193411 Isolate Unclassified
194 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
195 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
196 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
197 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
198 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
199 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
200 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
201 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
202 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
203 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
204 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
205 2862574272 Streptomyces sp. AcE210 Isolate Nodule
206 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
207 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
208 2867369537 Streptomyces sp. Z26 Isolate Unclassified
209 2867428634 Streptomyces sp. RP5T Isolate Unclassified
210 2867475112 Streptomyces sp. TM32 Isolate Unclassified
211 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
212 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
213 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
214 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
215 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
216 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
217 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
218 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
219 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
220 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
221 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
222 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
223 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
224 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
225 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
226 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
227 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
228 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
229 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
230 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
231 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
232 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
233 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
234 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
235 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
236 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
237 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
238 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
239 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
240 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
241 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
242 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
243 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
244 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
245 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
246 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
247 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
248 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
249 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
250 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
251 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
252 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
253 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
254 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
255 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
256 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
257 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
258 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
259 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
260 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
261 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
262 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.46
Metatranscriptomes 0
Isolates 26.54

Biome Distribution

Category Percentage (%)
Aerial Root 0.49
Bulb 0
Endosphere 0.98
Nodule 0.25
Rhizoplane 4.67
Rhizosphere 79.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10017984 3300003320 Bacteria 4403
2 rootH2_10126687 3300003320 Bacteria 3692
3 rootH1_10009565 3300003316 Bacteria 5500
4 rootH1_10009565 3300003323 Bacteria 5356
5 Ga0070658_10004502 3300005327 Bacteria 11334
6 Ga0070658_10098349 3300005327 Bacteria 2417
7 Ga0070682_100134864 3300005337 Bacteria 1676
8 Ga0070660_100010562 3300005339 Bacteria 6524
9 Ga0070714_100001338 3300005435 Bacteria 17792
10 Ga0070713_100028200 3300005436 Bacteria 4432
11 Ga0070713_100038411 3300005436 Bacteria 3879
12 Ga0070708_100119044 3300005445 Bacteria 2434
13 Ga0070707_100027552 3300005468 Bacteria 5406
14 Ga0068851_10070461 3300005834 Bacteria 1808
15 Ga0081455_10000201 3300005937 Bacteria 76008
16 Ga0081455_10008042 3300005937 Bacteria 11015
17 Ga0081539_10001814 3300005985 Bacteria 33764
18 Ga0081539_10011267 3300005985 Bacteria 7105
19 Ga0075363_100011901 3300006048 Bacteria 4178
20 Ga0075428_100004176 3300006844 Bacteria 15899
21 Ga0075430_100024912 3300006846 Bacteria 5089
22 Ga0075430_100031834 3300006846 Bacteria 4477
23 Ga0075431_100012734 3300006847 Bacteria 8490
24 Ga0075431_100018219 3300006847 Bacteria 7145
25 Ga0075431_100223320 3300006847 Bacteria 1921
26 Ga0075429_100000202 3300006880 Bacteria 39555
27 Ga0075429_100021275 3300006880 Bacteria 5623
28 Ga0114129_10013772 3300009147 Bacteria 11525
29 Ga0114129_10079158 3300009147 Bacteria 4570
30 Ga0105239_10099992 3300010375 Bacteria 3207
31 Ga0157369_10020362 3300013105 Bacteria 7415
32 Ga0157372_10066099 3300013307 Bacteria 4062
33 Ga0157372_10248661 3300013307 Bacteria 2064
34 Ga0163163_10123733 3300014325 Bacteria 2622
35 Ga0213875_10000808 3300021388 Bacteria 23400
36 Ga0213875_10015826 3300021388 Bacteria 3666
37 Ga0209758_1027256 3300025297 Bacteria 2446
38 Ga0207426_1003281 3300025302 Bacteria 9020
39 Ga0207426_1007237 3300025302 Bacteria 4676
40 Ga0207647_10021472 3300025904 Bacteria 4309
41 Ga0207643_10064784 3300025908 Bacteria 2092
42 Ga0207705_10003580 3300025909 Bacteria 11833
43 Ga0207705_10108508 3300025909 Bacteria 2049
44 Ga0207660_10117346 3300025917 Bacteria 2011
45 Ga0207657_10027862 3300025919 Bacteria 5166
46 Ga0207646_10017111 3300025922 Bacteria 6792
47 Ga0207700_10020233 3300025928 Bacteria 4514
48 Ga0207700_10172899 3300025928 Bacteria 1803
49 Ga0207664_10001334 3300025929 Bacteria 16233
50 Ga0207708_10064539 3300026075 Bacteria 2797
51 Ga0209371_1010825 3300027312 Bacteria 2765
52 Ga0207428_10006783 3300027907 Bacteria 10500
53 Ga0265336_10004335 3300028666 Bacteria 5376
54 Ga0265338_10002448 3300028800 Bacteria 27838
55 Ga0307513_10037581 3300031456 Bacteria 5387
56 Ga0307508_10005893 3300031616 Bacteria 11565
57 Ga0307508_10114525 3300031616 Bacteria 2297
58 Ga0307514_10001356 3300031649 Bacteria 30991
59 Ga0316576_10004181 3300031727 Bacteria 8619
60 Ga0316576_10008268 3300031727 Bacteria 6623
61 Ga0316576_10012653 3300031727 Bacteria 5581
62 Ga0316576_10106475 3300031727 Bacteria 2099
63 Ga0316578_10020322 3300031728 Bacteria 3667
64 Ga0316578_10024249 3300031728 Bacteria 3401
65 Ga0316578_10046713 3300031728 Bacteria 2524
66 Ga0307516_10028208 3300031730 Bacteria 5682
67 Ga0307407_10010574 3300031903 Bacteria 4360
68 Ga0307407_10040038 3300031903 Bacteria 2610
69 Ga0307409_100001726 3300031995 Bacteria 11025
70 Ga0307409_100006090 3300031995 Bacteria 7048
71 Ga0307409_100031364 3300031995 Bacteria 3835
72 Ga0307409_100072130 3300031995 Bacteria 2749
73 Ga0307409_100191343 3300031995 Bacteria 1821
74 Ga0307415_100000663 3300032126 Bacteria 15196
75 Ga0316583_10001604 3300032133 Bacteria 7634
76 Ga0316585_10001603 3300032137 Bacteria 5997
77 Ga0316580_10007436 3300032139 Bacteria 3264
78 Ga0316580_10011622 3300032139 Bacteria 2675
79 Ga0307507_10000020 3300033179 Bacteria 220880
80 Ga0316574_0019512 3300035398 Bacteria 4001
81 Ga0316574_0033278 3300035398 Bacteria 3137
82 Ga0316582_0049420 3300036647 Bacteria 2660
83 Ga0316584_0009259 3300036712 Bacteria 6825
84 Ga0316584_0011790 3300036712 Bacteria 6153
85 Ga0316584_0083845 3300036712 Bacteria 2387
86 Ga0395898_0013213 3300037466 Bacteria 8506
87 Ga0395898_0034496 3300037466 Bacteria 5042
88 Ga0316581_0005597 3300037588 Bacteria 3287
89 Ga0436364_0315677 3300037853 Bacteria 5956
90 Ga0436364_0814106 3300037853 Bacteria 79026
91 Ga0395901_0105467 3300038443 Bacteria 2958
92 Ga0395901_0126491 3300038443 Bacteria 2686
93 Ga0439436_0011773 3300041404 Bacteria 2655
94 Ga0439433_0006962 3300041999 Bacteria 2440
95 Ga0439442_003959 3300042002 Bacteria 2936
96 Ga0439449_0000019 3300042007 Bacteria 46468
97 Ga0450903_000136 3300042138 Bacteria 16124
98 Ga0466969_0000484 3300044656 Bacteria 21847
99 Ga0466969_0019871 3300044656 Bacteria 3483
100 Ga0466969_0038122 3300044656 Bacteria 2420
101 Ga0466969_0045762 3300044656 Bacteria 2171
102 Ga0466972_0010232 3300044658 Bacteria 4711
103 Ga0466972_0029070 3300044658 Bacteria 2723
104 Ga0466966_0002796 3300044684 Bacteria 11475
105 Ga0466966_0006761 3300044684 Bacteria 7594
106 Ga0466966_0059278 3300044684 Bacteria 2417
107 Ga0466961_0000710 3300044693 Bacteria 20961
108 Ga0466961_0001715 3300044693 Bacteria 13632
109 Ga0466961_0005513 3300044693 Bacteria 7983
110 Ga0466963_0000594 3300044694 Bacteria 17256
111 Ga0466963_0001396 3300044694 Bacteria 12945
112 Ga0466963_0084643 3300044694 Bacteria 2152
113 Ga0466964_0017390 3300044706 Bacteria 2751
114 Ga0466971_0002739 3300044719 Bacteria 7447
115 Ga0466971_0024614 3300044719 Bacteria 2686
116 Ga0466971_0046981 3300044719 Bacteria 1940
117 Ga0466970_0001581 3300044765 Bacteria 10999
118 Ga0466970_0029003 3300044765 Bacteria 2911
119 Ga0466957_0000224 3300044842 Bacteria 26690
120 Ga0466959_0000203 3300045049 Bacteria 38577
121 Ga0466959_0001264 3300045049 Bacteria 15277
122 Ga0466959_0012690 3300045049 Bacteria 6096
123 Ga0466959_0013432 3300045049 Bacteria 5935
124 Ga0466959_0066989 3300045049 Bacteria 2604
125 Ga0466967_0107892 3300045976 Bacteria 2554
126 Ga0495627_020329 3300046453 Bacteria 2214
127 Ga0495592_0093865 3300046454 Bacteria 2148
128 Ga0495603_0007454 3300046455 Bacteria 6580
129 Ga0495603_0011895 3300046455 Bacteria 5266
130 Ga0495629_0004816 3300046459 Bacteria 10125
131 Ga0495629_0006615 3300046459 Bacteria 8581
132 Ga0495629_0014033 3300046459 Bacteria 5773
133 Ga0495629_0082883 3300046459 Bacteria 2238
134 Ga0495651_0004865 3300046462 Bacteria 10276
135 Ga0495651_0012257 3300046462 Bacteria 6607
136 Ga0495662_0000430 3300046476 Bacteria 18783
137 Ga0495662_0026817 3300046476 Bacteria 2783
138 Ga0495662_0046136 3300046476 Bacteria 2104
139 Ga0495664_0023174 3300046477 Bacteria 3601
140 Ga0495664_0035267 3300046477 Bacteria 2945
141 Ga0495664_0042799 3300046477 Bacteria 2684
142 Ga0495664_0053706 3300046477 Bacteria 2396
143 Ga0495664_0127428 3300046477 Bacteria 1540
144 Ga0495585_0004275 3300046492 Bacteria 9304
145 Ga0495594_0001993 3300046499 Bacteria 10642
146 Ga0495608_0001172 3300046511 Bacteria 18575
147 Ga0495628_0021995 3300046516 Bacteria 5241
148 Ga0495628_0030825 3300046516 Bacteria 4340
149 Ga0495628_0040116 3300046516 Bacteria 3742
150 Ga0495643_0003336 3300046522 Bacteria 11829
151 Ga0495648_0023401 3300046524 Bacteria 4231
152 Ga0495652_0003944 3300046529 Bacteria 14397
153 Ga0495652_0069782 3300046529 Bacteria 2940
154 Ga0495652_0083124 3300046529 Bacteria 2636
155 Ga0495665_0000918 3300046531 Bacteria 15540
156 Ga0495640_0009039 3300046533 Bacteria 7773
157 Ga0495667_0020375 3300046559 Bacteria 4475
158 Ga0495635_0008695 3300046663 Bacteria 7092
159 Ga0495588_0002727 3300046674 Bacteria 7570
160 Ga0495657_0007281 3300046675 Bacteria 8565
161 Ga0495657_0007584 3300046675 Bacteria 8374
162 Ga0495657_0018239 3300046675 Bacteria 5084
163 Ga0495599_0040244 3300046678 Bacteria 2935
164 Ga0495623_0020843 3300046679 Bacteria 4236
165 Ga0495646_0006801 3300046680 Bacteria 7256
166 Ga0495613_0008780 3300046689 Bacteria 7494
167 Ga0495613_0014823 3300046689 Bacteria 5785
168 Ga0495613_0023389 3300046689 Bacteria 4603
169 Ga0495624_0127918 3300046690 Bacteria 1558
170 Ga0495589_0022723 3300046794 Bacteria 3199
171 Ga0495604_0010791 3300047317 Bacteria 7255
172 Ga0495636_0002311 3300047318 Bacteria 7321
173 Ga0495676_0001986 3300047321 Bacteria 17979
174 Ga0495676_0010570 3300047321 Bacteria 8360
175 Ga0495676_0021404 3300047321 Bacteria 5648
176 Ga0495676_0136223 3300047321 Bacteria 1765
177 Ga0495680_0007232 3300047322 Bacteria 10223
178 Ga0495675_0002942 3300047444 Bacteria 10233
179 Ga0495675_0011355 3300047444 Bacteria 5590
180 Ga0495675_0015372 3300047444 Bacteria 4841
181 Ga0495675_0017054 3300047444 Bacteria 4598
182 Ga0495675_0026757 3300047444 Bacteria 3678
183 Ga0495593_0090551 3300047673 Bacteria 1575
184 Ga0495614_0002925 3300048089 Bacteria 7610
185 Ga0496101_0156506 3300048904 Bacteria 1746
186 Ga0496102_0003712 3300048905 Bacteria 12907
187 Ga0496102_0025849 3300048905 Bacteria 5230
188 Ga0496102_0032297 3300048905 Bacteria 4703
189 Ga0496102_0039514 3300048905 Bacteria 4263
190 Ga0496105_0071498 3300048908 Bacteria 2867
191 Ga0496106_0016057 3300048909 Bacteria 5536
192 Ga0496107_0015865 3300048910 Bacteria 5285
193 Ga0496109_0023692 3300048912 Bacteria 5449
194 Ga0496109_0192581 3300048912 Bacteria 1916
195 Ga0496110_0180480 3300048913 Bacteria 1917
196 Ga0496111_0042775 3300048914 Bacteria 3253
197 Ga0496113_0109049 3300048916 Bacteria 2152
198 Ga0496113_0164627 3300048916 Bacteria 1754
199 Ga0496114_0009019 3300048917 Bacteria 7906
200 Ga0496114_0048456 3300048917 Bacteria 3534
201 Ga0496114_0063903 3300048917 Bacteria 3082
202 Ga0496114_0172464 3300048917 Bacteria 1886
203 Ga0496119_0001318 3300048922 Bacteria 30496
204 Ga0501031_0030527 3300049568 Bacteria 3516
205 Ga0501031_0038382 3300049568 Bacteria 3125
206 Ga0501032_0020191 3300049569 Bacteria 4644
207 Ga0501032_0047099 3300049569 Bacteria 2912
208 Ga0501033_0006494 3300049570 Bacteria 9148
209 Ga0501033_0053341 3300049570 Bacteria 2994
210 Ga0501034_0000985 3300049571 Bacteria 40845
211 Ga0501034_0011203 3300049571 Bacteria 9310
212 Ga0501034_0042131 3300049571 Bacteria 4621
213 Ga0501034_0203563 3300049571 Bacteria 1936
214 Ga0501036_0025434 3300049572 Bacteria 4993
215 Ga0501036_0049343 3300049572 Bacteria 3564
216 Ga0501037_0006540 3300049573 Bacteria 8528
217 Ga0501038_0003825 3300049574 Bacteria 13999
218 Ga0501038_0037725 3300049574 Bacteria 4236
219 Ga0501038_0049663 3300049574 Bacteria 3627
220 Ga0501038_0140263 3300049574 Bacteria 1978
221 Ga0501039_0007880 3300049575 Bacteria 8120
222 Ga0501039_0034087 3300049575 Bacteria 3928
223 Ga0501040_0001026 3300049576 Bacteria 17713
224 Ga0501040_0003748 3300049576 Bacteria 9852
225 Ga0501040_0028250 3300049576 Bacteria 3780
226 Ga0501041_0006512 3300049577 Bacteria 6837
227 Ga0501041_0009555 3300049577 Bacteria 5718
228 Ga0501042_0035369 3300049578 Bacteria 3543
229 Ga0501042_0093799 3300049578 Bacteria 2156
230 Ga0501043_0022553 3300049579 Bacteria 4936
231 Ga0501043_0037949 3300049579 Bacteria 3789
232 Ga0501046_0041496 3300049580 Bacteria 3671
233 Ga0501046_0063988 3300049580 Bacteria 2871
234 Ga0501047_0000036 3300049581 Bacteria 195504
235 Ga0501047_0001597 3300049581 Bacteria 22094
236 Ga0501047_0005202 3300049581 Bacteria 12213
237 Ga0501047_0021858 3300049581 Bacteria 6143
238 Ga0501047_0045424 3300049581 Bacteria 4248
239 Ga0501048_0001798 3300049582 Bacteria 16300
240 Ga0501048_0031494 3300049582 Bacteria 3836
241 Ga0501048_0053863 3300049582 Bacteria 2858
242 Ga0501048_0074260 3300049582 Bacteria 2399
243 Ga0501068_0031334 3300049584 Bacteria 3158
244 Ga0501068_0039322 3300049584 Bacteria 2836
245 Ga0501070_0001961 3300049586 Bacteria 18157
246 Ga0501070_0034255 3300049586 Bacteria 4246
247 Ga0501070_0067927 3300049586 Bacteria 2952
248 Ga0501071_0002659 3300049587 Bacteria 10944
249 Ga0501072_0001891 3300049588 Bacteria 15593
250 Ga0501072_0010675 3300049588 Bacteria 6993
251 Ga0501074_0002509 3300049590 Bacteria 12793
252 Ga0501074_0099630 3300049590 Bacteria 2080
253 Ga0501075_0019033 3300049591 Bacteria 4979
254 Ga0501075_0026348 3300049591 Bacteria 4279
255 Ga0501076_0037312 3300049592 Bacteria 3810
256 Ga0501076_0077316 3300049592 Bacteria 2670
257 Ga0501077_0007631 3300049593 Bacteria 6677
258 Ga0501077_0041337 3300049593 Bacteria 2935
259 Ga0501077_0061951 3300049593 Bacteria 2374
260 Ga0501079_0013558 3300049741 Bacteria 6217
261 Ga0501079_0035156 3300049741 Bacteria 3856
262 Ga0501080_0025472 3300049742 Bacteria 5490
263 Ga0501083_0003907 3300049744 Bacteria 10466
264 Ga0501035_0004079 3300049822 Bacteria 13885
265 Ga0501035_0017573 3300049822 Bacteria 6600
266 Ga0501035_0036307 3300049822 Bacteria 4467
267 Ga0501035_0082511 3300049822 Bacteria 2837
268 Ga0501035_0120208 3300049822 Bacteria 2297
269 Ga0501044_0001014 3300049823 Bacteria 33745
270 Ga0501044_0004151 3300049823 Bacteria 16268
271 Ga0501044_0006307 3300049823 Bacteria 13111
272 Ga0501044_0067705 3300049823 Bacteria 3638
273 Ga0501044_0139208 3300049823 Bacteria 2416
274 Ga0501044_0189632 3300049823 Bacteria 2019
275 Ga0501045_0004185 3300049824 Bacteria 9962
276 Ga0501045_0081617 3300049824 Bacteria 2384
277 Ga0501045_0163043 3300049824 Bacteria 1660
278 nmdc:mga05p37_370_c1 3300050507 Bacteria 48311
279 nmdc:mga09592_735_c1 3300050508 Bacteria 25241
280 nmdc:mga09592_7673_c1 3300050508 Bacteria 8771
281 nmdc:mga0qj67_23099_c1 3300050509 Bacteria 4781
282 nmdc:mga0qj67_28158_c1 3300050509 Bacteria 4359
283 nmdc:mga06r32_123211_c1 3300050510 Bacteria 2558
284 nmdc:mga06r32_1733_c2 3300050510 Bacteria 8517
285 nmdc:mga06r32_33227_c1 3300050510 Bacteria 4859
286 nmdc:mga06r32_5063_c1 3300050510 Bacteria 11871
287 nmdc:mga08y16_7864_c1 3300050511 Bacteria 11162
288 Ga0495601_0012650 3300053077 Bacteria 5061
289 Ga0495601_0016323 3300053077 Bacteria 4500
290 Ga0495601_0038632 3300053077 Bacteria 2986
291 Ga0495612_0014182 3300053078 Bacteria 3207
292 Ga0501084_0042273 3300054114 Bacteria 3812
293 Ga0501084_0059711 3300054114 Bacteria 3192
294 Ga0501084_0085729 3300054114 Bacteria 2644
295 Ga0501082_0034881 3300060353 Bacteria 4336
296 Ga0466962_0000138 3300061719 Bacteria 29768
297 Ga0466962_0000221 3300061719 Bacteria 23682
298 Ga0466962_0012438 3300061719 Bacteria 4091
299 Ga0466962_0058423 3300061719 Bacteria 1841
300 Ga0530510_0036010 3300061734 Bacteria 3567
301 3006430190 3006425503 Bacteria 6491253
302 2515719357 2515154129 Bacteria 5584369
303 2515722084 2515154129 Bacteria 5584369
304 2516083697 2515154202 Bacteria 5471270
305 2516085692 2515154202 Bacteria 5471270
306 2554260453 2554235005 Bacteria 6457341
307 2585297030 2582581312 Bacteria 7308206
308 2585307336 2582581313 Bacteria 10042643
309 2585317516 2582581314 Bacteria 11452267
310 2616699144 2616644814 Bacteria 11555299
311 2616902413 2616644941 Bacteria 8510691
312 2643761789 2643221548 Bacteria 8053412
313 2643904144 2643221578 Bacteria 9213798
314 2643943353 2643221587 Bacteria 7586415
315 2644016638 2643221601 Bacteria 7493239
316 2644174966 2643221631 Bacteria 8168043
317 2644264874 2643221647 Bacteria 10741251
318 2644388331 2643221670 Bacteria 6497041
319 2644402499 2643221673 Bacteria 9196637
320 2644430821 2643221677 Bacteria 7584031
321 2644442500 2643221678 Bacteria 9540101
322 2644445336 2643221679 Bacteria 3839507
323 2644460784 2643221682 Bacteria 6743283
324 2644626658 2643221714 Bacteria 9015452
325 2729905325 2728369276 Bacteria 5610032
326 2731906861 2731639228 Bacteria 4187555
327 2768646256 2767802112 Bacteria 6465194
328 2784472035 2784132109 Bacteria 3141763
329 2784591193 2784132148 Bacteria 8627943
330 2785372221 2784746768 Bacteria 10036182
331 2786673301 2786546132 Bacteria 10419719
332 2793985503 2791355406 Bacteria 11364898
333 2799184079 2799112218 Bacteria 4315149
334 2804848630 2802429296 Bacteria 7227771
335 2808844675 2808606359 Bacteria 9866990
336 2808914241 2808606375 Bacteria 9466072
337 2809234766 2808606448 Bacteria 8656184
338 2811843838 2808606982 Bacteria 7791042
339 2812355276 2811994879 Bacteria 9313447
340 2812477991 2811994917 Bacteria 7761064
341 2816425634 2816332119 Bacteria 8120218
342 2819699576 2818991463 Bacteria 7948711
343 2819740184 2818991472 Bacteria 10089953
344 2852638765 2852635781 Bacteria 8251373
345 2862179166 2862178590 Bacteria 8583590
346 2862180229 2862178590 Bacteria 8583590
347 2862283991 2862281513 Bacteria 9621493
348 2862293423 2862290372 Bacteria 7471434
349 2862516572 2862507626 Bacteria 9425308
350 2862576835 2862574272 Bacteria 10567477
351 2862708046 2862705112 Bacteria 6563286
352 2867352601 2867346516 Bacteria 7608576
353 2867374455 2867369537 Bacteria 6501581
354 2867434516 2867428634 Bacteria 9590268
355 2867475821 2867475112 Bacteria 6909112
356 2873318722 2873314349 Bacteria 8512634
357 2875397364 2875391855 Bacteria 7600475
358 2877678420 2877676314 Bacteria 9512378
359 2912716920 2912715099 Bacteria 9460473
360 2912729491 2912723979 Bacteria 8557534
361 2912763598 2912757875 Bacteria 7940295
362 2918507193 2918501144 Bacteria 8668083
363 2919474950 2919468124 Bacteria 9133025
364 2935391150 2935390628 Bacteria 7043367
365 2935394480 2935390628 Bacteria 7043367
366 2946047140 2946045630 Bacteria 8527308
367 2946070615 2946064051 Bacteria 8957905
368 2946078350 2946072368 Bacteria 8999607
369 2947226198 2947224130 Bacteria 9938529
370 2954010351 2954002825 Bacteria 9173742
371 2954383367 2954380949 Bacteria 10050426
372 2954679604 2954673503 Bacteria 9685905
373 2954684551 2954682443 Bacteria 9862841
374 2954694078 2954691527 Bacteria 10720516
375 2954709185 2954701450 Bacteria 10834262
376 2954713685 2954711539 Bacteria 10867210
377 2954723648 2954721474 Bacteria 10456478
378 2954738184 2954731030 Bacteria 10243860
379 2954757044 2954749733 Bacteria 10366972
380 2954761515 2954759201 Bacteria 9358192
381 2966600154 2966598605 Bacteria 7676064
382 2984579650 2984576629 Bacteria 4248407
383 2990049175 2990044586 Bacteria 6603797
384 2990257257 2990256926 Bacteria 4252839
385 2997459498 2997451912 Bacteria 8492419
386 2997602111 2997600082 Bacteria 9896405
387 3001891316 3001889506 Bacteria 2975194
388 3006327234 3006321560 Bacteria 8247479
389 3006396819 3006393351 Bacteria 6615579
390 3006486677 3006486233 Bacteria 8157040
391 3006499623 3006493962 Bacteria 8825450
392 8008490005 8008485437 Bacteria 7198341
393 8008576519 8008574985 Bacteria 7815457
394 8023624719 8023623736 Bacteria 8593882
395 8025419103 8025413630 Bacteria 7014048
396 8025529262 8025524527 Bacteria 7197316
397 8025532773 8025530807 Bacteria 8495698
398 8047895533 8047893842 Bacteria 11723082
399 8048128987 8048127548 Bacteria 11053136
400 8048363421 8048356638 Bacteria 11044339
401 8048372557 8048369669 Bacteria 11666822
402 8048381491 8048379754 Bacteria 11877923
403 8054164358 8054160619 Bacteria 7783213
404 8055174338 8055172936 Bacteria 9305943
405 8056065490 8056060235 Bacteria 7259403
406 8056449533 8056447290 Bacteria 7680491
407 8056667080 8056667051 Bacteria 6953971
408 8056829894 8056829672 Bacteria 9045328
409 rootH2_10017984
410 rootH2_10126687
411 rootH1_10009565
412 Ga0070658_10004502
413 Ga0070658_10098349
414 Ga0070682_100134864
415 Ga0070660_100010562
416 Ga0070714_100001338
417 Ga0070713_100028200
418 Ga0070713_100038411
419 Ga0070708_100119044
420 Ga0070707_100027552
421 Ga0068851_10070461
422 Ga0081455_10000201
423 Ga0081455_10008042
424 Ga0081539_10001814
425 Ga0081539_10011267
426 Ga0075363_100011901
427 Ga0075428_100004176
428 Ga0075430_100024912
429 Ga0075430_100031834
430 Ga0075431_100012734
431 Ga0075431_100018219
432 Ga0075431_100223320
433 Ga0075429_100000202
434 Ga0075429_100021275
435 Ga0114129_10013772
436 Ga0114129_10079158
437 Ga0105239_10099992
438 Ga0157369_10020362
439 Ga0157372_10066099
440 Ga0157372_10248661
441 Ga0163163_10123733
442 Ga0213875_10000808
443 Ga0213875_10015826
444 Ga0209758_1027256
445 Ga0207426_1003281
446 Ga0207426_1007237
447 Ga0207647_10021472
448 Ga0207643_10064784
449 Ga0207705_10003580
450 Ga0207705_10108508
451 Ga0207660_10117346
452 Ga0207657_10027862
453 Ga0207646_10017111
454 Ga0207700_10020233
455 Ga0207700_10172899
456 Ga0207664_10001334
457 Ga0207708_10064539
458 Ga0209371_1010825
459 Ga0207428_10006783
460 Ga0265336_10004335
461 Ga0265338_10002448
462 Ga0307513_10037581
463 Ga0307508_10005893
464 Ga0307508_10114525
465 Ga0307514_10001356
466 Ga0316576_10004181
467 Ga0316576_10008268
468 Ga0316576_10012653
469 Ga0316576_10106475
470 Ga0316578_10020322
471 Ga0316578_10024249
472 Ga0316578_10046713
473 Ga0307516_10028208
474 Ga0307407_10010574
475 Ga0307407_10040038
476 Ga0307409_100001726
477 Ga0307409_100006090
478 Ga0307409_100031364
479 Ga0307409_100072130
480 Ga0307409_100191343
481 Ga0307415_100000663
482 Ga0316583_10001604
483 Ga0316585_10001603
484 Ga0316580_10007436
485 Ga0316580_10011622
486 Ga0307507_10000020
487 Ga0316574_0019512
488 Ga0316574_0033278
489 Ga0316582_0049420
490 Ga0316584_0009259
491 Ga0316584_0011790
492 Ga0316584_0083845
493 Ga0395898_0013213
494 Ga0395898_0034496
495 Ga0316581_0005597
496 Ga0436364_0315677
497 Ga0436364_0814106
498 Ga0395901_0105467
499 Ga0395901_0126491
500 Ga0439436_0011773
501 Ga0439433_0006962
502 Ga0439442_003959
503 Ga0439449_0000019
504 Ga0450903_000136
505 Ga0466969_0000484
506 Ga0466969_0019871
507 Ga0466969_0038122
508 Ga0466969_0045762
509 Ga0466972_0010232
510 Ga0466972_0029070
511 Ga0466966_0002796
512 Ga0466966_0006761
513 Ga0466966_0059278
514 Ga0466961_0000710
515 Ga0466961_0001715
516 Ga0466961_0005513
517 Ga0466963_0000594
518 Ga0466963_0001396
519 Ga0466963_0084643
520 Ga0466964_0017390
521 Ga0466971_0002739
522 Ga0466971_0024614
523 Ga0466971_0046981
524 Ga0466970_0001581
525 Ga0466970_0029003
526 Ga0466957_0000224
527 Ga0466959_0000203
528 Ga0466959_0001264
529 Ga0466959_0012690
530 Ga0466959_0013432
531 Ga0466959_0066989
532 Ga0466967_0107892
533 Ga0495627_020329
534 Ga0495592_0093865
535 Ga0495603_0007454
536 Ga0495603_0011895
537 Ga0495629_0004816
538 Ga0495629_0006615
539 Ga0495629_0014033
540 Ga0495629_0082883
541 Ga0495651_0004865
542 Ga0495651_0012257
543 Ga0495662_0000430
544 Ga0495662_0026817
545 Ga0495662_0046136
546 Ga0495664_0023174
547 Ga0495664_0035267
548 Ga0495664_0042799
549 Ga0495664_0053706
550 Ga0495664_0127428
551 Ga0495585_0004275
552 Ga0495594_0001993
553 Ga0495608_0001172
554 Ga0495628_0021995
555 Ga0495628_0030825
556 Ga0495628_0040116
557 Ga0495643_0003336
558 Ga0495648_0023401
559 Ga0495652_0003944
560 Ga0495652_0069782
561 Ga0495652_0083124
562 Ga0495665_0000918
563 Ga0495640_0009039
564 Ga0495667_0020375
565 Ga0495635_0008695
566 Ga0495588_0002727
567 Ga0495657_0007281
568 Ga0495657_0007584
569 Ga0495657_0018239
570 Ga0495599_0040244
571 Ga0495623_0020843
572 Ga0495646_0006801
573 Ga0495613_0008780
574 Ga0495613_0014823
575 Ga0495613_0023389
576 Ga0495624_0127918
577 Ga0495589_0022723
578 Ga0495604_0010791
579 Ga0495636_0002311
580 Ga0495676_0001986
581 Ga0495676_0010570
582 Ga0495676_0021404
583 Ga0495676_0136223
584 Ga0495680_0007232
585 Ga0495675_0002942
586 Ga0495675_0011355
587 Ga0495675_0015372
588 Ga0495675_0017054
589 Ga0495675_0026757
590 Ga0495593_0090551
591 Ga0495614_0002925
592 Ga0496101_0156506
593 Ga0496102_0003712
594 Ga0496102_0025849
595 Ga0496102_0032297
596 Ga0496102_0039514
597 Ga0496105_0071498
598 Ga0496106_0016057
599 Ga0496107_0015865
600 Ga0496109_0023692
601 Ga0496109_0192581
602 Ga0496110_0180480
603 Ga0496111_0042775
604 Ga0496113_0109049
605 Ga0496113_0164627
606 Ga0496114_0009019
607 Ga0496114_0048456
608 Ga0496114_0063903
609 Ga0496114_0172464
610 Ga0496119_0001318
611 Ga0501031_0030527
612 Ga0501031_0038382
613 Ga0501032_0020191
614 Ga0501032_0047099
615 Ga0501033_0006494
616 Ga0501033_0053341
617 Ga0501034_0000985
618 Ga0501034_0011203
619 Ga0501034_0042131
620 Ga0501034_0203563
621 Ga0501036_0025434
622 Ga0501036_0049343
623 Ga0501037_0006540
624 Ga0501038_0003825
625 Ga0501038_0037725
626 Ga0501038_0049663
627 Ga0501038_0140263
628 Ga0501039_0007880
629 Ga0501039_0034087
630 Ga0501040_0001026
631 Ga0501040_0003748
632 Ga0501040_0028250
633 Ga0501041_0006512
634 Ga0501041_0009555
635 Ga0501042_0035369
636 Ga0501042_0093799
637 Ga0501043_0022553
638 Ga0501043_0037949
639 Ga0501046_0041496
640 Ga0501046_0063988
641 Ga0501047_0000036
642 Ga0501047_0001597
643 Ga0501047_0005202
644 Ga0501047_0021858
645 Ga0501047_0045424
646 Ga0501048_0001798
647 Ga0501048_0031494
648 Ga0501048_0053863
649 Ga0501048_0074260
650 Ga0501068_0031334
651 Ga0501068_0039322
652 Ga0501070_0001961
653 Ga0501070_0034255
654 Ga0501070_0067927
655 Ga0501071_0002659
656 Ga0501072_0001891
657 Ga0501072_0010675
658 Ga0501074_0002509
659 Ga0501074_0099630
660 Ga0501075_0019033
661 Ga0501075_0026348
662 Ga0501076_0037312
663 Ga0501076_0077316
664 Ga0501077_0007631
665 Ga0501077_0041337
666 Ga0501077_0061951
667 Ga0501079_0013558
668 Ga0501079_0035156
669 Ga0501080_0025472
670 Ga0501083_0003907
671 Ga0501035_0004079
672 Ga0501035_0017573
673 Ga0501035_0036307
674 Ga0501035_0082511
675 Ga0501035_0120208
676 Ga0501044_0001014
677 Ga0501044_0004151
678 Ga0501044_0006307
679 Ga0501044_0067705
680 Ga0501044_0139208
681 Ga0501044_0189632
682 Ga0501045_0004185
683 Ga0501045_0081617
684 Ga0501045_0163043
685 nmdc:mga05p37_370_c1
686 nmdc:mga09592_735_c1
687 nmdc:mga09592_7673_c1
688 nmdc:mga0qj67_23099_c1
689 nmdc:mga0qj67_28158_c1
690 nmdc:mga06r32_123211_c1
691 nmdc:mga06r32_1733_c2
692 nmdc:mga06r32_33227_c1
693 nmdc:mga06r32_5063_c1
694 nmdc:mga08y16_7864_c1
695 Ga0495601_0012650
696 Ga0495601_0016323
697 Ga0495601_0038632
698 Ga0495612_0014182
699 Ga0501084_0042273
700 Ga0501084_0059711
701 Ga0501084_0085729
702 Ga0501082_0034881
703 Ga0466962_0000138
704 Ga0466962_0000221
705 Ga0466962_0012438
706 Ga0466962_0058423
707 Ga0530510_0036010
708 3006430190
709 2515719357
710 2515722084
711 2516083697
712 2516085692
713 2554260453
714 2585297030
715 2585307336
716 2585317516
717 2616699144
718 2616902413
719 2643761789
720 2643904144
721 2643943353
722 2644016638
723 2644174966
724 2644264874
725 2644388331
726 2644402499
727 2644430821
728 2644442500
729 2644445336
730 2644460784
731 2644626658
732 2729905325
733 2731906861
734 2768646256
735 2784472035
736 2784591193
737 2785372221
738 2786673301
739 2793985503
740 2799184079
741 2804848630
742 2808844675
743 2808914241
744 2809234766
745 2811843838
746 2812355276
747 2812477991
748 2816425634
749 2819699576
750 2819740184
751 2852638765
752 2862179166
753 2862180229
754 2862283991
755 2862293423
756 2862516572
757 2862576835
758 2862708046
759 2867352601
760 2867374455
761 2867434516
762 2867475821
763 2873318722
764 2875397364
765 2877678420
766 2912716920
767 2912729491
768 2912763598
769 2918507193
770 2919474950
771 2935391150
772 2935394480
773 2946047140
774 2946070615
775 2946078350
776 2947226198
777 2954010351
778 2954383367
779 2954679604
780 2954684551
781 2954694078
782 2954709185
783 2954713685
784 2954723648
785 2954738184
786 2954757044
787 2954761515
788 2966600154
789 2984579650
790 2990049175
791 2990257257
792 2997459498
793 2997602111
794 3001891316
795 3006327234
796 3006396819
797 3006486677
798 3006499623
799 8008490005
800 8008576519
801 8023624719
802 8025419103
803 8025529262
804 8025532773
805 8047895533
806 8048128987
807 8048363421
808 8048372557
809 8048381491
810 8054164358
811 8055174338
812 8056065490
813 8056449533
814 8056667080
815 8056829894

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01266

DAO

FAD dependent oxidoreductase

22

151

0.94

PF00890

FAD_binding_2

FAD binding domain

22

63

0.93

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

25

89

0.93

PF01593

Amino_oxidase

Flavin containing amine oxidoreductase

30

548

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j0e-assembly1.cif.gz_A crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p1 space group 0.9863 6 36
5vj7-assembly1.cif.gz_A ferredoxin nadp oxidoreductase (xfn) 0.9828 6 41
8ajj-assembly2.cif.gz_A-3 crystal structure of the disulfide reductase mera from staphylococcus aureus 0.9794 6 40
7bke-assembly1.cif.gz_a formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodisulfide reductase core and mobile arm in conformational state 2, composite structure) 0.9738 6 44
3fg2-assembly1.cif.gz_P crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris 0.972 6 40
ID Description Score Start End Superfamily
af_Q58065_4_310_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1 6 40 3.50.50.60
af_Q687X5_19_201_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9973 6 33 3.40.50.720
af_Q2G2C7_5_335_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9953 6 34 3.90.180.10
2cvjA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9872 8 36 3.50.50.60
2vq3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9863 7 33 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7Z0TM43-F1-model_v4 FAD-dependent oxidoreductase 0.9932 281 450
AF-A0A6I5D9H0-F1-model_v4 deleted 0.9739 1 281
AF-A0A7K2XHV1-F1-model_v4 Protoporphyrinogen oxidase 0.9686 86 205
AF-A0A6L6WXY7-F1-model_v4 Coproporphyrinogen III oxidase (EC 1.3.3.15) 0.9655 6 471 GO:0004729
GO:0005737
GO:0006783
AF-A0A7W0L2S1-F1-model_v4 Coproporphyrinogen III oxidase (EC 1.3.3.15) 0.9598 6 451 GO:0004729
GO:0005737
GO:0006783
GO:0070819

Map