F436666

General Info

Members Datasets Scaffolds Average Seq Length
408 245 816 250

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100182830|Ga0070699_1001828302
Length 292
Sequence MQPQLQKSKTDQPKVVSQAEWLAARKDLLTEEKEFTRRRDALSAKRRELPWVKVEKNYVFDGPNGKESLSDLFRGNTQLIVYHFMLGPDWKEGCPSCSFLGDHFDGTLVHLNARDVSFSAVSRAPMPQIEAFKKRMGWHFKWVSSNSNDFNYDYHVSFTKDEMAKGKVNYNYGEREFPSEEAPGLSVFYKNAVGEIFHTYSTYGRGLDILLGAYNFLDLTPKGRDEDALAFTMSWVRHHDRYENGHTVDQTAAYQPQNWPTTPAAPTTSQHKALASDLVSLVAAASCSDAKG

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
71 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
72 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
73 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
242 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.25
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 3.92
Rhizosphere 92.65
Stem 0
Stem Tuber 0
Unclassified 7.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100182830 3300005518 Bacteria 1861
2 rootH1_10292688 3300003323 Unclassified 1970
3 Ga0070658_10015636 3300005327 Bacteria 6069
4 Ga0070683_100001211 3300005329 Bacteria 19600
5 Ga0070683_100011659 3300005329 Bacteria 7610
6 Ga0070683_100105674 3300005329 Bacteria 2654
7 Ga0070670_100410455 3300005331 Bacteria 1196
8 Ga0068869_100006038 3300005334 Bacteria 7663
9 Ga0068868_100012459 3300005338 Bacteria 6218
10 Ga0070660_100257862 3300005339 Bacteria 1423
11 Ga0070661_100013373 3300005344 Bacteria 5760
12 Ga0070661_100022707 3300005344 Bacteria 4493
13 Ga0070671_100037967 3300005355 Bacteria 3997
14 Ga0070671_100039370 3300005355 Bacteria 3924
15 Ga0070671_100162911 3300005355 Bacteria 1885
16 Ga0070688_100061892 3300005365 Bacteria 2368
17 Ga0070667_100005190 3300005367 Bacteria 10885
18 Ga0070709_10305467 3300005434 Unclassified 1163
19 Ga0070714_100427336 3300005435 Bacteria 1256
20 Ga0070713_100365402 3300005436 Bacteria 1342
21 Ga0070710_10337516 3300005437 Bacteria 994
22 Ga0070711_100113803 3300005439 Bacteria 1990
23 Ga0070711_100185127 3300005439 Bacteria 1596
24 Ga0070711_100390053 3300005439 Bacteria 1128
25 Ga0070708_100006132 3300005445 Bacteria 9563
26 Ga0070708_100015174 3300005445 Bacteria 6352
27 Ga0070708_100081443 3300005445 Bacteria 2931
28 Ga0070708_100244327 3300005445 Bacteria 1686
29 Ga0070663_100045524 3300005455 Bacteria 3100
30 Ga0070706_100001944 3300005467 Bacteria 21302
31 Ga0070706_100072721 3300005467 Bacteria 3181
32 Ga0070706_100096329 3300005467 Bacteria 2747
33 Ga0070706_100223240 3300005467 Bacteria 1759
34 Ga0070706_100255432 3300005467 Bacteria 1636
35 Ga0070707_100005736 3300005468 Bacteria 11582
36 Ga0070707_100141804 3300005468 Bacteria 2339
37 Ga0070707_100295246 3300005468 Bacteria 1575
38 Ga0070698_100207849 3300005471 Bacteria 1893
39 Ga0070699_100246828 3300005518 Bacteria 1594
40 Ga0070679_100015557 3300005530 Bacteria 7310
41 Ga0070684_100044808 3300005535 Bacteria 3827
42 Ga0070697_100054881 3300005536 Bacteria 3238
43 Ga0068853_100000261 3300005539 Bacteria 37164
44 Ga0070672_100442207 3300005543 Bacteria 1119
45 Ga0070693_100222952 3300005547 Bacteria 1236
46 Ga0070665_100003253 3300005548 Bacteria 17456
47 Ga0068855_100000176 3300005563 Bacteria 82215
48 Ga0068855_100009781 3300005563 Bacteria 11567
49 Ga0068855_100011383 3300005563 Bacteria 10743
50 Ga0068855_100418054 3300005563 Bacteria 1467
51 Ga0068857_100003255 3300005577 Bacteria 13492
52 Ga0068857_100310797 3300005577 Unclassified 1454
53 Ga0068854_100044444 3300005578 Bacteria 3153
54 Ga0068854_100049548 3300005578 Bacteria 3000
55 Ga0068854_100314914 3300005578 Bacteria 1270
56 Ga0068856_100003164 3300005614 Bacteria 16778
57 Ga0068856_100010641 3300005614 Bacteria 8940
58 Ga0068856_100040430 3300005614 Bacteria 4581
59 Ga0068852_100001731 3300005616 Bacteria 14875
60 Ga0068852_100079070 3300005616 Bacteria 2912
61 Ga0068852_100081148 3300005616 Bacteria 2878
62 Ga0068852_100487803 3300005616 Unclassified 1225
63 Ga0068864_100000358 3300005618 Bacteria 40190
64 Ga0068851_10005232 3300005834 Bacteria 5888
65 Ga0068851_10007202 3300005834 Bacteria 5097
66 Ga0068851_10019445 3300005834 Bacteria 3282
67 Ga0068863_100005134 3300005841 Bacteria 12914
68 Ga0068858_100001902 3300005842 Bacteria 21302
69 Ga0068858_100132986 3300005842 Bacteria 2333
70 Ga0068860_100000809 3300005843 Bacteria 35018
71 Ga0068860_100078057 3300005843 Bacteria 3149
72 Ga0068862_100014469 3300005844 Bacteria 6547
73 Ga0081455_10001890 3300005937 Bacteria 25190
74 Ga0081540_1015458 3300005983 Bacteria 4833
75 Ga0081539_10054558 3300005985 Unclassified 2230
76 Ga0070717_10003478 3300006028 Bacteria 11277
77 Ga0070717_10498102 3300006028 Bacteria 1101
78 Ga0070716_100007610 3300006173 Bacteria 5341
79 Ga0070716_100050234 3300006173 Bacteria 2366
80 Ga0070716_100187857 3300006173 Bacteria 1363
81 Ga0070716_100189849 3300006173 Bacteria 1356
82 Ga0070712_100023446 3300006175 Bacteria 4078
83 Ga0070712_100133926 3300006175 Bacteria 1882
84 Ga0070712_100315417 3300006175 Bacteria 1270
85 Ga0097621_100001148 3300006237 Bacteria 18380
86 Ga0097621_100002966 3300006237 Bacteria 11648
87 Ga0097621_100013063 3300006237 Bacteria 6175
88 Ga0097621_100024639 3300006237 Bacteria 4701
89 Ga0097621_100095056 3300006237 Unclassified 2499
90 Ga0068871_100000441 3300006358 Bacteria 28558
91 Ga0068871_100010253 3300006358 Bacteria 6828
92 Ga0068871_100383455 3300006358 Bacteria 1249
93 Ga0075430_100005441 3300006846 Bacteria 10760
94 Ga0075431_100097132 3300006847 Bacteria 3041
95 Ga0075436_100047819 3300006914 Bacteria 2951
96 Ga0099795_10032916 3300007788 Bacteria 1797
97 Ga0105240_10000309 3300009093 Bacteria 93964
98 Ga0105240_10003931 3300009093 Bacteria 22956
99 Ga0105240_10021894 3300009093 Bacteria 8492
100 Ga0105240_10229047 3300009093 Bacteria 2161
101 Ga0105240_10949753 3300009093 Bacteria 922
102 Ga0105245_10000670 3300009098 Bacteria 31023
103 Ga0105245_10006830 3300009098 Bacteria 10010
104 Ga0105245_10062595 3300009098 Unclassified 3357
105 Ga0105245_10154711 3300009098 Bacteria 2171
106 Ga0105241_10000076 3300009174 Bacteria 74496
107 Ga0105241_10002447 3300009174 Bacteria 13938
108 Ga0105241_10063556 3300009174 Bacteria 2849
109 Ga0105241_10074255 3300009174 Unclassified 2648
110 Ga0105248_10021599 3300009177 Bacteria 7129
111 Ga0105248_10032745 3300009177 Bacteria 5807
112 Ga0105248_11096342 3300009177 Bacteria 900
113 Ga0105238_10000673 3300009551 Bacteria 35869
114 Ga0105238_10363526 3300009551 Bacteria 1437
115 Ga0105249_10110783 3300009553 Bacteria 2594
116 Ga0105239_10001562 3300010375 Bacteria 30313
117 Ga0105239_10031152 3300010375 Bacteria 5868
118 Ga0105239_10084712 3300010375 Bacteria 3492
119 Ga0105239_10523919 3300010375 Bacteria 1348
120 Ga0105239_10565392 3300010375 Bacteria 1296
121 Ga0105246_10015139 3300011119 Bacteria 4863
122 Ga0157369_10009367 3300013105 Bacteria 11198
123 Ga0157369_10090760 3300013105 Bacteria 3262
124 Ga0157369_10092505 3300013105 Bacteria 3228
125 Ga0157374_10005956 3300013296 Bacteria 10310
126 Ga0157374_10102858 3300013296 Bacteria 2740
127 Ga0157374_10108293 3300013296 Bacteria 2671
128 Ga0157374_10278423 3300013296 Bacteria 1651
129 Ga0157374_10599433 3300013296 Bacteria 1111
130 Ga0157378_10000757 3300013297 Bacteria 30212
131 Ga0157378_10008333 3300013297 Bacteria 9032
132 Ga0157378_10008764 3300013297 Bacteria 8808
133 Ga0157378_10008774 3300013297 Bacteria 8801
134 Ga0163162_10003268 3300013306 Bacteria 15510
135 Ga0163162_10258018 3300013306 Bacteria 1875
136 Ga0157375_10004246 3300013308 Bacteria 12427
137 Ga0163163_10001103 3300014325 Bacteria 22908
138 Ga0157377_10159183 3300014745 Bacteria 1403
139 Ga0157379_10000092 3300014968 Bacteria 60487
140 Ga0157379_10153848 3300014968 Bacteria 2074
141 Ga0157376_10000607 3300014969 Bacteria 23162
142 Ga0157376_10016093 3300014969 Bacteria 5668
143 Ga0157376_10019038 3300014969 Bacteria 5280
144 Ga0157376_10222331 3300014969 Bacteria 1749
145 Ga0224569_100154 3300022732 Bacteria 5289
146 Ga0224571_100060 3300022734 Bacteria 3849
147 Ga0224572_1009035 3300024225 Bacteria 1853
148 Ga0228598_1000912 3300024227 Bacteria 6396
149 Ga0228598_1000948 3300024227 Bacteria 6304
150 Ga0228598_1013029 3300024227 Bacteria 1647
151 Ga0209130_1001807 3300025284 Bacteria 12466
152 Ga0207426_1000235 3300025302 Bacteria 126601
153 Ga0207656_10037279 3300025321 Unclassified 2045
154 Ga0207655_1004844 3300025728 Bacteria 9352
155 Ga0207710_10008997 3300025900 Bacteria 4204
156 Ga0207685_10090942 3300025905 Bacteria 1285
157 Ga0207699_10032282 3300025906 Bacteria 2949
158 Ga0207645_10159832 3300025907 Bacteria 1473
159 Ga0207705_10006879 3300025909 Bacteria 8406
160 Ga0207705_10019190 3300025909 Bacteria 4890
161 Ga0207684_10131048 3300025910 Bacteria 2152
162 Ga0207654_10000025 3300025911 Bacteria 143807
163 Ga0207654_10000035 3300025911 Bacteria 112494
164 Ga0207654_10079149 3300025911 Bacteria 1974
165 Ga0207654_10104921 3300025911 Unclassified 1748
166 Ga0207707_10058626 3300025912 Bacteria 3351
167 Ga0207695_10000119 3300025913 Bacteria 235221
168 Ga0207695_10000314 3300025913 Bacteria 116506
169 Ga0207695_10000635 3300025913 Bacteria 70312
170 Ga0207695_10017239 3300025913 Bacteria 8412
171 Ga0207695_10068060 3300025913 Bacteria 3649
172 Ga0207695_10104885 3300025913 Unclassified 2815
173 Ga0207671_10000246 3300025914 Bacteria 81042
174 Ga0207671_10000975 3300025914 Bacteria 35477
175 Ga0207693_10006662 3300025915 Bacteria 9540
176 Ga0207693_10029842 3300025915 Bacteria 4303
177 Ga0207693_10039986 3300025915 Bacteria 3693
178 Ga0207693_10048057 3300025915 Bacteria 3351
179 Ga0207693_10189952 3300025915 Bacteria 1616
180 Ga0207663_10063980 3300025916 Bacteria 2345
181 Ga0207663_10148840 3300025916 Bacteria 1640
182 Ga0207660_10459571 3300025917 Bacteria 1030
183 Ga0207657_10218666 3300025919 Bacteria 1527
184 Ga0207649_10022662 3300025920 Bacteria 3629
185 Ga0207649_10414179 3300025920 Bacteria 1011
186 Ga0207652_10057111 3300025921 Bacteria 3361
187 Ga0207646_10000274 3300025922 Bacteria 70391
188 Ga0207646_10047662 3300025922 Bacteria 3843
189 Ga0207694_10000445 3300025924 Bacteria 38303
190 Ga0207694_10001160 3300025924 Bacteria 22863
191 Ga0207694_10011512 3300025924 Bacteria 6676
192 Ga0207694_10129156 3300025924 Bacteria 2025
193 Ga0207694_10485225 3300025924 Bacteria 1034
194 Ga0207650_10338326 3300025925 Bacteria 1235
195 Ga0207700_10054189 3300025928 Bacteria 3009
196 Ga0207700_10097043 3300025928 Bacteria 2342
197 Ga0207700_10285518 3300025928 Bacteria 1421
198 Ga0207664_10317632 3300025929 Bacteria 1374
199 Ga0207644_10000617 3300025931 Bacteria 22668
200 Ga0207644_10027433 3300025931 Bacteria 3933
201 Ga0207670_10066881 3300025936 Bacteria 2470
202 Ga0207665_10007240 3300025939 Bacteria 7340
203 Ga0207665_10049946 3300025939 Bacteria 2812
204 Ga0207665_10370778 3300025939 Bacteria 1084
205 Ga0207711_10047709 3300025941 Bacteria 3663
206 Ga0207689_10000553 3300025942 Bacteria 35691
207 Ga0207661_10038192 3300025944 Bacteria 3761
208 Ga0207667_10001456 3300025949 Bacteria 29689
209 Ga0207667_10007234 3300025949 Bacteria 13396
210 Ga0207667_10014286 3300025949 Bacteria 9058
211 Ga0207640_10031338 3300025981 Bacteria 3284
212 Ga0207640_10041432 3300025981 Bacteria 2929
213 Ga0207658_10005986 3300025986 Bacteria 8316
214 Ga0207658_10277789 3300025986 Bacteria 1435
215 Ga0207677_10000104 3300026023 Bacteria 70036
216 Ga0207703_10001493 3300026035 Bacteria 21338
217 Ga0207703_10142750 3300026035 Bacteria 2080
218 Ga0207703_10544455 3300026035 Bacteria 1094
219 Ga0207639_10000059 3300026041 Bacteria 108373
220 Ga0207678_10026676 3300026067 Bacteria 5040
221 Ga0207702_10001638 3300026078 Bacteria 22149
222 Ga0207702_10022354 3300026078 Bacteria 5243
223 Ga0207702_10070276 3300026078 Unclassified 3011
224 Ga0207702_10168428 3300026078 Bacteria 2006
225 Ga0207641_10000809 3300026088 Bacteria 33415
226 Ga0207648_10363222 3300026089 Bacteria 1307
227 Ga0207676_10000862 3300026095 Bacteria 23512
228 Ga0207674_10003375 3300026116 Bacteria 19604
229 Ga0207674_10258391 3300026116 Bacteria 1689
230 Ga0207674_10391690 3300026116 Unclassified 1343
231 Ga0207698_10005184 3300026142 Bacteria 8010
232 Ga0207698_10022321 3300026142 Bacteria 4395
233 Ga0207698_10053054 3300026142 Bacteria 3110
234 Ga0207698_10201636 3300026142 Bacteria 1782
235 Ga0209974_10049994 3300027876 Bacteria 1403
236 Ga0209974_10061918 3300027876 Bacteria 1267
237 Ga0265357_1000053 3300028023 Bacteria 3976
238 Ga0268266_10092374 3300028379 Bacteria 2655
239 Ga0268265_10056877 3300028380 Bacteria 2978
240 Ga0268265_10248160 3300028380 Bacteria 1575
241 Ga0268264_10000325 3300028381 Bacteria 75416
242 Ga0268264_10001031 3300028381 Bacteria 28009
243 Ga0268264_10353328 3300028381 Bacteria 1400
244 Ga0307515_10305025 3300028794 Bacteria 1273
245 Ga0265760_10012177 3300031090 Bacteria 2458
246 Ga0265330_10097126 3300031235 Bacteria 1262
247 Ga0265340_10010192 3300031247 Bacteria 5033
248 Ga0265339_10116698 3300031249 Bacteria 1376
249 Ga0307513_10143876 3300031456 Bacteria 2306
250 Ga0265342_10175400 3300031712 Bacteria 1177
251 Ga0307516_10011544 3300031730 Bacteria 9587
252 Ga0307414_10102286 3300032004 Bacteria 2159
253 Ga0373934_0086170 3300035086 Bacteria 1264
254 Ga0373944_0054083 3300035089 Bacteria 1272
255 Ga0373923_0126819 3300035111 Bacteria 1144
256 Ga0373954_0003894 3300035118 Bacteria 6386
257 Ga0373956_0077555 3300035119 Bacteria 1521
258 Ga0373943_0026636 3300035170 Bacteria 2710
259 Ga0373943_0175495 3300035170 Bacteria 1175
260 Ga0373955_0020418 3300035172 Bacteria 3330
261 Ga0373955_0093806 3300035172 Bacteria 1714
262 Ga0373924_0077645 3300035410 Bacteria 1408
263 Ga0373931_0002208 3300035691 Bacteria 8595
264 Ga0373935_0026291 3300035692 Bacteria 3591
265 Ga0373935_0210389 3300035692 Bacteria 1347
266 Ga0373927_0008504 3300035695 Bacteria 6905
267 Ga0373927_0071180 3300035695 Bacteria 2251
268 Ga0373933_0000497 3300035724 Bacteria 24474
269 Ga0373947_0006532 3300035725 Bacteria 6763
270 Ga0373937_0000456 3300036401 Bacteria 37790
271 Ga0373937_0001704 3300036401 Bacteria 18477
272 Ga0373937_0031561 3300036401 Bacteria 4802
273 Ga0373937_0051494 3300036401 Bacteria 3774
274 Ga0373937_0465539 3300036401 Bacteria 1201
275 Ga0373925_0004794 3300037068 Bacteria 10186
276 Ga0395900_0180617 3300037418 Bacteria 2145
277 Ga0395900_0191225 3300037418 Bacteria 2076
278 Ga0395905_0050095 3300037471 Bacteria 3914
279 Ga0395905_0205628 3300037471 Bacteria 1845
280 Ga0436364_0262495 3300037853 Bacteria 1212
281 Ga0395901_0070870 3300038443 Bacteria 3632
282 Ga0395901_0167704 3300038443 Bacteria 2305
283 Ga0436360_0355661 3300039438 Bacteria 1753
284 Ga0436361_0268335 3300039447 Unclassified 2132
285 Ga0436361_0379601 3300039447 Bacteria 896
286 Ga0436361_0489473 3300039447 Bacteria 2739
287 Ga0466969_0000123 3300044656 Bacteria 41546
288 Ga0466961_0023229 3300044693 Bacteria 3989
289 Ga0466970_0138938 3300044765 Bacteria 1337
290 Ga0466959_0211476 3300045049 Bacteria 1347
291 Ga0466967_0623361 3300045976 Bacteria 1065
292 Ga0495592_0022794 3300046454 Bacteria 4762
293 Ga0495603_0080258 3300046455 Unclassified 1912
294 Ga0495629_0040932 3300046459 Bacteria 3260
295 Ga0495651_0006453 3300046462 Bacteria 8973
296 Ga0495653_0003993 3300046463 Bacteria 11913
297 Ga0495650_0026697 3300046471 Bacteria 2679
298 Ga0495580_0000481 3300046472 Bacteria 33302
299 Ga0495580_0003520 3300046472 Bacteria 13308
300 Ga0495580_0050471 3300046472 Unclassified 2942
301 Ga0495582_0000232 3300046473 Bacteria 30900
302 Ga0495582_0011849 3300046473 Bacteria 4801
303 Ga0495639_0082914 3300046475 Bacteria 1495
304 Ga0495662_0068811 3300046476 Bacteria 1715
305 Ga0495664_0300767 3300046477 Unclassified 968
306 Ga0495607_0019481 3300046501 Bacteria 4308
307 Ga0495583_0000798 3300046506 Bacteria 38957
308 Ga0495608_0000549 3300046511 Bacteria 25949
309 Ga0495608_0061348 3300046511 Bacteria 2473
310 Ga0495610_0030546 3300046512 Bacteria 2822
311 Ga0495616_0023044 3300046513 Bacteria 3355
312 Ga0495618_0128857 3300046514 Bacteria 1619
313 Ga0495618_0214441 3300046514 Bacteria 1216
314 Ga0495628_0178468 3300046516 Bacteria 1607
315 Ga0495630_0051957 3300046517 Unclassified 3068
316 Ga0495631_0012230 3300046518 Bacteria 4200
317 Ga0495632_0077360 3300046519 Bacteria 1591
318 Ga0495632_0169469 3300046519 Bacteria 1003
319 Ga0495637_0000181 3300046520 Bacteria 48899
320 Ga0495643_0000580 3300046522 Bacteria 44701
321 Ga0495643_0040047 3300046522 Bacteria 2560
322 Ga0495644_0009131 3300046523 Bacteria 3819
323 Ga0495666_0067484 3300046526 Unclassified 1704
324 Ga0495652_0005030 3300046529 Bacteria 12515
325 Ga0495652_0127669 3300046529 Bacteria 2018
326 Ga0495665_0040703 3300046531 Bacteria 2474
327 Ga0495665_0058200 3300046531 Unclassified 2041
328 Ga0495640_0016963 3300046533 Bacteria 5437
329 Ga0495640_0123352 3300046533 Unclassified 1682
330 Ga0495586_0213576 3300046535 Unclassified 1095
331 Ga0495645_0376950 3300046543 Bacteria 908
332 Ga0495622_0168717 3300046557 Unclassified 985
333 Ga0495667_0010643 3300046559 Bacteria 6218
334 Ga0495667_0053235 3300046559 Bacteria 2666
335 Ga0495611_0000904 3300046648 Bacteria 16136
336 Ga0495635_0003358 3300046663 Bacteria 11058
337 Ga0495635_0065267 3300046663 Unclassified 2498
338 Ga0495661_0000041 3300046665 Bacteria 151138
339 Ga0495588_0070790 3300046674 Bacteria 1813
340 Ga0495657_0003404 3300046675 Bacteria 12991
341 Ga0495599_0158970 3300046678 Bacteria 1397
342 Ga0495623_0013818 3300046679 Bacteria 5233
343 Ga0495646_0017921 3300046680 Bacteria 4486
344 Ga0495658_0007077 3300046683 Bacteria 5539
345 Ga0495658_0043305 3300046683 Unclassified 2517
346 Ga0495613_0002408 3300046689 Bacteria 14147
347 Ga0495613_0058295 3300046689 Unclassified 2834
348 Ga0495613_0071693 3300046689 Bacteria 2525
349 Ga0495613_0115140 3300046689 Bacteria 1935
350 Ga0495671_0110656 3300046692 Bacteria 1341
351 Ga0495649_0032755 3300046694 Bacteria 2861
352 Ga0495600_0133690 3300046809 Bacteria 1611
353 Ga0495581_0124889 3300047315 Bacteria 1498
354 Ga0495581_0190210 3300047315 Bacteria 1201
355 Ga0495604_0000355 3300047317 Bacteria 41013
356 Ga0495674_0002445 3300047319 Bacteria 18147
357 Ga0495674_0351386 3300047319 Bacteria 1197
358 Ga0495674_0362748 3300047319 Bacteria 1174
359 Ga0495672_0032058 3300047320 Bacteria 3273
360 Ga0495676_0000023 3300047321 Bacteria 156478
361 Ga0495676_0050001 3300047321 Bacteria 3356
362 Ga0495676_0119498 3300047321 Bacteria 1920
363 Ga0495680_0001780 3300047322 Bacteria 22838
364 Ga0495675_0006149 3300047444 Bacteria 7353
365 Ga0495681_0009035 3300047470 Bacteria 6179
366 Ga0495684_0008447 3300047471 Bacteria 7975
367 Ga0495684_0063704 3300047471 Bacteria 2802
368 Ga0495684_0191017 3300047471 Unclassified 1514
369 Ga0495686_0011981 3300047472 Bacteria 6093
370 Ga0495593_0036514 3300047673 Bacteria 2665
371 Ga0495602_0057078 3300048088 Bacteria 3428
372 Ga0495614_0126643 3300048089 Unclassified 1128
373 Ga0495626_0000213 3300048091 Bacteria 69180
374 Ga0496100_0015035 3300048903 Bacteria 4512
375 Ga0496101_0060839 3300048904 Bacteria 2741
376 Ga0496101_0519164 3300048904 Unclassified 941
377 Ga0496102_0055783 3300048905 Bacteria 3603
378 Ga0496104_0176436 3300048907 Bacteria 2047
379 Ga0496104_0308295 3300048907 Bacteria 1496
380 Ga0496106_0079119 3300048909 Bacteria 2524
381 Ga0496107_0016943 3300048910 Bacteria 5124
382 Ga0496108_0056071 3300048911 Bacteria 3310
383 Ga0496110_0234369 3300048913 Bacteria 1670
384 Ga0496112_0129819 3300048915 Bacteria 2491
385 Ga0496112_0187199 3300048915 Bacteria 2033
386 Ga0496114_0003270 3300048917 Bacteria 12439
387 Ga0496115_0009066 3300048918 Bacteria 7382
388 Ga0496115_0015954 3300048918 Bacteria 5710
389 Ga0496115_0019051 3300048918 Bacteria 5277
390 Ga0496121_0001304 3300048924 Bacteria 42843
391 Ga0496125_0000614 3300048928 Bacteria 60399
392 Ga0496126_0409232 3300048929 Bacteria 1099
393 Ga0495678_005517 3300049459 Bacteria 6963
394 Ga0501033_0248908 3300049570 Bacteria 1260
395 Ga0501083_0006934 3300049744 Bacteria 8043
396 Ga0501044_0003287 3300049823 Bacteria 18208
397 nmdc:mga0qj67_317590_c1 3300050509 Bacteria 1261
398 nmdc:mga06r32_118128_c1 3300050510 Bacteria 2614
399 nmdc:mga0rr50_56785_c1 3300050513 Bacteria 2926
400 Ga0495612_0000988 3300053078 Bacteria 11685
401 Ga0495595_0000774 3300053084 Bacteria 12122
402 Ga0495619_0008839 3300053085 Bacteria 6368
403 Ga0495619_0080826 3300053085 Bacteria 2188
404 Ga0500642_0003926 3300053130 Bacteria 4582
405 Ga0500559_0133952 3300053136 Bacteria 1158
406 Ga0500616_0016357 3300053153 Bacteria 4222
407 Ga0501084_0073445 3300054114 Bacteria 2864
408 2687236474 2684623219 Bacteria 8442773
409 Ga0070699_100182830
410 rootH1_10292688
411 Ga0070658_10015636
412 Ga0070683_100001211
413 Ga0070683_100011659
414 Ga0070683_100105674
415 Ga0070670_100410455
416 Ga0068869_100006038
417 Ga0068868_100012459
418 Ga0070660_100257862
419 Ga0070661_100013373
420 Ga0070661_100022707
421 Ga0070671_100037967
422 Ga0070671_100039370
423 Ga0070671_100162911
424 Ga0070688_100061892
425 Ga0070667_100005190
426 Ga0070709_10305467
427 Ga0070714_100427336
428 Ga0070713_100365402
429 Ga0070710_10337516
430 Ga0070711_100113803
431 Ga0070711_100185127
432 Ga0070711_100390053
433 Ga0070708_100006132
434 Ga0070708_100015174
435 Ga0070708_100081443
436 Ga0070708_100244327
437 Ga0070663_100045524
438 Ga0070706_100001944
439 Ga0070706_100072721
440 Ga0070706_100096329
441 Ga0070706_100223240
442 Ga0070706_100255432
443 Ga0070707_100005736
444 Ga0070707_100141804
445 Ga0070707_100295246
446 Ga0070698_100207849
447 Ga0070699_100246828
448 Ga0070679_100015557
449 Ga0070684_100044808
450 Ga0070697_100054881
451 Ga0068853_100000261
452 Ga0070672_100442207
453 Ga0070693_100222952
454 Ga0070665_100003253
455 Ga0068855_100000176
456 Ga0068855_100009781
457 Ga0068855_100011383
458 Ga0068855_100418054
459 Ga0068857_100003255
460 Ga0068857_100310797
461 Ga0068854_100044444
462 Ga0068854_100049548
463 Ga0068854_100314914
464 Ga0068856_100003164
465 Ga0068856_100010641
466 Ga0068856_100040430
467 Ga0068852_100001731
468 Ga0068852_100079070
469 Ga0068852_100081148
470 Ga0068852_100487803
471 Ga0068864_100000358
472 Ga0068851_10005232
473 Ga0068851_10007202
474 Ga0068851_10019445
475 Ga0068863_100005134
476 Ga0068858_100001902
477 Ga0068858_100132986
478 Ga0068860_100000809
479 Ga0068860_100078057
480 Ga0068862_100014469
481 Ga0081455_10001890
482 Ga0081540_1015458
483 Ga0081539_10054558
484 Ga0070717_10003478
485 Ga0070717_10498102
486 Ga0070716_100007610
487 Ga0070716_100050234
488 Ga0070716_100187857
489 Ga0070716_100189849
490 Ga0070712_100023446
491 Ga0070712_100133926
492 Ga0070712_100315417
493 Ga0097621_100001148
494 Ga0097621_100002966
495 Ga0097621_100013063
496 Ga0097621_100024639
497 Ga0097621_100095056
498 Ga0068871_100000441
499 Ga0068871_100010253
500 Ga0068871_100383455
501 Ga0075430_100005441
502 Ga0075431_100097132
503 Ga0075436_100047819
504 Ga0099795_10032916
505 Ga0105240_10000309
506 Ga0105240_10003931
507 Ga0105240_10021894
508 Ga0105240_10229047
509 Ga0105240_10949753
510 Ga0105245_10000670
511 Ga0105245_10006830
512 Ga0105245_10062595
513 Ga0105245_10154711
514 Ga0105241_10000076
515 Ga0105241_10002447
516 Ga0105241_10063556
517 Ga0105241_10074255
518 Ga0105248_10021599
519 Ga0105248_10032745
520 Ga0105248_11096342
521 Ga0105238_10000673
522 Ga0105238_10363526
523 Ga0105249_10110783
524 Ga0105239_10001562
525 Ga0105239_10031152
526 Ga0105239_10084712
527 Ga0105239_10523919
528 Ga0105239_10565392
529 Ga0105246_10015139
530 Ga0157369_10009367
531 Ga0157369_10090760
532 Ga0157369_10092505
533 Ga0157374_10005956
534 Ga0157374_10102858
535 Ga0157374_10108293
536 Ga0157374_10278423
537 Ga0157374_10599433
538 Ga0157378_10000757
539 Ga0157378_10008333
540 Ga0157378_10008764
541 Ga0157378_10008774
542 Ga0163162_10003268
543 Ga0163162_10258018
544 Ga0157375_10004246
545 Ga0163163_10001103
546 Ga0157377_10159183
547 Ga0157379_10000092
548 Ga0157379_10153848
549 Ga0157376_10000607
550 Ga0157376_10016093
551 Ga0157376_10019038
552 Ga0157376_10222331
553 Ga0224569_100154
554 Ga0224571_100060
555 Ga0224572_1009035
556 Ga0228598_1000912
557 Ga0228598_1000948
558 Ga0228598_1013029
559 Ga0209130_1001807
560 Ga0207426_1000235
561 Ga0207656_10037279
562 Ga0207655_1004844
563 Ga0207710_10008997
564 Ga0207685_10090942
565 Ga0207699_10032282
566 Ga0207645_10159832
567 Ga0207705_10006879
568 Ga0207705_10019190
569 Ga0207684_10131048
570 Ga0207654_10000025
571 Ga0207654_10000035
572 Ga0207654_10079149
573 Ga0207654_10104921
574 Ga0207707_10058626
575 Ga0207695_10000119
576 Ga0207695_10000314
577 Ga0207695_10000635
578 Ga0207695_10017239
579 Ga0207695_10068060
580 Ga0207695_10104885
581 Ga0207671_10000246
582 Ga0207671_10000975
583 Ga0207693_10006662
584 Ga0207693_10029842
585 Ga0207693_10039986
586 Ga0207693_10048057
587 Ga0207693_10189952
588 Ga0207663_10063980
589 Ga0207663_10148840
590 Ga0207660_10459571
591 Ga0207657_10218666
592 Ga0207649_10022662
593 Ga0207649_10414179
594 Ga0207652_10057111
595 Ga0207646_10000274
596 Ga0207646_10047662
597 Ga0207694_10000445
598 Ga0207694_10001160
599 Ga0207694_10011512
600 Ga0207694_10129156
601 Ga0207694_10485225
602 Ga0207650_10338326
603 Ga0207700_10054189
604 Ga0207700_10097043
605 Ga0207700_10285518
606 Ga0207664_10317632
607 Ga0207644_10000617
608 Ga0207644_10027433
609 Ga0207670_10066881
610 Ga0207665_10007240
611 Ga0207665_10049946
612 Ga0207665_10370778
613 Ga0207711_10047709
614 Ga0207689_10000553
615 Ga0207661_10038192
616 Ga0207667_10001456
617 Ga0207667_10007234
618 Ga0207667_10014286
619 Ga0207640_10031338
620 Ga0207640_10041432
621 Ga0207658_10005986
622 Ga0207658_10277789
623 Ga0207677_10000104
624 Ga0207703_10001493
625 Ga0207703_10142750
626 Ga0207703_10544455
627 Ga0207639_10000059
628 Ga0207678_10026676
629 Ga0207702_10001638
630 Ga0207702_10022354
631 Ga0207702_10070276
632 Ga0207702_10168428
633 Ga0207641_10000809
634 Ga0207648_10363222
635 Ga0207676_10000862
636 Ga0207674_10003375
637 Ga0207674_10258391
638 Ga0207674_10391690
639 Ga0207698_10005184
640 Ga0207698_10022321
641 Ga0207698_10053054
642 Ga0207698_10201636
643 Ga0209974_10049994
644 Ga0209974_10061918
645 Ga0265357_1000053
646 Ga0268266_10092374
647 Ga0268265_10056877
648 Ga0268265_10248160
649 Ga0268264_10000325
650 Ga0268264_10001031
651 Ga0268264_10353328
652 Ga0307515_10305025
653 Ga0265760_10012177
654 Ga0265330_10097126
655 Ga0265340_10010192
656 Ga0265339_10116698
657 Ga0307513_10143876
658 Ga0265342_10175400
659 Ga0307516_10011544
660 Ga0307414_10102286
661 Ga0373934_0086170
662 Ga0373944_0054083
663 Ga0373923_0126819
664 Ga0373954_0003894
665 Ga0373956_0077555
666 Ga0373943_0026636
667 Ga0373943_0175495
668 Ga0373955_0020418
669 Ga0373955_0093806
670 Ga0373924_0077645
671 Ga0373931_0002208
672 Ga0373935_0026291
673 Ga0373935_0210389
674 Ga0373927_0008504
675 Ga0373927_0071180
676 Ga0373933_0000497
677 Ga0373947_0006532
678 Ga0373937_0000456
679 Ga0373937_0001704
680 Ga0373937_0031561
681 Ga0373937_0051494
682 Ga0373937_0465539
683 Ga0373925_0004794
684 Ga0395900_0180617
685 Ga0395900_0191225
686 Ga0395905_0050095
687 Ga0395905_0205628
688 Ga0436364_0262495
689 Ga0395901_0070870
690 Ga0395901_0167704
691 Ga0436360_0355661
692 Ga0436361_0268335
693 Ga0436361_0379601
694 Ga0436361_0489473
695 Ga0466969_0000123
696 Ga0466961_0023229
697 Ga0466970_0138938
698 Ga0466959_0211476
699 Ga0466967_0623361
700 Ga0495592_0022794
701 Ga0495603_0080258
702 Ga0495629_0040932
703 Ga0495651_0006453
704 Ga0495653_0003993
705 Ga0495650_0026697
706 Ga0495580_0000481
707 Ga0495580_0003520
708 Ga0495580_0050471
709 Ga0495582_0000232
710 Ga0495582_0011849
711 Ga0495639_0082914
712 Ga0495662_0068811
713 Ga0495664_0300767
714 Ga0495607_0019481
715 Ga0495583_0000798
716 Ga0495608_0000549
717 Ga0495608_0061348
718 Ga0495610_0030546
719 Ga0495616_0023044
720 Ga0495618_0128857
721 Ga0495618_0214441
722 Ga0495628_0178468
723 Ga0495630_0051957
724 Ga0495631_0012230
725 Ga0495632_0077360
726 Ga0495632_0169469
727 Ga0495637_0000181
728 Ga0495643_0000580
729 Ga0495643_0040047
730 Ga0495644_0009131
731 Ga0495666_0067484
732 Ga0495652_0005030
733 Ga0495652_0127669
734 Ga0495665_0040703
735 Ga0495665_0058200
736 Ga0495640_0016963
737 Ga0495640_0123352
738 Ga0495586_0213576
739 Ga0495645_0376950
740 Ga0495622_0168717
741 Ga0495667_0010643
742 Ga0495667_0053235
743 Ga0495611_0000904
744 Ga0495635_0003358
745 Ga0495635_0065267
746 Ga0495661_0000041
747 Ga0495588_0070790
748 Ga0495657_0003404
749 Ga0495599_0158970
750 Ga0495623_0013818
751 Ga0495646_0017921
752 Ga0495658_0007077
753 Ga0495658_0043305
754 Ga0495613_0002408
755 Ga0495613_0058295
756 Ga0495613_0071693
757 Ga0495613_0115140
758 Ga0495671_0110656
759 Ga0495649_0032755
760 Ga0495600_0133690
761 Ga0495581_0124889
762 Ga0495581_0190210
763 Ga0495604_0000355
764 Ga0495674_0002445
765 Ga0495674_0351386
766 Ga0495674_0362748
767 Ga0495672_0032058
768 Ga0495676_0000023
769 Ga0495676_0050001
770 Ga0495676_0119498
771 Ga0495680_0001780
772 Ga0495675_0006149
773 Ga0495681_0009035
774 Ga0495684_0008447
775 Ga0495684_0063704
776 Ga0495684_0191017
777 Ga0495686_0011981
778 Ga0495593_0036514
779 Ga0495602_0057078
780 Ga0495614_0126643
781 Ga0495626_0000213
782 Ga0496100_0015035
783 Ga0496101_0060839
784 Ga0496101_0519164
785 Ga0496102_0055783
786 Ga0496104_0176436
787 Ga0496104_0308295
788 Ga0496106_0079119
789 Ga0496107_0016943
790 Ga0496108_0056071
791 Ga0496110_0234369
792 Ga0496112_0129819
793 Ga0496112_0187199
794 Ga0496114_0003270
795 Ga0496115_0009066
796 Ga0496115_0015954
797 Ga0496115_0019051
798 Ga0496121_0001304
799 Ga0496125_0000614
800 Ga0496126_0409232
801 Ga0495678_005517
802 Ga0501033_0248908
803 Ga0501083_0006934
804 Ga0501044_0003287
805 nmdc:mga0qj67_317590_c1
806 nmdc:mga06r32_118128_c1
807 nmdc:mga0rr50_56785_c1
808 Ga0495612_0000988
809 Ga0495595_0000774
810 Ga0495619_0008839
811 Ga0495619_0080826
812 Ga0500642_0003926
813 Ga0500559_0133952
814 Ga0500616_0016357
815 Ga0501084_0073445
816 2687236474

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05988

DUF899

Bacterial protein of unknown function (DUF899)

10

242

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d3l-assembly1.cif.gz_A the 2.6 a crystal structure of the lipoxygenase domain of human arachidonate 12-lipoxygenase, 12s-type 0.7563 173 199
4nmu-assembly2.cif.gz_B crystal structure of thiol-disulfide oxidoreductase from bacillus str. 'ames ancestor' 0.7439 48 208
2a4v-assembly1.cif.gz_A crystal structure of a truncated mutant of yeast nuclear thiol peroxidase 0.7434 48 215
1iow-assembly1.cif.gz_A complex of y216f d-ala:d-ala ligase with adp and a phosphoryl phosphinate 0.7276 177 203
1st9-assembly2.cif.gz_B crystal structure of a soluble domain of resa in the oxidised form 0.7232 48 212
ID Description Score Start End Superfamily
af_A0A0P0VN26_465_565_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7366 177 199 3.30.420.10
4af2A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7218 49 198 3.40.30.10
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7108 49 212 3.40.30.10
af_Q8IJD0_13_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7096 55 217 3.40.30.10
af_Q559T9_1_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.702 43 209 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2S6R5Q2-F1-model_v4 Thioredoxin domain-containing protein 0.99 8 187
AF-A0A2V6G796-F1-model_v4 DUF899 domain-containing protein 0.9832 8 238
AF-A0A2V6KS03-F1-model_v4 DUF899 domain-containing protein 0.9828 24 238
AF-A0A535QUL9-F1-model_v4 DUF899 domain-containing protein 0.9795 7 202
AF-A0A2S6R5Q2-F1-model_v4 Thioredoxin domain-containing protein 0.9792 8 187

Map