F436645

General Info

Members Datasets Scaffolds Average Seq Length
408 243 816 293

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10041094|Ga0070677_100410942
Length 288
Sequence MAAMKSLAKAGTFKMGSRIVKRLGYGAMQLAGPGVFGPPKDRNAALAVLREVVASGLDHIDTSDFYGPHVTNQILREALHPYPKELVIVTKVGAKRGPQGSWEPAFSAEEITSAVHDNLRNLELDTLEVVNLRVMFAMGPAEGSIAAPLSALVRLQREGKIRHIGLSNVTAQQVEEGRAITEIVCVQNHYNLAHRSDDRLIDSLASAGIAYVPFFPLGGFSPLQSTVLSDVATKLGATPMQVALAWLLRRSPNILLIPGTSSIDHLRENLAAAELELPADAMTSLERI

Samples

Sample ID Description Type Environment
1 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
45 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
52 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
89 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
101 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
115 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
139 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
168 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
171 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
172 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
178 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
194 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
207 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
208 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
209 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
210 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
211 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
212 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
213 2643221645 Massilia sp. Root351 Isolate Unclassified
214 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
215 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
216 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
217 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
218 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
219 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
220 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
221 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
222 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
223 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
224 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
225 2818991450 Burkholderia sp. 604 Isolate Unclassified
226 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
227 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
228 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
229 2884411467 Dyella sp. AD56 Isolate Rhizosphere
230 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
231 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
232 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
233 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
234 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
235 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
236 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
237 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
238 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
239 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
240 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
241 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
242 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
243 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.44
Metatranscriptomes 0.25
Isolates 9.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.13
Nodule 3.19
Rhizoplane 1.23
Rhizosphere 79.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10041094 3300005333 Bacteria 1824
2 JGI24739J22299_10010377 3300001989 Bacteria 3459
3 JGI25156J39149_1000616 3300002705 Bacteria 19598
4 JGI25406J46586_10021803 3300003203 Bacteria 2564
5 JGI25165J46597_1000492 3300003214 Bacteria 38146
6 rootH1_10092349 3300003323 Bacteria 2984
7 Ga0055533_1000106 3300003756 Bacteria 104514
8 Ga0055533_1002867 3300003756 Bacteria 3718
9 Ga0055532_1000003 3300003758 Bacteria 494004
10 Ga0055527_1000006 3300003760 Bacteria 494004
11 Ga0055535_1000003 3300003761 Bacteria 494004
12 Ga0055542_1000007 3300003762 Bacteria 494004
13 Ga0055529_1000003 3300003763 Bacteria 494004
14 Ga0055531_10001879 3300003794 Bacteria 14715
15 Ga0070682_100141430 3300005337 Bacteria 1641
16 Ga0070668_100005343 3300005347 Bacteria 9534
17 Ga0070667_100129409 3300005367 Bacteria 2202
18 Ga0070681_10118628 3300005458 Bacteria 2582
19 Ga0070665_100033990 3300005548 Bacteria 5128
20 Ga0068855_100035884 3300005563 Bacteria 5904
21 Ga0068855_100098413 3300005563 Bacteria 3370
22 Ga0068857_100285735 3300005577 Bacteria 1518
23 Ga0068856_100337895 3300005614 Bacteria 1524
24 Ga0068859_100000776 3300005617 Bacteria 32237
25 Ga0068851_10164929 3300005834 Bacteria 1219
26 Ga0068858_100056903 3300005842 Bacteria 3614
27 Ga0068860_100135524 3300005843 Bacteria 2364
28 Ga0081539_10008055 3300005985 Bacteria 9335
29 Ga0070716_100122162 3300006173 Bacteria 1632
30 Ga0075434_100025950 3300006871 Bacteria 5737
31 Ga0068865_100002909 3300006881 Bacteria 10213
32 Ga0097620_100000776 3300006931 Bacteria 32237
33 Ga0075435_100232079 3300007076 Bacteria 1568
34 Ga0105240_10015865 3300009093 Bacteria 10221
35 Ga0105240_10061613 3300009093 Bacteria 4675
36 Ga0105247_10073171 3300009101 Bacteria 2147
37 Ga0114129_10465010 3300009147 Bacteria 1657
38 Ga0105237_10072104 3300009545 Bacteria 3448
39 Ga0105237_10267452 3300009545 Bacteria 1713
40 Ga0105237_10330397 3300009545 Bacteria 1529
41 Ga0105238_10087123 3300009551 Bacteria 3110
42 Ga0105239_10302162 3300010375 Bacteria 1802
43 Ga0157370_10186441 3300013104 Bacteria 1926
44 Ga0157369_10005727 3300013105 Bacteria 14436
45 Ga0157369_10163353 3300013105 Bacteria 2349
46 Ga0157372_10166761 3300013307 Bacteria 2547
47 Ga0157372_10947722 3300013307 Bacteria 998
48 Ga0157379_10099917 3300014968 Bacteria 2605
49 Ga0157376_10210893 3300014969 Bacteria 1793
50 Ga0182007_10000313 3300015262 Bacteria 30902
51 Ga0213872_10006515 3300021361 Bacteria 5845
52 Ga0213872_10030010 3300021361 Bacteria 2493
53 Ga0209674_100025 3300025226 Bacteria 515942
54 Ga0209672_100002 3300025228 Bacteria 1733325
55 Ga0209147_100003 3300025229 Bacteria 1733325
56 Ga0209563_101327 3300025230 Bacteria 6738
57 Ga0207427_101885 3300025231 Bacteria 6601
58 Ga0209258_100005 3300025242 Bacteria 1087938
59 Ga0209026_1008048 3300025250 Bacteria 2262
60 Ga0209677_110705 3300025253 Bacteria 1498
61 Ga0209148_1000006 3300025254 Bacteria 1733325
62 Ga0209759_1000006 3300025256 Bacteria 492407
63 Ga0209759_1000086 3300025256 Bacteria 167075
64 Ga0209759_1001197 3300025256 Bacteria 16140
65 Ga0209233_1000018 3300025261 Bacteria 886857
66 Ga0209455_1000003 3300025272 Bacteria 1471893
67 Ga0209455_1000218 3300025272 Bacteria 79966
68 Ga0209673_1023608 3300025273 Bacteria 2089
69 Ga0209050_1001205 3300025298 Bacteria 30315
70 Ga0209256_1000437 3300025299 Bacteria 64248
71 Ga0209051_1005117 3300025303 Bacteria 7787
72 Ga0209257_1000479 3300025304 Bacteria 72716
73 Ga0207656_10119618 3300025321 Bacteria 1225
74 Ga0207713_1001596 3300025735 Bacteria 17724
75 Ga0207647_10027253 3300025904 Bacteria 3727
76 Ga0207647_10080740 3300025904 Bacteria 1950
77 Ga0207647_10082072 3300025904 Bacteria 1931
78 Ga0207707_10020449 3300025912 Bacteria 5781
79 Ga0207695_10064613 3300025913 Bacteria 3766
80 Ga0207671_10287320 3300025914 Bacteria 1298
81 Ga0207660_10103853 3300025917 Bacteria 2127
82 Ga0207704_10153816 3300025938 Bacteria 1627
83 Ga0207704_10158521 3300025938 Bacteria 1607
84 Ga0207667_10025316 3300025949 Bacteria 6497
85 Ga0207667_10107629 3300025949 Bacteria 2876
86 Ga0207668_10006252 3300025972 Bacteria 7035
87 Ga0207640_10050497 3300025981 Bacteria 2699
88 Ga0207658_10251058 3300025986 Bacteria 1503
89 Ga0207678_10052904 3300026067 Bacteria 3501
90 Ga0207702_10002786 3300026078 Bacteria 16383
91 Ga0265356_1000148 3300028017 Bacteria 12602
92 Ga0268264_10012782 3300028381 Bacteria 6909
93 Ga0265338_10000325 3300028800 Bacteria 86856
94 Ga0265760_10015115 3300031090 Bacteria 2212
95 Ga0307408_100028018 3300031548 Bacteria 3889
96 Ga0307405_10066283 3300031731 Bacteria 2302
97 Ga0307412_10000002 3300031911 Bacteria 743446
98 Ga0307411_10076605 3300032005 Bacteria 2287
99 Ga0395899_0000018 3300037312 Bacteria 423194
100 Ga0395905_0000039 3300037471 Bacteria 253197
101 Ga0395901_0326264 3300038443 Bacteria 1588
102 Ga0436361_0118308 3300039447 Bacteria 2024
103 Ga0436361_0451010 3300039447 Bacteria 8636
104 Ga0436361_1012054 3300039447 Bacteria 3663
105 Ga0439452_025335 3300042010 Bacteria 1507
106 Ga0466982_0004950 3300044672 Bacteria 6151
107 Ga0466966_0106311 3300044684 Bacteria 1732
108 Ga0466961_0004292 3300044693 Bacteria 8926
109 Ga0466961_0166134 3300044693 Bacteria 1374
110 Ga0466963_0229529 3300044694 Bacteria 1301
111 Ga0466971_0120898 3300044719 Bacteria 1212
112 Ga0466970_0149260 3300044765 Bacteria 1290
113 Ga0466957_0143908 3300044842 Bacteria 1538
114 Ga0466960_0008234 3300044901 Bacteria 4263
115 Ga0466958_0001035 3300045836 Bacteria 12709
116 Ga0466958_0061920 3300045836 Bacteria 2280
117 Ga0495592_0027540 3300046454 Bacteria 4308
118 Ga0495592_0092645 3300046454 Bacteria 2165
119 Ga0495603_0001966 3300046455 Bacteria 12112
120 Ga0495603_0059289 3300046455 Bacteria 2263
121 Ga0495590_0008566 3300046457 Bacteria 3904
122 Ga0495591_000055 3300046458 Bacteria 135355
123 Ga0495591_000644 3300046458 Bacteria 25785
124 Ga0495591_003404 3300046458 Bacteria 8240
125 Ga0495591_009689 3300046458 Bacteria 3803
126 Ga0495629_0000031 3300046459 Bacteria 124543
127 Ga0495629_0005434 3300046459 Bacteria 9498
128 Ga0495629_0006054 3300046459 Bacteria 8988
129 Ga0495629_0022984 3300046459 Bacteria 4444
130 Ga0495638_0032420 3300046460 Bacteria 3349
131 Ga0495641_0036108 3300046461 Bacteria 2325
132 Ga0495651_0044167 3300046462 Bacteria 3454
133 Ga0495653_0002304 3300046463 Bacteria 15123
134 Ga0495653_0005627 3300046463 Bacteria 10228
135 Ga0495653_0102515 3300046463 Bacteria 2071
136 Ga0495653_0107661 3300046463 Bacteria 2008
137 Ga0495650_0000316 3300046471 Bacteria 86653
138 Ga0495650_0008503 3300046471 Bacteria 5975
139 Ga0495580_0000310 3300046472 Bacteria 39754
140 Ga0495580_0000442 3300046472 Bacteria 34202
141 Ga0495580_0006600 3300046472 Bacteria 9431
142 Ga0495580_0039771 3300046472 Bacteria 3364
143 Ga0495580_0167245 3300046472 Bacteria 1521
144 Ga0495580_0169535 3300046472 Bacteria 1509
145 Ga0495582_0008041 3300046473 Bacteria 5821
146 Ga0495582_0101934 3300046473 Bacteria 1607
147 Ga0495582_0179390 3300046473 Bacteria 1206
148 Ga0495605_0000007 3300046474 Bacteria 358289
149 Ga0495605_0000688 3300046474 Bacteria 25300
150 Ga0495605_0004538 3300046474 Bacteria 8133
151 Ga0495605_0008098 3300046474 Bacteria 5945
152 Ga0495664_0010897 3300046477 Bacteria 5112
153 Ga0495584_0004381 3300046491 Bacteria 7604
154 Ga0495594_0010000 3300046499 Bacteria 4914
155 Ga0495596_0008066 3300046500 Bacteria 4703
156 Ga0495596_0017803 3300046500 Bacteria 2936
157 Ga0495596_0050248 3300046500 Bacteria 1634
158 Ga0495607_0010501 3300046501 Bacteria 6222
159 Ga0495607_0077391 3300046501 Bacteria 1837
160 Ga0495607_0160157 3300046501 Bacteria 1144
161 Ga0495583_0000007 3300046506 Bacteria 434661
162 Ga0495583_0000848 3300046506 Bacteria 37200
163 Ga0495583_0014646 3300046506 Bacteria 4314
164 Ga0495606_0000281 3300046507 Bacteria 88474
165 Ga0495606_0015538 3300046507 Bacteria 5858
166 Ga0495606_0027096 3300046507 Bacteria 4069
167 Ga0495608_0078871 3300046511 Bacteria 2141
168 Ga0495610_0009281 3300046512 Bacteria 6236
169 Ga0495610_0127109 3300046512 Bacteria 1110
170 Ga0495616_0044991 3300046513 Bacteria 2236
171 Ga0495618_0004949 3300046514 Bacteria 8144
172 Ga0495618_0024415 3300046514 Bacteria 3743
173 Ga0495618_0077070 3300046514 Bacteria 2124
174 Ga0495618_0082858 3300046514 Bacteria 2048
175 Ga0495620_0000110 3300046515 Bacteria 65755
176 Ga0495620_0004123 3300046515 Bacteria 8247
177 Ga0495628_0002024 3300046516 Bacteria 18373
178 Ga0495628_0010253 3300046516 Bacteria 7969
179 Ga0495628_0122098 3300046516 Bacteria 1997
180 Ga0495628_0130143 3300046516 Bacteria 1925
181 Ga0495628_0358751 3300046516 Bacteria 1070
182 Ga0495630_0002742 3300046517 Bacteria 12221
183 Ga0495630_0003392 3300046517 Bacteria 11096
184 Ga0495630_0017212 3300046517 Bacteria 5292
185 Ga0495630_0220926 3300046517 Bacteria 1446
186 Ga0495631_0022920 3300046518 Bacteria 2900
187 Ga0495631_0024087 3300046518 Bacteria 2814
188 Ga0495632_0007793 3300046519 Bacteria 6673
189 Ga0495632_0050733 3300046519 Bacteria 2044
190 Ga0495632_0059143 3300046519 Bacteria 1865
191 Ga0495632_0075924 3300046519 Bacteria 1608
192 Ga0495637_0001570 3300046520 Bacteria 13299
193 Ga0495637_0001761 3300046520 Bacteria 12408
194 Ga0495643_0056552 3300046522 Bacteria 2094
195 Ga0495643_0058648 3300046522 Bacteria 2048
196 Ga0495644_0046470 3300046523 Bacteria 1631
197 Ga0495648_0001324 3300046524 Bacteria 24557
198 Ga0495648_0010438 3300046524 Bacteria 7075
199 Ga0495648_0016068 3300046524 Bacteria 5404
200 Ga0495648_0047480 3300046524 Bacteria 2653
201 Ga0495648_0170105 3300046524 Bacteria 1117
202 Ga0495666_0004866 3300046526 Bacteria 6789
203 Ga0495666_0007264 3300046526 Bacteria 5557
204 Ga0495666_0009818 3300046526 Bacteria 4783
205 Ga0495666_0124634 3300046526 Bacteria 1205
206 Ga0495652_0006700 3300046529 Bacteria 10692
207 Ga0495652_0040343 3300046529 Bacteria 4035
208 Ga0495652_0058891 3300046529 Bacteria 3251
209 Ga0495654_0002972 3300046530 Bacteria 10609
210 Ga0495654_0006577 3300046530 Bacteria 6583
211 Ga0495654_0037855 3300046530 Bacteria 2415
212 Ga0495665_0005375 3300046531 Bacteria 6904
213 Ga0495665_0037827 3300046531 Bacteria 2575
214 Ga0495640_0046287 3300046533 Bacteria 3014
215 Ga0495586_0005006 3300046535 Bacteria 7092
216 Ga0495586_0041496 3300046535 Bacteria 2478
217 Ga0495587_0012657 3300046536 Bacteria 5305
218 Ga0495609_0000004 3300046538 Bacteria 697346
219 Ga0495609_0000188 3300046538 Bacteria 61830
220 Ga0495609_0015847 3300046538 Bacteria 3522
221 Ga0495597_0000467 3300046542 Bacteria 34288
222 Ga0495597_0001306 3300046542 Bacteria 18280
223 Ga0495645_0001666 3300046543 Bacteria 15092
224 Ga0495645_0145529 3300046543 Bacteria 1651
225 Ga0495622_0029251 3300046557 Bacteria 2574
226 Ga0495633_0000020 3300046558 Bacteria 227180
227 Ga0495633_0017564 3300046558 Bacteria 3654
228 Ga0495667_0044559 3300046559 Bacteria 2938
229 Ga0495668_0005036 3300046616 Bacteria 9105
230 Ga0495668_0007537 3300046616 Bacteria 6943
231 Ga0495634_0005210 3300046642 Bacteria 10045
232 Ga0495634_0072434 3300046642 Bacteria 2266
233 Ga0495634_0202454 3300046642 Bacteria 1232
234 Ga0495611_0023398 3300046648 Bacteria 2680
235 Ga0495611_0053370 3300046648 Bacteria 1824
236 Ga0495611_0135742 3300046648 Bacteria 1148
237 Ga0495625_0000004 3300046660 Bacteria 611314
238 Ga0495635_0017117 3300046663 Bacteria 5063
239 Ga0495635_0043863 3300046663 Bacteria 3085
240 Ga0495661_0000006 3300046665 Bacteria 427288
241 Ga0495661_0000009 3300046665 Bacteria 291327
242 Ga0495661_0003186 3300046665 Bacteria 12266
243 Ga0495661_0056089 3300046665 Bacteria 2358
244 Ga0495588_0008274 3300046674 Bacteria 4766
245 Ga0495657_0039157 3300046675 Bacteria 3259
246 Ga0495657_0163978 3300046675 Bacteria 1373
247 Ga0495599_0022450 3300046678 Bacteria 3939
248 Ga0495599_0025052 3300046678 Bacteria 3733
249 Ga0495599_0056764 3300046678 Bacteria 2450
250 Ga0495623_0006463 3300046679 Bacteria 7629
251 Ga0495623_0007438 3300046679 Bacteria 7110
252 Ga0495623_0009674 3300046679 Bacteria 6258
253 Ga0495623_0039453 3300046679 Bacteria 3017
254 Ga0495646_0000947 3300046680 Bacteria 16527
255 Ga0495646_0004463 3300046680 Bacteria 8814
256 Ga0495646_0007123 3300046680 Bacteria 7105
257 Ga0495646_0021475 3300046680 Bacteria 4076
258 Ga0495646_0023659 3300046680 Bacteria 3867
259 Ga0495646_0082192 3300046680 Bacteria 1874
260 Ga0495624_0003069 3300046690 Bacteria 12504
261 Ga0495624_0004592 3300046690 Bacteria 10077
262 Ga0495624_0004820 3300046690 Bacteria 9810
263 Ga0495671_0004461 3300046692 Bacteria 8369
264 Ga0495671_0012420 3300046692 Bacteria 4653
265 Ga0495671_0051431 3300046692 Bacteria 2049
266 Ga0495649_0041880 3300046694 Bacteria 2503
267 Ga0495589_0001222 3300046794 Bacteria 15244
268 Ga0495589_0007080 3300046794 Bacteria 5879
269 Ga0495589_0016648 3300046794 Bacteria 3777
270 Ga0495589_0137730 3300046794 Bacteria 1170
271 Ga0495600_0004853 3300046809 Bacteria 8074
272 Ga0495660_0000741 3300046810 Bacteria 24710
273 Ga0495660_0064400 3300046810 Bacteria 1959
274 Ga0495660_0074658 3300046810 Bacteria 1791
275 Ga0495581_0003818 3300047315 Bacteria 8664
276 Ga0495581_0010402 3300047315 Bacteria 5382
277 Ga0495581_0056749 3300047315 Bacteria 2260
278 Ga0495604_0000745 3300047317 Bacteria 27317
279 Ga0495604_0011048 3300047317 Bacteria 7167
280 Ga0495604_0017087 3300047317 Bacteria 5804
281 Ga0495604_0196035 3300047317 Bacteria 1404
282 Ga0495674_0016136 3300047319 Bacteria 6971
283 Ga0495674_0050541 3300047319 Bacteria 3668
284 Ga0495674_0077968 3300047319 Bacteria 2848
285 Ga0495672_0012099 3300047320 Bacteria 6042
286 Ga0495672_0012358 3300047320 Bacteria 5961
287 Ga0495672_0015413 3300047320 Bacteria 5190
288 Ga0495672_0091746 3300047320 Bacteria 1666
289 Ga0495676_0000493 3300047321 Bacteria 32407
290 Ga0495676_0016267 3300047321 Bacteria 6605
291 Ga0495676_0081056 3300047321 Bacteria 2461
292 Ga0495676_0086242 3300047321 Bacteria 2363
293 Ga0495680_0003122 3300047322 Bacteria 16496
294 Ga0495680_0130897 3300047322 Bacteria 1843
295 Ga0495683_0000003 3300047323 Bacteria 383992
296 Ga0495683_0001914 3300047323 Bacteria 13001
297 Ga0495683_0002324 3300047323 Bacteria 11555
298 Ga0495683_0096265 3300047323 Bacteria 1428
299 Ga0495687_023573 3300047443 Bacteria 2938
300 Ga0495675_0007759 3300047444 Bacteria 6621
301 Ga0495675_0043759 3300047444 Bacteria 2852
302 Ga0495675_0089568 3300047444 Bacteria 1931
303 Ga0495675_0209331 3300047444 Bacteria 1184
304 Ga0495679_000006 3300047446 Bacteria 449956
305 Ga0495679_000015 3300047446 Bacteria 287256
306 Ga0495679_000122 3300047446 Bacteria 68748
307 Ga0495679_000599 3300047446 Bacteria 24563
308 Ga0495679_005235 3300047446 Bacteria 5790
309 Ga0495673_0002158 3300047469 Bacteria 14281
310 Ga0495673_0007145 3300047469 Bacteria 6460
311 Ga0495673_0013562 3300047469 Bacteria 4275
312 Ga0495673_0020783 3300047469 Bacteria 3260
313 Ga0495681_0005337 3300047470 Bacteria 8620
314 Ga0495681_0009073 3300047470 Bacteria 6165
315 Ga0495684_0017524 3300047471 Bacteria 5514
316 Ga0495684_0193621 3300047471 Bacteria 1502
317 Ga0495686_0000099 3300047472 Bacteria 180546
318 Ga0495686_0116331 3300047472 Bacteria 1598
319 Ga0495593_0002281 3300047673 Bacteria 11501
320 Ga0495593_0025920 3300047673 Bacteria 3243
321 Ga0495593_0033702 3300047673 Bacteria 2788
322 Ga0495602_0025980 3300048088 Bacteria 5657
323 Ga0495602_0026203 3300048088 Bacteria 5626
324 Ga0495602_0329631 3300048088 Bacteria 1107
325 Ga0495614_0000386 3300048089 Bacteria 17870
326 Ga0495614_0010541 3300048089 Bacteria 4075
327 Ga0495626_0000201 3300048091 Bacteria 72576
328 Ga0495626_0007475 3300048091 Bacteria 6079
329 Ga0496102_0115698 3300048905 Bacteria 2502
330 Ga0496104_0000016 3300048907 Bacteria 335025
331 Ga0496105_0000010 3300048908 Bacteria 309880
332 Ga0496115_0000544 3300048918 Bacteria 29353
333 Ga0496116_0010692 3300048919 Bacteria 7663
334 Ga0496117_0005723 3300048920 Bacteria 12925
335 Ga0496117_0012367 3300048920 Bacteria 7532
336 Ga0496118_0002759 3300048921 Bacteria 23058
337 Ga0496118_0009927 3300048921 Bacteria 9511
338 Ga0496118_0010169 3300048921 Bacteria 9347
339 Ga0496118_0017426 3300048921 Bacteria 6538
340 Ga0496119_0002615 3300048922 Bacteria 19529
341 Ga0496120_0000015 3300048923 Bacteria 310795
342 Ga0496121_0000985 3300048924 Bacteria 51003
343 Ga0496121_0013089 3300048924 Bacteria 8955
344 Ga0496122_0024500 3300048925 Bacteria 5278
345 Ga0496123_0143545 3300048926 Bacteria 1300
346 Ga0496124_0000383 3300048927 Bacteria 80834
347 Ga0496124_0269096 3300048927 Bacteria 1249
348 Ga0496126_0000102 3300048929 Bacteria 201540
349 Ga0496126_0006025 3300048929 Bacteria 13609
350 Ga0496126_0019611 3300048929 Bacteria 6658
351 Ga0495678_000007 3300049459 Bacteria 448039
352 Ga0495678_000394 3300049459 Bacteria 44121
353 Ga0495678_012135 3300049459 Bacteria 4092
354 Ga0495678_030139 3300049459 Bacteria 2272
355 Ga0495682_0018900 3300049460 Bacteria 2594
356 Ga0501031_0174233 3300049568 Bacteria 1405
357 Ga0501033_0077031 3300049570 Bacteria 2447
358 Ga0501033_0284111 3300049570 Bacteria 1168
359 Ga0501043_0167156 3300049579 Bacteria 1717
360 Ga0501046_0046415 3300049580 Bacteria 3448
361 Ga0501047_0040463 3300049581 Bacteria 4508
362 Ga0501047_0046890 3300049581 Bacteria 4175
363 Ga0501070_0048584 3300049586 Bacteria 3524
364 Ga0501241_005206 3300049758 Bacteria 2426
365 Ga0501035_0024057 3300049822 Bacteria 5589
366 Ga0501035_0127149 3300049822 Bacteria 2224
367 Ga0501044_0003627 3300049823 Bacteria 17369
368 Ga0501044_0462303 3300049823 Bacteria 1174
369 nmdc:mga0n895_16777_c1 3300050512 Bacteria 6730
370 nmdc:mga0rr50_219769_c1 3300050513 Bacteria 1568
371 2509127054 2508501125 Bacteria 7208311
372 2510246680 2510065045 Bacteria 7761063
373 2512350361 2512047030 Bacteria 9031815
374 2513591833 2513237087 Bacteria 5817514
375 2513961085 2513237151 Bacteria 6309801
376 2514052294 2513237166 Bacteria 10373764
377 2600815205 2600255067 Bacteria 6795583
378 2644251636 2643221645 Bacteria 7207331
379 2719644005 2718217991 Bacteria 7829542
380 2738822099 2738541296 Bacteria 7285013
381 2738834581 2738541298 Bacteria 7286732
382 2738875785 2738541306 Bacteria 7284992
383 2739187737 2738543002 Bacteria 7284546
384 2739222383 2738543008 Bacteria 7282815
385 2746091144 2744054900 Bacteria 8399525
386 2746097576 2744054901 Bacteria 8397047
387 2808974220 2808606384 Bacteria 8474373
388 2809009006 2808606390 Bacteria 8476311
389 2809016157 2808606391 Bacteria 8308166
390 2819620475 2818991450 Bacteria 6962147
391 2842330854 2842324504 Bacteria 9364110
392 2842355193 2842348783 Bacteria 9002918
393 2842456132 2842454564 Bacteria 8730687
394 2884414184 2884411467 Bacteria 5246714
395 2885279377 2885270888 Bacteria 9831543
396 2900640384 2900634093 Bacteria 10263517
397 2904616740 2904615490 Bacteria 10047340
398 2919528066 2919527303 Bacteria 7718827
399 2928108923 2928108538 Bacteria 7360024
400 2928136147 2928135762 Bacteria 7259641
401 2928504072 2928503688 Bacteria 7268108
402 2945938449 2945934425 Bacteria 7444609
403 2990708451 2990703756 Bacteria 7715990
404 642423581 641736151 Bacteria 7477263
405 642598206 642555112 Bacteria 8676562
406 642616974 642555113 Bacteria 8214658
407 8055268695 8055266321 Bacteria 7999742
408 8055304716 8055301274 Bacteria 8587385
409 Ga0070677_10041094
410 JGI24739J22299_10010377
411 JGI25156J39149_1000616
412 JGI25406J46586_10021803
413 JGI25165J46597_1000492
414 rootH1_10092349
415 Ga0055533_1000106
416 Ga0055533_1002867
417 Ga0055532_1000003
418 Ga0055527_1000006
419 Ga0055535_1000003
420 Ga0055542_1000007
421 Ga0055529_1000003
422 Ga0055531_10001879
423 Ga0070682_100141430
424 Ga0070668_100005343
425 Ga0070667_100129409
426 Ga0070681_10118628
427 Ga0070665_100033990
428 Ga0068855_100035884
429 Ga0068855_100098413
430 Ga0068857_100285735
431 Ga0068856_100337895
432 Ga0068859_100000776
433 Ga0068851_10164929
434 Ga0068858_100056903
435 Ga0068860_100135524
436 Ga0081539_10008055
437 Ga0070716_100122162
438 Ga0075434_100025950
439 Ga0068865_100002909
440 Ga0097620_100000776
441 Ga0075435_100232079
442 Ga0105240_10015865
443 Ga0105240_10061613
444 Ga0105247_10073171
445 Ga0114129_10465010
446 Ga0105237_10072104
447 Ga0105237_10267452
448 Ga0105237_10330397
449 Ga0105238_10087123
450 Ga0105239_10302162
451 Ga0157370_10186441
452 Ga0157369_10005727
453 Ga0157369_10163353
454 Ga0157372_10166761
455 Ga0157372_10947722
456 Ga0157379_10099917
457 Ga0157376_10210893
458 Ga0182007_10000313
459 Ga0213872_10006515
460 Ga0213872_10030010
461 Ga0209674_100025
462 Ga0209672_100002
463 Ga0209147_100003
464 Ga0209563_101327
465 Ga0207427_101885
466 Ga0209258_100005
467 Ga0209026_1008048
468 Ga0209677_110705
469 Ga0209148_1000006
470 Ga0209759_1000006
471 Ga0209759_1000086
472 Ga0209759_1001197
473 Ga0209233_1000018
474 Ga0209455_1000003
475 Ga0209455_1000218
476 Ga0209673_1023608
477 Ga0209050_1001205
478 Ga0209256_1000437
479 Ga0209051_1005117
480 Ga0209257_1000479
481 Ga0207656_10119618
482 Ga0207713_1001596
483 Ga0207647_10027253
484 Ga0207647_10080740
485 Ga0207647_10082072
486 Ga0207707_10020449
487 Ga0207695_10064613
488 Ga0207671_10287320
489 Ga0207660_10103853
490 Ga0207704_10153816
491 Ga0207704_10158521
492 Ga0207667_10025316
493 Ga0207667_10107629
494 Ga0207668_10006252
495 Ga0207640_10050497
496 Ga0207658_10251058
497 Ga0207678_10052904
498 Ga0207702_10002786
499 Ga0265356_1000148
500 Ga0268264_10012782
501 Ga0265338_10000325
502 Ga0265760_10015115
503 Ga0307408_100028018
504 Ga0307405_10066283
505 Ga0307412_10000002
506 Ga0307411_10076605
507 Ga0395899_0000018
508 Ga0395905_0000039
509 Ga0395901_0326264
510 Ga0436361_0118308
511 Ga0436361_0451010
512 Ga0436361_1012054
513 Ga0439452_025335
514 Ga0466982_0004950
515 Ga0466966_0106311
516 Ga0466961_0004292
517 Ga0466961_0166134
518 Ga0466963_0229529
519 Ga0466971_0120898
520 Ga0466970_0149260
521 Ga0466957_0143908
522 Ga0466960_0008234
523 Ga0466958_0001035
524 Ga0466958_0061920
525 Ga0495592_0027540
526 Ga0495592_0092645
527 Ga0495603_0001966
528 Ga0495603_0059289
529 Ga0495590_0008566
530 Ga0495591_000055
531 Ga0495591_000644
532 Ga0495591_003404
533 Ga0495591_009689
534 Ga0495629_0000031
535 Ga0495629_0005434
536 Ga0495629_0006054
537 Ga0495629_0022984
538 Ga0495638_0032420
539 Ga0495641_0036108
540 Ga0495651_0044167
541 Ga0495653_0002304
542 Ga0495653_0005627
543 Ga0495653_0102515
544 Ga0495653_0107661
545 Ga0495650_0000316
546 Ga0495650_0008503
547 Ga0495580_0000310
548 Ga0495580_0000442
549 Ga0495580_0006600
550 Ga0495580_0039771
551 Ga0495580_0167245
552 Ga0495580_0169535
553 Ga0495582_0008041
554 Ga0495582_0101934
555 Ga0495582_0179390
556 Ga0495605_0000007
557 Ga0495605_0000688
558 Ga0495605_0004538
559 Ga0495605_0008098
560 Ga0495664_0010897
561 Ga0495584_0004381
562 Ga0495594_0010000
563 Ga0495596_0008066
564 Ga0495596_0017803
565 Ga0495596_0050248
566 Ga0495607_0010501
567 Ga0495607_0077391
568 Ga0495607_0160157
569 Ga0495583_0000007
570 Ga0495583_0000848
571 Ga0495583_0014646
572 Ga0495606_0000281
573 Ga0495606_0015538
574 Ga0495606_0027096
575 Ga0495608_0078871
576 Ga0495610_0009281
577 Ga0495610_0127109
578 Ga0495616_0044991
579 Ga0495618_0004949
580 Ga0495618_0024415
581 Ga0495618_0077070
582 Ga0495618_0082858
583 Ga0495620_0000110
584 Ga0495620_0004123
585 Ga0495628_0002024
586 Ga0495628_0010253
587 Ga0495628_0122098
588 Ga0495628_0130143
589 Ga0495628_0358751
590 Ga0495630_0002742
591 Ga0495630_0003392
592 Ga0495630_0017212
593 Ga0495630_0220926
594 Ga0495631_0022920
595 Ga0495631_0024087
596 Ga0495632_0007793
597 Ga0495632_0050733
598 Ga0495632_0059143
599 Ga0495632_0075924
600 Ga0495637_0001570
601 Ga0495637_0001761
602 Ga0495643_0056552
603 Ga0495643_0058648
604 Ga0495644_0046470
605 Ga0495648_0001324
606 Ga0495648_0010438
607 Ga0495648_0016068
608 Ga0495648_0047480
609 Ga0495648_0170105
610 Ga0495666_0004866
611 Ga0495666_0007264
612 Ga0495666_0009818
613 Ga0495666_0124634
614 Ga0495652_0006700
615 Ga0495652_0040343
616 Ga0495652_0058891
617 Ga0495654_0002972
618 Ga0495654_0006577
619 Ga0495654_0037855
620 Ga0495665_0005375
621 Ga0495665_0037827
622 Ga0495640_0046287
623 Ga0495586_0005006
624 Ga0495586_0041496
625 Ga0495587_0012657
626 Ga0495609_0000004
627 Ga0495609_0000188
628 Ga0495609_0015847
629 Ga0495597_0000467
630 Ga0495597_0001306
631 Ga0495645_0001666
632 Ga0495645_0145529
633 Ga0495622_0029251
634 Ga0495633_0000020
635 Ga0495633_0017564
636 Ga0495667_0044559
637 Ga0495668_0005036
638 Ga0495668_0007537
639 Ga0495634_0005210
640 Ga0495634_0072434
641 Ga0495634_0202454
642 Ga0495611_0023398
643 Ga0495611_0053370
644 Ga0495611_0135742
645 Ga0495625_0000004
646 Ga0495635_0017117
647 Ga0495635_0043863
648 Ga0495661_0000006
649 Ga0495661_0000009
650 Ga0495661_0003186
651 Ga0495661_0056089
652 Ga0495588_0008274
653 Ga0495657_0039157
654 Ga0495657_0163978
655 Ga0495599_0022450
656 Ga0495599_0025052
657 Ga0495599_0056764
658 Ga0495623_0006463
659 Ga0495623_0007438
660 Ga0495623_0009674
661 Ga0495623_0039453
662 Ga0495646_0000947
663 Ga0495646_0004463
664 Ga0495646_0007123
665 Ga0495646_0021475
666 Ga0495646_0023659
667 Ga0495646_0082192
668 Ga0495624_0003069
669 Ga0495624_0004592
670 Ga0495624_0004820
671 Ga0495671_0004461
672 Ga0495671_0012420
673 Ga0495671_0051431
674 Ga0495649_0041880
675 Ga0495589_0001222
676 Ga0495589_0007080
677 Ga0495589_0016648
678 Ga0495589_0137730
679 Ga0495600_0004853
680 Ga0495660_0000741
681 Ga0495660_0064400
682 Ga0495660_0074658
683 Ga0495581_0003818
684 Ga0495581_0010402
685 Ga0495581_0056749
686 Ga0495604_0000745
687 Ga0495604_0011048
688 Ga0495604_0017087
689 Ga0495604_0196035
690 Ga0495674_0016136
691 Ga0495674_0050541
692 Ga0495674_0077968
693 Ga0495672_0012099
694 Ga0495672_0012358
695 Ga0495672_0015413
696 Ga0495672_0091746
697 Ga0495676_0000493
698 Ga0495676_0016267
699 Ga0495676_0081056
700 Ga0495676_0086242
701 Ga0495680_0003122
702 Ga0495680_0130897
703 Ga0495683_0000003
704 Ga0495683_0001914
705 Ga0495683_0002324
706 Ga0495683_0096265
707 Ga0495687_023573
708 Ga0495675_0007759
709 Ga0495675_0043759
710 Ga0495675_0089568
711 Ga0495675_0209331
712 Ga0495679_000006
713 Ga0495679_000015
714 Ga0495679_000122
715 Ga0495679_000599
716 Ga0495679_005235
717 Ga0495673_0002158
718 Ga0495673_0007145
719 Ga0495673_0013562
720 Ga0495673_0020783
721 Ga0495681_0005337
722 Ga0495681_0009073
723 Ga0495684_0017524
724 Ga0495684_0193621
725 Ga0495686_0000099
726 Ga0495686_0116331
727 Ga0495593_0002281
728 Ga0495593_0025920
729 Ga0495593_0033702
730 Ga0495602_0025980
731 Ga0495602_0026203
732 Ga0495602_0329631
733 Ga0495614_0000386
734 Ga0495614_0010541
735 Ga0495626_0000201
736 Ga0495626_0007475
737 Ga0496102_0115698
738 Ga0496104_0000016
739 Ga0496105_0000010
740 Ga0496115_0000544
741 Ga0496116_0010692
742 Ga0496117_0005723
743 Ga0496117_0012367
744 Ga0496118_0002759
745 Ga0496118_0009927
746 Ga0496118_0010169
747 Ga0496118_0017426
748 Ga0496119_0002615
749 Ga0496120_0000015
750 Ga0496121_0000985
751 Ga0496121_0013089
752 Ga0496122_0024500
753 Ga0496123_0143545
754 Ga0496124_0000383
755 Ga0496124_0269096
756 Ga0496126_0000102
757 Ga0496126_0006025
758 Ga0496126_0019611
759 Ga0495678_000007
760 Ga0495678_000394
761 Ga0495678_012135
762 Ga0495678_030139
763 Ga0495682_0018900
764 Ga0501031_0174233
765 Ga0501033_0077031
766 Ga0501033_0284111
767 Ga0501043_0167156
768 Ga0501046_0046415
769 Ga0501047_0040463
770 Ga0501047_0046890
771 Ga0501070_0048584
772 Ga0501241_005206
773 Ga0501035_0024057
774 Ga0501035_0127149
775 Ga0501044_0003627
776 Ga0501044_0462303
777 nmdc:mga0n895_16777_c1
778 nmdc:mga0rr50_219769_c1
779 2509127054
780 2510246680
781 2512350361
782 2513591833
783 2513961085
784 2514052294
785 2600815205
786 2644251636
787 2719644005
788 2738822099
789 2738834581
790 2738875785
791 2739187737
792 2739222383
793 2746091144
794 2746097576
795 2808974220
796 2809009006
797 2809016157
798 2819620475
799 2842330854
800 2842355193
801 2842456132
802 2884414184
803 2885279377
804 2900640384
805 2904616740
806 2919528066
807 2928108923
808 2928136147
809 2928504072
810 2945938449
811 2990708451
812 642423581
813 642598206
814 642616974
815 8055268695
816 8055304716

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

22

288

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.8885 6 284
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.878 10 286
6cia-assembly1.cif.gz_A crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with nadph. 0.8584 9 287
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.8497 6 284
6ky6-assembly2.cif.gz_B crystal structure of a thermostable aldo-keto reductase tm1743 in complexs with inhibitor epalrestat in space group p3221cc 0.8482 10 288
ID Description Score Start End Superfamily
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9575 13 289 3.20.20.100
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9442 13 289 3.20.20.100
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9151 18 292 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8819 18 289 3.20.20.100
af_P77256_1_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8791 9 290 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A529NSE1-F1-model_v4 Oxidoreductase 0.9645 66 268
AF-A0A2V7AYD1-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9604 117 288 GO:0016491
AF-A0A2U0UWB7-F1-model_v4 deleted 0.96 10 287
AF-A0A529NSE1-F1-model_v4 Oxidoreductase 0.9598 66 268
AF-A0A0C2MEU3-F1-model_v4 Putative oxidoreductase YdbC 0.9583 105 217

Map