F436698

General Info

Members Datasets Scaffolds Average Seq Length
408 272 390 413

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10001398|Ga0105240_1000139815
Length 415
Sequence MTTSTLSTSPAASAAERTGFTVLGGISFAHFLNDTIQSVIIAIYPLLKGNFNLSFAQIGLITLTYQITASLLQPLIGLYTDKHPKPYSLPVGMGFTLAGLLLMSQAPNFGVLLVAAALVGTGSSVFHPESSRVARLASGGRHGLAQSIFQVGGNAGSAMGPLLAALLVIPHGQGSLAWFSLAALVAILVLWQVGGWYKQKIEVARRAPPKAVKVSTLPRRTVMIAVTVLGALMFSKFFYLASISSYYTFYLMDKFGLSTQAAQLHLFVFLFAVAAGTLLGGPIGDRIGRKQVIWVSILGAAPFTLALPYVGLTLTTVLSFVIGFILASAFSAILVFAQELMPGKVGTVSGLFFGLAFGMGGIAAAVLGVVADAEGIEFVYKVCAFLPLLGLLTALLPDLHDAKPRKKGPQAASVC

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
3 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
4 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
5 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
6 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
7 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
8 2818991436 Collimonas arenae 515 Isolate Unclassified
9 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
10 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
11 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
12 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
13 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
14 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
15 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
16 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
17 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
18 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
19 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
20 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
25 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
26 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
27 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
28 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
29 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
30 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
97 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
163 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
262 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
263 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
264 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
265 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
266 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
267 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
268 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
269 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
270 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
271 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
272 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.59
Metatranscriptomes 0
Isolates 4.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.84
Nodule 0.74
Rhizoplane 2.94
Rhizosphere 77.21
Stem 0
Stem Tuber 0
Unclassified 11.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000080 3300002704 Bacteria 56018
2 JGI25155J39150_1000156 3300002704 Bacteria 30755
3 JGI25156J39149_1000112 3300002705 Bacteria 59192
4 JGI25156J39149_1000128 3300002705 Bacteria 56012
5 JGI25156J39149_1005221 3300002705 Bacteria 3800
6 JGI25162J39368_1000032 3300002737 Bacteria 195871
7 JGI25154J39366_1000125 3300002738 Bacteria 61587
8 JGI25154J39366_1000143 3300002738 Bacteria 56016
9 JGI25154J39366_1000228 3300002738 Bacteria 37567
10 JGI25157J39369_1000134 3300002741 Bacteria 61613
11 JGI25165J46597_1000067 3300003214 Bacteria 196411
12 Ga0055538_1000033 3300003751 Bacteria 195914
13 Ga0055539_1000045 3300003752 Bacteria 195316
14 Ga0055533_1000054 3300003756 Bacteria 195914
15 Ga0055532_1000101 3300003758 Bacteria 92881
16 Ga0055525_1000065 3300003759 Bacteria 195779
17 Ga0055535_1006081 3300003761 Bacteria 2512
18 Ga0055541_1000031 3300003841 Bacteria 195914
19 Ga0065704_10003347 3300005289 Bacteria 4899
20 Ga0065707_10086852 3300005295 Bacteria 5275
21 Ga0070683_100098446 3300005329 Bacteria 2752
22 Ga0070666_10000058 3300005335 Bacteria 89886
23 Ga0070680_100000224 3300005336 Bacteria 37398
24 Ga0070682_100000299 3300005337 Bacteria 34539
25 Ga0070660_100088028 3300005339 Bacteria 2445
26 Ga0070691_10002867 3300005341 Bacteria 7720
27 Ga0070668_100012154 3300005347 Bacteria 6413
28 Ga0070668_100073138 3300005347 Bacteria 2672
29 Ga0070675_100205680 3300005354 Bacteria 1710
30 Ga0070675_100296311 3300005354 Bacteria 1424
31 Ga0070674_100015576 3300005356 Bacteria 4750
32 Ga0070673_100068201 3300005364 Bacteria 2848
33 Ga0070673_100293626 3300005364 Bacteria 1429
34 Ga0070659_100096689 3300005366 Bacteria 2372
35 Ga0070667_100000005 3300005367 Bacteria 347268
36 Ga0070667_100007154 3300005367 Bacteria 9271
37 Ga0070667_100049221 3300005367 Bacteria 3549
38 Ga0070714_100026121 3300005435 Bacteria 4825
39 Ga0070713_100011004 3300005436 Bacteria 6566
40 Ga0070711_100009318 3300005439 Bacteria 6042
41 Ga0070700_100027934 3300005441 Bacteria 3351
42 Ga0070663_100000431 3300005455 Bacteria 22124
43 Ga0070663_100020372 3300005455 Bacteria 4390
44 Ga0070678_100014523 3300005456 Bacteria 4973
45 Ga0070678_100048880 3300005456 Bacteria 3049
46 Ga0070678_100172500 3300005456 Bacteria 1763
47 Ga0070681_10001725 3300005458 Bacteria 19578
48 Ga0070681_10006482 3300005458 Bacteria 11389
49 Ga0070681_10010666 3300005458 Bacteria 9082
50 Ga0070681_10041648 3300005458 Bacteria 4603
51 Ga0070681_10081515 3300005458 Bacteria 3191
52 Ga0068867_100037290 3300005459 Bacteria 3533
53 Ga0070707_100234588 3300005468 Bacteria 1786
54 Ga0070698_100003839 3300005471 Bacteria 16518
55 Ga0070679_100001305 3300005530 Bacteria 22005
56 Ga0070679_100034361 3300005530 Bacteria 5025
57 Ga0070679_100035213 3300005530 Bacteria 4967
58 Ga0068853_100002772 3300005539 Bacteria 13242
59 Ga0070696_100000044 3300005546 Bacteria 57075
60 Ga0070693_100022238 3300005547 Bacteria 3368
61 Ga0070665_100076609 3300005548 Bacteria 3351
62 Ga0070665_100081663 3300005548 Bacteria 3238
63 Ga0068855_100000604 3300005563 Bacteria 44010
64 Ga0068855_100064198 3300005563 Bacteria 4282
65 Ga0068855_100067963 3300005563 Bacteria 4150
66 Ga0068857_100099285 3300005577 Bacteria 2611
67 Ga0068854_100002891 3300005578 Bacteria 10676
68 Ga0068854_100163354 3300005578 Bacteria 1727
69 Ga0068856_100013216 3300005614 Bacteria 7994
70 Ga0068859_100400151 3300005617 Bacteria 1469
71 Ga0068861_100004563 3300005719 Bacteria 9302
72 Ga0068863_100067026 3300005841 Bacteria 3396
73 Ga0068858_100044421 3300005842 Bacteria 4119
74 Ga0068860_100025921 3300005843 Bacteria 5657
75 Ga0068860_100144029 3300005843 Bacteria 2292
76 Ga0075369_10035253 3300006186 Bacteria 2126
77 Ga0068865_100012995 3300006881 Bacteria 5250
78 Ga0068865_100039744 3300006881 Bacteria 3193
79 Ga0097620_100400170 3300006931 Bacteria 1469
80 Ga0079104_1021933 3300006946 Bacteria 1729
81 Ga0105240_10000587 3300009093 Bacteria 67507
82 Ga0105240_10001398 3300009093 Bacteria 41467
83 Ga0105240_10004288 3300009093 Bacteria 21788
84 Ga0105240_10012569 3300009093 Bacteria 11680
85 Ga0105240_10016320 3300009093 Bacteria 10059
86 Ga0105240_10023313 3300009093 Bacteria 8190
87 Ga0105240_10077254 3300009093 Bacteria 4102
88 Ga0105240_10131839 3300009093 Bacteria 2997
89 Ga0111539_10071298 3300009094 Bacteria 4100
90 Ga0105241_10000245 3300009174 Bacteria 41232
91 Ga0105248_10001319 3300009177 Bacteria 27642
92 Ga0105248_10009465 3300009177 Bacteria 10724
93 Ga0105237_10001780 3300009545 Bacteria 27851
94 Ga0105237_10004084 3300009545 Bacteria 17024
95 Ga0105237_10029113 3300009545 Bacteria 5618
96 Ga0105238_10000290 3300009551 Bacteria 55810
97 Ga0105238_10195595 3300009551 Bacteria 1998
98 Ga0105249_10000359 3300009553 Bacteria 45709
99 Ga0099796_10013152 3300010159 Bacteria 2356
100 Ga0105239_10000615 3300010375 Bacteria 50705
101 Ga0105239_10451891 3300010375 Bacteria 1458
102 Ga0157370_10000822 3300013104 Bacteria 39237
103 Ga0157370_10016219 3300013104 Bacteria 7550
104 Ga0157370_10073689 3300013104 Bacteria 3222
105 Ga0157378_10093722 3300013297 Bacteria 2734
106 Ga0157378_10098072 3300013297 Bacteria 2672
107 Ga0163162_10001998 3300013306 Bacteria 19189
108 Ga0163162_10003005 3300013306 Bacteria 16118
109 Ga0163162_10096970 3300013306 Bacteria 3037
110 Ga0157372_10063536 3300013307 Bacteria 4140
111 Ga0157372_10108060 3300013307 Bacteria 3184
112 Ga0157375_10346297 3300013308 Unclassified 1651
113 Ga0163163_10194275 3300014325 Bacteria 2077
114 Ga0157377_10039952 3300014745 Unclassified 2596
115 Ga0157379_10017001 3300014968 Bacteria 6402
116 Ga0157376_10011240 3300014969 Bacteria 6591
117 Ga0182007_10002924 3300015262 Bacteria 8298
118 Ga0182007_10016780 3300015262 Bacteria 2692
119 Ga0182005_1000492 3300015265 Bacteria 20288
120 Ga0163161_10010075 3300017792 Bacteria 6542
121 Ga0213872_10003481 3300021361 Bacteria 8726
122 Ga0213875_10003833 3300021388 Bacteria 8446
123 Ga0209435_100016 3300025206 Bacteria 305566
124 Ga0209435_100101 3300025206 Bacteria 35039
125 Ga0209760_101144 3300025207 Bacteria 3005
126 Ga0209784_100048 3300025224 Bacteria 198885
127 Ga0209566_100060 3300025225 Bacteria 198885
128 Ga0209674_100082 3300025226 Bacteria 198885
129 Ga0209147_100023 3300025229 Bacteria 437803
130 Ga0209563_100082 3300025230 Bacteria 198750
131 Ga0207427_101380 3300025231 Bacteria 8893
132 Ga0209437_100125 3300025233 Bacteria 198146
133 Ga0209437_100166 3300025233 Bacteria 144787
134 Ga0209258_100345 3300025242 Bacteria 67870
135 Ga0209646_1000033 3300025246 Bacteria 369507
136 Ga0209646_1000093 3300025246 Bacteria 183840
137 Ga0209026_1000031 3300025250 Bacteria 325747
138 Ga0209026_1003180 3300025250 Bacteria 5563
139 Ga0209677_100046 3300025253 Bacteria 198287
140 Ga0209759_1000227 3300025256 Bacteria 84278
141 Ga0209759_1000346 3300025256 Bacteria 60977
142 Ga0209233_1000138 3300025261 Bacteria 198287
143 Ga0207680_10000006 3300025903 Bacteria 635950
144 Ga0207645_10012681 3300025907 Bacteria 5715
145 Ga0207705_10000585 3300025909 Bacteria 30596
146 Ga0207705_10085877 3300025909 Bacteria 2299
147 Ga0207654_10000743 3300025911 Bacteria 18094
148 Ga0207707_10000487 3300025912 Bacteria 41080
149 Ga0207707_10026274 3300025912 Bacteria 5090
150 Ga0207707_10148890 3300025912 Bacteria 2047
151 Ga0207695_10006362 3300025913 Bacteria 15366
152 Ga0207695_10013425 3300025913 Bacteria 9770
153 Ga0207695_10015715 3300025913 Bacteria 8898
154 Ga0207695_10017376 3300025913 Bacteria 8370
155 Ga0207695_10017999 3300025913 Bacteria 8181
156 Ga0207695_10042107 3300025913 Bacteria 4882
157 Ga0207695_10082787 3300025913 Bacteria 3243
158 Ga0207671_10003233 3300025914 Bacteria 16389
159 Ga0207671_10004391 3300025914 Bacteria 13519
160 Ga0207671_10037919 3300025914 Bacteria 3573
161 Ga0207671_10107396 3300025914 Bacteria 2120
162 Ga0207693_10091290 3300025915 Bacteria 2388
163 Ga0207660_10000332 3300025917 Bacteria 30478
164 Ga0207660_10167073 3300025917 Bacteria 1701
165 Ga0207649_10150144 3300025920 Bacteria 1604
166 Ga0207652_10000296 3300025921 Bacteria 51546
167 Ga0207694_10000311 3300025924 Bacteria 45796
168 Ga0207694_10162832 3300025924 Bacteria 1803
169 Ga0207664_10175049 3300025929 Bacteria 1839
170 Ga0207690_10025202 3300025932 Bacteria 3731
171 Ga0207669_10008636 3300025937 Bacteria 4796
172 Ga0207704_10008322 3300025938 Bacteria 4952
173 Ga0207711_10000013 3300025941 Bacteria 514850
174 Ga0207711_10000470 3300025941 Bacteria 41566
175 Ga0207711_10024510 3300025941 Bacteria 5057
176 Ga0207661_10096245 3300025944 Bacteria 2477
177 Ga0207667_10019089 3300025949 Bacteria 7665
178 Ga0207667_10026316 3300025949 Bacteria 6358
179 Ga0207667_10046731 3300025949 Bacteria 4584
180 Ga0207667_10109868 3300025949 Bacteria 2844
181 Ga0207667_10193974 3300025949 Bacteria 2084
182 Ga0207651_10215122 3300025960 Bacteria 1550
183 Ga0207712_10001143 3300025961 Bacteria 18476
184 Ga0207668_10021791 3300025972 Bacteria 4091
185 Ga0207658_10000006 3300025986 Bacteria 392309
186 Ga0207658_10014020 3300025986 Bacteria 5486
187 Ga0207703_10047491 3300026035 Bacteria 3462
188 Ga0207639_10015783 3300026041 Bacteria 5331
189 Ga0207639_10044739 3300026041 Bacteria 3331
190 Ga0207678_10000596 3300026067 Bacteria 33081
191 Ga0207678_10002280 3300026067 Bacteria 17365
192 Ga0207702_10017461 3300026078 Bacteria 5935
193 Ga0207674_10005608 3300026116 Bacteria 14880
194 Ga0207675_100046720 3300026118 Bacteria 4046
195 Ga0207698_10159462 3300026142 Bacteria 1971
196 Ga0268266_10000043 3300028379 Bacteria 316604
197 Ga0268266_10000049 3300028379 Bacteria 307763
198 Ga0268264_10000041 3300028381 Bacteria 372501
199 Ga0268264_10019215 3300028381 Bacteria 5584
200 Ga0268264_10120282 3300028381 Bacteria 2314
201 Ga0265319_1012217 3300028563 Bacteria 3479
202 Ga0265334_10000471 3300028573 Bacteria 20776
203 Ga0265318_10000764 3300028577 Bacteria 21437
204 Ga0265338_10017020 3300028800 Bacteria 7862
205 Ga0265338_10020998 3300028800 Bacteria 6831
206 Ga0265330_10020852 3300031235 Bacteria 2994
207 Ga0265332_10006933 3300031238 Bacteria 5134
208 Ga0265328_10001805 3300031239 Bacteria 9769
209 Ga0265320_10008247 3300031240 Bacteria 6386
210 Ga0265325_10066018 3300031241 Bacteria 1825
211 Ga0265325_10080936 3300031241 Bacteria 1614
212 Ga0265329_10010248 3300031242 Bacteria 3452
213 Ga0265340_10009770 3300031247 Bacteria 5143
214 Ga0265340_10066337 3300031247 Bacteria 1718
215 Ga0265331_10012655 3300031250 Bacteria 4562
216 Ga0265316_10020751 3300031344 Bacteria 5584
217 Ga0307408_100174514 3300031548 Bacteria 1719
218 Ga0265313_10013990 3300031595 Bacteria 4777
219 Ga0265314_10023514 3300031711 Bacteria 4696
220 Ga0307516_10000050 3300031730 Bacteria 129848
221 Ga0307516_10000577 3300031730 Bacteria 49482
222 Ga0307414_10004044 3300032004 Bacteria 7911
223 Ga0307510_10192159 3300033180 Bacteria 1588
224 Ga0316212_1002434 3300033547 Bacteria 2655
225 Ga0373934_0000077 3300035086 Bacteria 34309
226 Ga0373956_0001817 3300035119 Bacteria 8810
227 Ga0373957_0002465 3300035120 Bacteria 5291
228 Ga0373943_0001918 3300035170 Bacteria 9411
229 Ga0373946_0046785 3300035171 Bacteria 1794
230 Ga0373955_0011624 3300035172 Bacteria 4204
231 Ga0373955_0044405 3300035172 Bacteria 2394
232 Ga0373935_0036608 3300035692 Bacteria 3069
233 Ga0373935_0063595 3300035692 Bacteria 2365
234 Ga0373933_0000626 3300035724 Bacteria 22055
235 Ga0373947_0002035 3300035725 Bacteria 12345
236 Ga0373937_0001529 3300036401 Bacteria 19466
237 Ga0373937_0013644 3300036401 Bacteria 7159
238 Ga0373925_0002936 3300037068 Bacteria 13454
239 Ga0436364_0094686 3300037853 Bacteria 72452
240 Ga0436360_0139163 3300039438 Bacteria 5073
241 Ga0436361_1136812 3300039447 Bacteria 13502
242 Ga0436363_0316777 3300039450 Bacteria 1594
243 Ga0436363_0911147 3300039450 Bacteria 6223
244 Ga0466969_0004945 3300044656 Bacteria 7102
245 Ga0466969_0009411 3300044656 Bacteria 5179
246 Ga0453683_0000784 3300044673 Bacteria 31467
247 Ga0466961_0020114 3300044693 Bacteria 4296
248 Ga0466964_0055751 3300044706 Bacteria 1632
249 Ga0466971_0003714 3300044719 Bacteria 6531
250 Ga0466970_0013598 3300044765 Bacteria 4174
251 Ga0466959_0004815 3300045049 Bacteria 9116
252 Ga0466959_0131248 3300045049 Bacteria 1775
253 Ga0495592_0004888 3300046454 Bacteria 9862
254 Ga0495592_0005055 3300046454 Bacteria 9705
255 Ga0495603_0024502 3300046455 Bacteria 3650
256 Ga0495629_0006314 3300046459 Bacteria 8793
257 Ga0495629_0029485 3300046459 Bacteria 3890
258 Ga0495651_0001476 3300046462 Bacteria 18194
259 Ga0495651_0001484 3300046462 Bacteria 18152
260 Ga0495651_0012923 3300046462 Bacteria 6451
261 Ga0495651_0108252 3300046462 Bacteria 2058
262 Ga0495653_0001386 3300046463 Bacteria 18823
263 Ga0495653_0005547 3300046463 Bacteria 10285
264 Ga0495653_0011111 3300046463 Bacteria 7363
265 Ga0495650_0005691 3300046471 Bacteria 7991
266 Ga0495580_0000920 3300046472 Bacteria 25688
267 Ga0495580_0091506 3300046472 Bacteria 2117
268 Ga0495582_0000540 3300046473 Bacteria 20914
269 Ga0495639_0000299 3300046475 Bacteria 24262
270 Ga0495608_0000523 3300046511 Bacteria 26314
271 Ga0495608_0041189 3300046511 Bacteria 3093
272 Ga0495628_0000082 3300046516 Bacteria 74118
273 Ga0495628_0003467 3300046516 Bacteria 14110
274 Ga0495628_0003994 3300046516 Bacteria 13144
275 Ga0495630_0002506 3300046517 Bacteria 12734
276 Ga0495630_0059309 3300046517 Bacteria 2871
277 Ga0495630_0099524 3300046517 Bacteria 2200
278 Ga0495652_0003723 3300046529 Bacteria 14928
279 Ga0495652_0006795 3300046529 Bacteria 10604
280 Ga0495652_0053746 3300046529 Bacteria 3432
281 Ga0495652_0073792 3300046529 Bacteria 2839
282 Ga0495665_0002836 3300046531 Bacteria 9358
283 Ga0495640_0197257 3300046533 Bacteria 1277
284 Ga0495587_0000978 3300046536 Bacteria 18740
285 Ga0495587_0001512 3300046536 Bacteria 15462
286 Ga0495645_0000667 3300046543 Bacteria 23683
287 Ga0495645_0029023 3300046543 Bacteria 4020
288 Ga0495667_0000488 3300046559 Bacteria 25260
289 Ga0495667_0001496 3300046559 Bacteria 15406
290 Ga0495667_0050315 3300046559 Bacteria 2751
291 Ga0495625_0001333 3300046660 Bacteria 30655
292 Ga0495625_0050305 3300046660 Bacteria 2991
293 Ga0495635_0000277 3300046663 Bacteria 32937
294 Ga0495588_0000608 3300046674 Bacteria 16869
295 Ga0495657_0001251 3300046675 Bacteria 22150
296 Ga0495599_0006853 3300046678 Bacteria 6888
297 Ga0495646_0000984 3300046680 Bacteria 16352
298 Ga0495646_0004067 3300046680 Bacteria 9176
299 Ga0495646_0106200 3300046680 Bacteria 1603
300 Ga0495658_0000216 3300046683 Bacteria 32922
301 Ga0495658_0017414 3300046683 Unclassified 3711
302 Ga0495613_0006968 3300046689 Bacteria 8428
303 Ga0495600_0000093 3300046809 Bacteria 48851
304 Ga0495600_0010311 3300046809 Bacteria 5798
305 Ga0495600_0048993 3300046809 Bacteria 2756
306 Ga0495581_0000157 3300047315 Bacteria 30371
307 Ga0495604_0000028 3300047317 Bacteria 141804
308 Ga0495604_0002857 3300047317 Bacteria 13848
309 Ga0495604_0031460 3300047317 Bacteria 4208
310 Ga0495674_0054543 3300047319 Bacteria 3510
311 Ga0495674_0064130 3300047319 Bacteria 3194
312 Ga0495680_0001762 3300047322 Bacteria 22946
313 Ga0495680_0002507 3300047322 Bacteria 18781
314 Ga0495680_0085312 3300047322 Bacteria 2378
315 Ga0495675_0005454 3300047444 Bacteria 7756
316 Ga0495684_0000729 3300047471 Bacteria 26499
317 Ga0495684_0001713 3300047471 Bacteria 17651
318 Ga0495684_0101851 3300047471 Bacteria 2171
319 Ga0495686_0005918 3300047472 Bacteria 9521
320 Ga0495593_0000204 3300047673 Bacteria 31275
321 Ga0495602_0001478 3300048088 Bacteria 23356
322 Ga0495614_0000137 3300048089 Bacteria 25977
323 Ga0496101_0055221 3300048904 Bacteria 2868
324 Ga0496103_0028450 3300048906 Bacteria 3392
325 Ga0496104_0012094 3300048907 Bacteria 7747
326 Ga0496104_0086102 3300048907 Bacteria 3000
327 Ga0496105_0000815 3300048908 Bacteria 21113
328 Ga0496105_0013667 3300048908 Bacteria 6446
329 Ga0496106_0083002 3300048909 Bacteria 2464
330 Ga0496107_0004645 3300048910 Bacteria 9316
331 Ga0496109_0180631 3300048912 Bacteria 1982
332 Ga0496114_0045412 3300048917 Bacteria 3649
333 Ga0496115_0011221 3300048918 Bacteria 6713
334 Ga0496115_0097118 3300048918 Bacteria 2413
335 Ga0496116_0013017 3300048919 Bacteria 6746
336 Ga0496118_0031079 3300048921 Bacteria 4438
337 Ga0496121_0069591 3300048924 Bacteria 2839
338 Ga0496121_0072617 3300048924 Bacteria 2762
339 Ga0496122_0000457 3300048925 Bacteria 84895
340 Ga0496122_0000463 3300048925 Bacteria 84540
341 Ga0496122_0004210 3300048925 Bacteria 18088
342 Ga0496123_0000296 3300048926 Bacteria 97428
343 Ga0496123_0000321 3300048926 Bacteria 91682
344 Ga0496123_0001099 3300048926 Bacteria 40612
345 Ga0496125_0000895 3300048928 Bacteria 47230
346 Ga0496125_0031013 3300048928 Bacteria 4772
347 Ga0501031_0002332 3300049568 Bacteria 12020
348 Ga0501031_0003787 3300049568 Bacteria 9737
349 Ga0501032_0076115 3300049569 Bacteria 2235
350 Ga0501033_0001402 3300049570 Bacteria 21391
351 Ga0501034_0033656 3300049571 Bacteria 5197
352 Ga0501034_0066825 3300049571 Bacteria 3609
353 Ga0501037_0007686 3300049573 Bacteria 7891
354 Ga0501037_0098323 3300049573 Bacteria 2114
355 Ga0501038_0002803 3300049574 Bacteria 16230
356 Ga0501038_0150670 3300049574 Bacteria 1896
357 Ga0501039_0011940 3300049575 Bacteria 6620
358 Ga0501043_0004990 3300049579 Bacteria 10736
359 Ga0501047_0001398 3300049581 Bacteria 23652
360 Ga0501067_0012936 3300049583 Bacteria 4618
361 Ga0501070_0045436 3300049586 Bacteria 3653
362 Ga0501070_0207559 3300049586 Bacteria 1608
363 Ga0501072_0005592 3300049588 Bacteria 9564
364 Ga0501073_0017420 3300049589 Bacteria 5204
365 Ga0501073_0081629 3300049589 Bacteria 2249
366 Ga0501074_0034587 3300049590 Bacteria 3662
367 Ga0501076_0088109 3300049592 Bacteria 2495
368 Ga0501249_000507 3300049679 Bacteria 9478
369 Ga0501079_0001752 3300049741 Bacteria 15470
370 Ga0501080_0000015 3300049742 Bacteria 98057
371 Ga0501080_0170181 3300049742 Bacteria 2009
372 Ga0501035_0000350 3300049822 Bacteria 52924
373 Ga0501035_0036581 3300049822 Bacteria 4449
374 Ga0501044_0151058 3300049823 Bacteria 2304
375 nmdc:mga0n895_231448_c1 3300050512 Bacteria 1875
376 Ga0495601_0020062 3300053077 Bacteria 4079
377 Ga0495601_0077035 3300053077 Bacteria 2135
378 Ga0495612_0000189 3300053078 Bacteria 26228
379 Ga0495619_0001396 3300053085 Bacteria 15904
380 Ga0500643_003723 3300053087 Bacteria 7169
381 Ga0500595_002583 3300053119 Bacteria 8844
382 Ga0500597_000435 3300053120 Bacteria 8770
383 Ga0500608_000890 3300053122 Bacteria 10771
384 Ga0500614_008275 3300053123 Bacteria 2205
385 Ga0500564_002170 3300053138 Bacteria 7144
386 Ga0500573_0065509 3300053140 Bacteria 2077
387 Ga0500574_000824 3300053141 Bacteria 4199
388 Ga0500567_008380 3300053723 Bacteria 4888
389 Ga0500625_000034 3300053729 Bacteria 48891
390 Ga0466962_0000889 3300061719 Bacteria 13584

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100012154 Ga0070668_1000121549 390
2 3300005356 Ga0070674_100015576 Ga0070674_1000155766 390
3 3300005367 Ga0070667_100049221 Ga0070667_1000492213 390
4 3300005441 Ga0070700_100027934 Ga0070700_1000279341 390
5 3300005456 Ga0070678_100014523 Ga0070678_1000145236 390
6 3300005578 Ga0068854_100163354 Ga0068854_1001633542 390
7 3300005719 Ga0068861_100004563 Ga0068861_1000045638 390
8 3300005843 Ga0068860_100025921 Ga0068860_1000259217 390
9 3300006881 Ga0068865_100012995 Ga0068865_1000129956 390
10 3300017792 Ga0163161_10010075 Ga0163161_100100759 390
11 3300025937 Ga0207669_10008636 Ga0207669_100086366 390
12 3300025938 Ga0207704_10008322 Ga0207704_100083225 390
13 3300025972 Ga0207668_10021791 Ga0207668_100217915 390
14 3300026118 Ga0207675_100046720 Ga0207675_1000467201 390
15 3300028381 Ga0268264_10019215 Ga0268264_100192157 390
16 3300048904 Ga0496101_0055221 Ga0496101_0055221_1328_2593 390
17 3300048906 Ga0496103_0028450 Ga0496103_0028450_1397_2662 390
18 3300048907 Ga0496104_0086102 Ga0496104_0086102_430_1695 390
19 3300048908 Ga0496105_0013667 Ga0496105_0013667_475_1740 390
20 3300048909 Ga0496106_0083002 Ga0496106_0083002_869_2134 390
21 3300048910 Ga0496107_0004645 Ga0496107_0004645_5666_6931 390
22 3300048917 Ga0496114_0045412 Ga0496114_0045412_1672_2937 390
23 3300048918 Ga0496115_0097118 Ga0496115_0097118_717_1982 390
24 3300005354 Ga0070675_100296311 Ga0070675_1002963111 391
25 3300039450 Ga0436363_0316777 Ga0436363_0316777_263_1522 394
26 3300013306 Ga0163162_10001998 Ga0163162_100019982 395
27 3300028381 Ga0268264_10000041 Ga0268264_10000041218 395
28 3300028379 Ga0268266_10000049 Ga0268266_10000049158 396
29 3300005455 Ga0070663_100000431 Ga0070663_10000043113 397
30 3300005614 Ga0068856_100013216 Ga0068856_1000132168 397
31 3300009177 Ga0105248_10001319 Ga0105248_100013192 397
32 3300013104 Ga0157370_10073689 Ga0157370_100736893 397
33 3300025914 Ga0207671_10004391 Ga0207671_1000439114 397
34 3300026067 Ga0207678_10000596 Ga0207678_1000059623 397
35 3300026078 Ga0207702_10017461 Ga0207702_100174614 397
36 3300031730 Ga0307516_10000577 Ga0307516_1000057724 397
37 3300048925 Ga0496122_0000463 Ga0496122_0000463_17134_18417 397
38 3300048926 Ga0496123_0000296 Ga0496123_0000296_40761_42044 397
39 3300005367 Ga0070667_100000005 Ga0070667_10000000576 398
40 3300005455 Ga0070663_100020372 Ga0070663_1000203723 398
41 3300005539 Ga0068853_100002772 Ga0068853_10000277210 398
42 3300025941 Ga0207711_10000470 Ga0207711_1000047028 398
43 3300025986 Ga0207658_10000006 Ga0207658_10000006297 398
44 3300028563 Ga0265319_1012217 Ga0265319_10122173 398
45 3300028573 Ga0265334_10000471 Ga0265334_1000047117 398
46 3300028577 Ga0265318_10000764 Ga0265318_100007647 398
47 3300028800 Ga0265338_10017020 Ga0265338_100170204 398
48 3300031235 Ga0265330_10020852 Ga0265330_100208523 398
49 3300031238 Ga0265332_10006933 Ga0265332_100069332 398
50 3300031239 Ga0265328_10001805 Ga0265328_100018053 398
51 3300031240 Ga0265320_10008247 Ga0265320_100082472 398
52 3300031241 Ga0265325_10066018 Ga0265325_100660181 398
53 3300031242 Ga0265329_10010248 Ga0265329_100102483 398
54 3300031247 Ga0265340_10066337 Ga0265340_100663372 398
55 3300031250 Ga0265331_10012655 Ga0265331_100126552 398
56 3300031344 Ga0265316_10020751 Ga0265316_100207512 398
57 3300031595 Ga0265313_10013990 Ga0265313_100139902 398
58 3300031711 Ga0265314_10023514 Ga0265314_100235142 398
59 iso_pu_bacteria 2526164512 2526211506 398
60 3300010159 Ga0099796_10013152 Ga0099796_100131522 399
61 3300025915 Ga0207693_10091290 Ga0207693_100912902 399
62 3300046454 Ga0495592_0005055 Ga0495592_0005055_5209_6450 399
63 3300046462 Ga0495651_0001484 Ga0495651_0001484_943_2184 399
64 3300046463 Ga0495653_0011111 Ga0495653_0011111_4817_6058 399
65 3300046511 Ga0495608_0041189 Ga0495608_0041189_1020_2261 399
66 3300046516 Ga0495628_0003467 Ga0495628_0003467_64_1305 399
67 3300046517 Ga0495630_0059309 Ga0495630_0059309_790_2031 399
68 3300046529 Ga0495652_0006795 Ga0495652_0006795_1509_2750 399
69 3300046536 Ga0495587_0001512 Ga0495587_0001512_7176_8417 399
70 3300046543 Ga0495645_0029023 Ga0495645_0029023_176_1417 399
71 3300046559 Ga0495667_0000488 Ga0495667_0000488_5222_6463 399
72 3300046809 Ga0495600_0010311 Ga0495600_0010311_1532_2773 399
73 3300047317 Ga0495604_0002857 Ga0495604_0002857_176_1417 399
74 3300047322 Ga0495680_0002507 Ga0495680_0002507_6892_8133 399
75 3300047471 Ga0495684_0001713 Ga0495684_0001713_10497_11738 399
76 iso_pu_bacteria 2818991436 2819544707 399
77 3300005354 Ga0070675_100205680 Ga0070675_1002056801 400
78 3300005456 Ga0070678_100048880 Ga0070678_1000488803 400
79 3300005459 Ga0068867_100037290 Ga0068867_1000372905 400
80 3300006186 Ga0075369_10035253 Ga0075369_100352532 400
81 3300013308 Ga0157375_10346297 Ga0157375_103462972 400
82 3300014745 Ga0157377_10039952 Ga0157377_100399524 400
83 3300033180 Ga0307510_10192159 Ga0307510_101921592 400
84 3300049592 Ga0501076_0088109 Ga0501076_0088109_877_2100 400
85 3300005289 Ga0065704_10003347 Ga0065704_100033475 401
86 3300005458 Ga0070681_10006482 Ga0070681_100064822 401
87 3300005546 Ga0070696_100000044 Ga0070696_1000000446 401
88 3300005548 Ga0070665_100081663 Ga0070665_1000816631 401
89 3300005563 Ga0068855_100000604 Ga0068855_10000060422 401
90 3300009093 Ga0105240_10000587 Ga0105240_100005872 401
91 3300009093 Ga0105240_10023313 Ga0105240_100233135 401
92 3300009093 Ga0105240_10131839 Ga0105240_101318392 401
93 3300009094 Ga0111539_10071298 Ga0111539_100712983 401
94 3300009545 Ga0105237_10029113 Ga0105237_100291132 401
95 3300009551 Ga0105238_10195595 Ga0105238_101955952 401
96 3300021388 Ga0213875_10003833 Ga0213875_100038336 401
97 3300025912 Ga0207707_10148890 Ga0207707_101488902 401
98 3300025913 Ga0207695_10017999 Ga0207695_100179994 401
99 3300025913 Ga0207695_10042107 Ga0207695_100421075 401
100 3300025914 Ga0207671_10107396 Ga0207671_101073962 401
101 3300025924 Ga0207694_10162832 Ga0207694_101628322 401
102 3300025941 Ga0207711_10000013 Ga0207711_10000013313 401
103 3300025949 Ga0207667_10046731 Ga0207667_100467314 401
104 3300035172 Ga0373955_0044405 Ga0373955_0044405_875_2134 401
105 3300037853 Ga0436364_0094686 Ga0436364_0094686_26510_27763 401
106 3300045049 Ga0466959_0131248 Ga0466959_0131248_141_1385 401
107 3300046459 Ga0495629_0029485 Ga0495629_0029485_2334_3593 401
108 3300046559 Ga0495667_0050315 Ga0495667_0050315_703_1962 401
109 3300047322 Ga0495680_0085312 Ga0495680_0085312_257_1516 401
110 3300049573 Ga0501037_0098323 Ga0501037_0098323_768_2006 401
111 3300053077 Ga0495601_0077035 Ga0495601_0077035_270_1529 401
112 iso_pu_bacteria 2919437846 2919442115 401
113 3300005347 Ga0070668_100073138 Ga0070668_1000731382 402
114 3300005364 Ga0070673_100068201 Ga0070673_1000682013 402
115 3300005367 Ga0070667_100007154 Ga0070667_1000071544 402
116 3300005456 Ga0070678_100172500 Ga0070678_1001725001 402
117 3300005468 Ga0070707_100234588 Ga0070707_1002345882 402
118 3300005471 Ga0070698_100003839 Ga0070698_10000383917 402
119 3300005530 Ga0070679_100034361 Ga0070679_1000343613 402
120 3300005563 Ga0068855_100064198 Ga0068855_1000641982 402
121 3300005617 Ga0068859_100400151 Ga0068859_1004001511 402
122 3300005841 Ga0068863_100067026 Ga0068863_1000670263 402
123 3300005842 Ga0068858_100044421 Ga0068858_1000444212 402
124 3300006881 Ga0068865_100039744 Ga0068865_1000397442 402
125 3300006931 Ga0097620_100400170 Ga0097620_1004001702 402
126 3300009093 Ga0105240_10077254 Ga0105240_100772543 402
127 3300013104 Ga0157370_10016219 Ga0157370_100162194 402
128 3300013297 Ga0157378_10098072 Ga0157378_100980723 402
129 3300013306 Ga0163162_10096970 Ga0163162_100969703 402
130 3300014325 Ga0163163_10194275 Ga0163163_101942752 402
131 3300014968 Ga0157379_10017001 Ga0157379_100170011 402
132 3300014969 Ga0157376_10011240 Ga0157376_100112405 402
133 3300021361 Ga0213872_10003481 Ga0213872_100034813 402
134 3300025907 Ga0207645_10012681 Ga0207645_100126813 402
135 3300025913 Ga0207695_10082787 Ga0207695_100827874 402
136 3300025949 Ga0207667_10019089 Ga0207667_100190894 402
137 3300025986 Ga0207658_10014020 Ga0207658_100140202 402
138 3300026035 Ga0207703_10047491 Ga0207703_100474913 402
139 3300026041 Ga0207639_10015783 Ga0207639_100157834 402
140 3300026067 Ga0207678_10002280 Ga0207678_100022802 402
141 3300033547 Ga0316212_1002434 Ga0316212_10024341 402
142 3300039447 Ga0436361_1136812 Ga0436361_1136812_1385_2641 402
143 3300044656 Ga0466969_0009411 Ga0466969_0009411_20_1246 402
144 3300048912 Ga0496109_0180631 Ga0496109_0180631_197_1426 402
145 3300048921 Ga0496118_0031079 Ga0496118_0031079_42_1268 402
146 3300048924 Ga0496121_0072617 Ga0496121_0072617_600_1883 402
147 3300048925 Ga0496122_0004210 Ga0496122_0004210_14238_15464 402
148 3300048926 Ga0496123_0001099 Ga0496123_0001099_14318_15544 402
149 3300049568 Ga0501031_0003787 Ga0501031_0003787_6920_8143 402
150 3300049570 Ga0501033_0001402 Ga0501033_0001402_19785_21008 402
151 3300049571 Ga0501034_0033656 Ga0501034_0033656_2157_3380 402
152 3300049573 Ga0501037_0007686 Ga0501037_0007686_2391_3614 402
153 3300049574 Ga0501038_0002803 Ga0501038_0002803_12082_13305 402
154 3300049575 Ga0501039_0011940 Ga0501039_0011940_5289_6512 402
155 3300049579 Ga0501043_0004990 Ga0501043_0004990_5176_6399 402
156 3300049583 Ga0501067_0012936 Ga0501067_0012936_1239_2462 402
157 3300049588 Ga0501072_0005592 Ga0501072_0005592_2361_3584 402
158 3300049589 Ga0501073_0017420 Ga0501073_0017420_2743_3966 402
159 3300049590 Ga0501074_0034587 Ga0501074_0034587_1972_3195 402
160 3300049741 Ga0501079_0001752 Ga0501079_0001752_3376_4599 402
161 3300049742 Ga0501080_0000015 Ga0501080_0000015_60321_61544 402
162 3300049823 Ga0501044_0151058 Ga0501044_0151058_575_1798 402
163 iso_pu_bacteria 2721755763 2723875813 402
164 3300002737 JGI25162J39368_1000032 JGI25162J39368_100003266 403
165 3300003214 JGI25165J46597_1000067 JGI25165J46597_100006766 403
166 3300003751 Ga0055538_1000033 Ga0055538_100003366 403
167 3300003752 Ga0055539_1000045 Ga0055539_100004565 403
168 3300003756 Ga0055533_1000054 Ga0055533_100005466 403
169 3300003759 Ga0055525_1000065 Ga0055525_100006566 403
170 3300003841 Ga0055541_1000031 Ga0055541_100003166 403
171 3300005335 Ga0070666_10000058 Ga0070666_1000005824 403
172 3300005364 Ga0070673_100293626 Ga0070673_1002936262 403
173 3300005366 Ga0070659_100096689 Ga0070659_1000966891 403
174 3300005439 Ga0070711_100009318 Ga0070711_1000093182 403
175 3300005458 Ga0070681_10041648 Ga0070681_100416483 403
176 3300005458 Ga0070681_10081515 Ga0070681_100815154 403
177 3300005547 Ga0070693_100022238 Ga0070693_1000222383 403
178 3300005548 Ga0070665_100076609 Ga0070665_1000766092 403
179 3300005577 Ga0068857_100099285 Ga0068857_1000992852 403
180 3300005578 Ga0068854_100002891 Ga0068854_10000289112 403
181 3300005843 Ga0068860_100144029 Ga0068860_1001440292 403
182 3300009551 Ga0105238_10000290 Ga0105238_1000029015 403
183 3300013306 Ga0163162_10003005 Ga0163162_100030054 403
184 3300015262 Ga0182007_10002924 Ga0182007_100029247 403
185 3300015262 Ga0182007_10016780 Ga0182007_100167801 403
186 3300015265 Ga0182005_1000492 Ga0182005_100049213 403
187 3300025207 Ga0209760_101144 Ga0209760_1011442 403
188 3300025224 Ga0209784_100048 Ga0209784_10004866 403
189 3300025225 Ga0209566_100060 Ga0209566_10006066 403
190 3300025226 Ga0209674_100082 Ga0209674_10008266 403
191 3300025230 Ga0209563_100082 Ga0209563_10008266 403
192 3300025231 Ga0207427_101380 Ga0207427_1013804 403
193 3300025233 Ga0209437_100125 Ga0209437_10012565 403
194 3300025253 Ga0209677_100046 Ga0209677_10004665 403
195 3300025261 Ga0209233_1000138 Ga0209233_100013865 403
196 3300025903 Ga0207680_10000006 Ga0207680_10000006124 403
197 3300025909 Ga0207705_10000585 Ga0207705_1000058527 403
198 3300025909 Ga0207705_10085877 Ga0207705_100858771 403
199 3300025920 Ga0207649_10150144 Ga0207649_101501442 403
200 3300025924 Ga0207694_10000311 Ga0207694_1000031123 403
201 3300025932 Ga0207690_10025202 Ga0207690_100252024 403
202 3300025949 Ga0207667_10109868 Ga0207667_101098683 403
203 3300025960 Ga0207651_10215122 Ga0207651_102151222 403
204 3300026116 Ga0207674_10005608 Ga0207674_100056084 403
205 3300028379 Ga0268266_10000043 Ga0268266_10000043209 403
206 3300028381 Ga0268264_10120282 Ga0268264_101202823 403
207 3300028800 Ga0265338_10020998 Ga0265338_100209985 403
208 3300031241 Ga0265325_10080936 Ga0265325_100809362 403
209 3300031247 Ga0265340_10009770 Ga0265340_100097703 403
210 3300035086 Ga0373934_0000077 Ga0373934_0000077_4177_5430 403
211 3300035119 Ga0373956_0001817 Ga0373956_0001817_5770_7023 403
212 3300035120 Ga0373957_0002465 Ga0373957_0002465_3211_4464 403
213 3300035170 Ga0373943_0001918 Ga0373943_0001918_6248_7501 403
214 3300035171 Ga0373946_0046785 Ga0373946_0046785_272_1525 403
215 3300035172 Ga0373955_0011624 Ga0373955_0011624_1602_2855 403
216 3300035692 Ga0373935_0063595 Ga0373935_0063595_1017_2270 403
217 3300035724 Ga0373933_0000626 Ga0373933_0000626_3850_5103 403
218 3300035725 Ga0373947_0002035 Ga0373947_0002035_757_2010 403
219 3300036401 Ga0373937_0001529 Ga0373937_0001529_9698_10951 403
220 3300037068 Ga0373925_0002936 Ga0373925_0002936_3138_4391 403
221 3300039438 Ga0436360_0139163 Ga0436360_0139163_1475_2740 403
222 3300044656 Ga0466969_0004945 Ga0466969_0004945_2601_3839 403
223 3300044693 Ga0466961_0020114 Ga0466961_0020114_2910_4148 403
224 3300044706 Ga0466964_0055751 Ga0466964_0055751_314_1552 403
225 3300044719 Ga0466971_0003714 Ga0466971_0003714_401_1639 403
226 3300044765 Ga0466970_0013598 Ga0466970_0013598_336_1574 403
227 3300045049 Ga0466959_0004815 Ga0466959_0004815_2910_4148 403
228 3300046454 Ga0495592_0004888 Ga0495592_0004888_8540_9793 403
229 3300046455 Ga0495603_0024502 Ga0495603_0024502_671_1924 403
230 3300046459 Ga0495629_0006314 Ga0495629_0006314_1654_2907 403
231 3300046462 Ga0495651_0001476 Ga0495651_0001476_10385_11638 403
232 3300046462 Ga0495651_0012923 Ga0495651_0012923_2283_3518 403
233 3300046462 Ga0495651_0108252 Ga0495651_0108252_512_1747 403
234 3300046463 Ga0495653_0001386 Ga0495653_0001386_9706_10959 403
235 3300046463 Ga0495653_0005547 Ga0495653_0005547_7641_8876 403
236 3300046472 Ga0495580_0000920 Ga0495580_0000920_17716_18969 403
237 3300046473 Ga0495582_0000540 Ga0495582_0000540_11118_12371 403
238 3300046475 Ga0495639_0000299 Ga0495639_0000299_5314_6567 403
239 3300046511 Ga0495608_0000523 Ga0495608_0000523_12660_13913 403
240 3300046516 Ga0495628_0000082 Ga0495628_0000082_58745_59998 403
241 3300046516 Ga0495628_0003994 Ga0495628_0003994_675_1910 403
242 3300046517 Ga0495630_0002506 Ga0495630_0002506_8154_9407 403
243 3300046517 Ga0495630_0099524 Ga0495630_0099524_839_2104 403
244 3300046529 Ga0495652_0003723 Ga0495652_0003723_10649_11902 403
245 3300046529 Ga0495652_0053746 Ga0495652_0053746_744_2270 403
246 3300046529 Ga0495652_0073792 Ga0495652_0073792_470_1705 403
247 3300046531 Ga0495665_0002836 Ga0495665_0002836_1743_3002 403
248 3300046533 Ga0495640_0197257 Ga0495640_0197257_13_1266 403
249 3300046536 Ga0495587_0000978 Ga0495587_0000978_15744_16997 403
250 3300046543 Ga0495645_0000667 Ga0495645_0000667_995_2248 403
251 3300046559 Ga0495667_0001496 Ga0495667_0001496_13693_14946 403
252 3300046663 Ga0495635_0000277 Ga0495635_0000277_15799_17052 403
253 3300046674 Ga0495588_0000608 Ga0495588_0000608_11093_12346 403
254 3300046675 Ga0495657_0001251 Ga0495657_0001251_5737_6990 403
255 3300046678 Ga0495599_0006853 Ga0495599_0006853_4993_6228 403
256 3300046680 Ga0495646_0000984 Ga0495646_0000984_9747_11000 403
257 3300046680 Ga0495646_0004067 Ga0495646_0004067_6827_8062 403
258 3300046680 Ga0495646_0106200 Ga0495646_0106200_54_1289 403
259 3300046683 Ga0495658_0000216 Ga0495658_0000216_17561_18814 403
260 3300046683 Ga0495658_0017414 Ga0495658_0017414_1361_2596 403
261 3300046689 Ga0495613_0006968 Ga0495613_0006968_4581_5834 403
262 3300046809 Ga0495600_0000093 Ga0495600_0000093_15908_17161 403
263 3300046809 Ga0495600_0048993 Ga0495600_0048993_847_2082 403
264 3300047315 Ga0495581_0000157 Ga0495581_0000157_14849_16102 403
265 3300047317 Ga0495604_0000028 Ga0495604_0000028_21738_22991 403
266 3300047317 Ga0495604_0031460 Ga0495604_0031460_869_2104 403
267 3300047319 Ga0495674_0054543 Ga0495674_0054543_1398_2633 403
268 3300047319 Ga0495674_0064130 Ga0495674_0064130_597_1850 403
269 3300047322 Ga0495680_0001762 Ga0495680_0001762_1510_2763 403
270 3300047444 Ga0495675_0005454 Ga0495675_0005454_3598_4851 403
271 3300047471 Ga0495684_0000729 Ga0495684_0000729_9692_10945 403
272 3300047471 Ga0495684_0101851 Ga0495684_0101851_93_1328 403
273 3300047673 Ga0495593_0000204 Ga0495593_0000204_12368_13621 403
274 3300048088 Ga0495602_0001478 Ga0495602_0001478_20474_21727 403
275 3300048089 Ga0495614_0000137 Ga0495614_0000137_7150_8403 403
276 3300048907 Ga0496104_0012094 Ga0496104_0012094_4914_6140 403
277 3300048908 Ga0496105_0000815 Ga0496105_0000815_9597_10823 403
278 3300048918 Ga0496115_0011221 Ga0496115_0011221_5157_6383 403
279 3300049568 Ga0501031_0002332 Ga0501031_0002332_8633_9910 403
280 3300049571 Ga0501034_0066825 Ga0501034_0066825_2143_3375 403
281 3300049586 Ga0501070_0207559 Ga0501070_0207559_197_1486 403
282 3300049589 Ga0501073_0081629 Ga0501073_0081629_672_1961 403
283 3300049679 Ga0501249_000507 Ga0501249_000507_3370_4596 403
284 3300049742 Ga0501080_0170181 Ga0501080_0170181_561_1850 403
285 3300050512 nmdc:mga0n895_231448_c1 nmdc:mga0n895_231448_c1_305_1558 403
286 3300053077 Ga0495601_0020062 Ga0495601_0020062_2422_3657 403
287 3300053078 Ga0495612_0000189 Ga0495612_0000189_17390_18643 403
288 3300053085 Ga0495619_0001396 Ga0495619_0001396_7246_8499 403
289 3300053119 Ga0500595_002583 Ga0500595_002583_2530_3765 403
290 3300053122 Ga0500608_000890 Ga0500608_000890_2464_3690 403
291 3300053123 Ga0500614_008275 Ga0500614_008275_110_1336 403
292 3300053138 Ga0500564_002170 Ga0500564_002170_4214_5440 403
293 3300053140 Ga0500573_0065509 Ga0500573_0065509_63_1289 403
294 3300053141 Ga0500574_000824 Ga0500574_000824_2134_3369 403
295 3300053723 Ga0500567_008380 Ga0500567_008380_1459_2685 403
296 3300053729 Ga0500625_000034 Ga0500625_000034_17613_18839 403
297 3300061719 Ga0466962_0000889 Ga0466962_0000889_386_1624 403
298 iso_pu_bacteria 8003151029 8003154818 403
299 3300009093 Ga0105240_10001398 Ga0105240_1000139815 404
300 3300009093 Ga0105240_10012569 Ga0105240_1001256910 404
301 3300009177 Ga0105248_10009465 Ga0105248_100094656 404
302 3300009545 Ga0105237_10001780 Ga0105237_1000178015 404
303 3300009545 Ga0105237_10004084 Ga0105237_100040842 404
304 3300010375 Ga0105239_10000615 Ga0105239_1000061525 404
305 3300013297 Ga0157378_10093722 Ga0157378_100937222 404
306 3300025913 Ga0207695_10006362 Ga0207695_100063625 404
307 3300025913 Ga0207695_10013425 Ga0207695_100134258 404
308 3300025914 Ga0207671_10003233 Ga0207671_100032334 404
309 3300025914 Ga0207671_10037919 Ga0207671_100379192 404
310 3300025941 Ga0207711_10024510 Ga0207711_100245108 404
311 3300031730 Ga0307516_10000050 Ga0307516_1000005038 404
312 3300032004 Ga0307414_10004044 Ga0307414_100040445 404
313 3300035692 Ga0373935_0036608 Ga0373935_0036608_707_1975 404
314 3300039450 Ga0436363_0911147 Ga0436363_0911147_4547_5818 404
315 3300046471 Ga0495650_0005691 Ga0495650_0005691_2543_3814 404
316 3300046472 Ga0495580_0091506 Ga0495580_0091506_77_1345 404
317 3300046660 Ga0495625_0050305 Ga0495625_0050305_1547_2827 404
318 3300049569 Ga0501032_0076115 Ga0501032_0076115_209_1462 404
319 3300049581 Ga0501047_0001398 Ga0501047_0001398_1349_2602 404
320 3300049822 Ga0501035_0000350 Ga0501035_0000350_4515_5792 404
321 3300005295 Ga0065707_10086852 Ga0065707_100868526 405
322 3300005329 Ga0070683_100098446 Ga0070683_1000984462 405
323 3300005336 Ga0070680_100000224 Ga0070680_10000022412 405
324 3300005337 Ga0070682_100000299 Ga0070682_10000029914 405
325 3300005339 Ga0070660_100088028 Ga0070660_1000880282 405
326 3300005341 Ga0070691_10002867 Ga0070691_100028674 405
327 3300005458 Ga0070681_10001725 Ga0070681_100017259 405
328 3300005458 Ga0070681_10010666 Ga0070681_100106664 405
329 3300005530 Ga0070679_100001305 Ga0070679_10000130513 405
330 3300005530 Ga0070679_100035213 Ga0070679_1000352132 405
331 3300005563 Ga0068855_100067963 Ga0068855_1000679632 405
332 3300009093 Ga0105240_10004288 Ga0105240_100042882 405
333 3300009093 Ga0105240_10016320 Ga0105240_100163207 405
334 3300009174 Ga0105241_10000245 Ga0105241_100002452 405
335 3300009553 Ga0105249_10000359 Ga0105249_1000035928 405
336 3300010375 Ga0105239_10451891 Ga0105239_104518911 405
337 3300013104 Ga0157370_10000822 Ga0157370_1000082213 405
338 3300013307 Ga0157372_10063536 Ga0157372_100635362 405
339 3300013307 Ga0157372_10108060 Ga0157372_101080602 405
340 3300025911 Ga0207654_10000743 Ga0207654_1000074315 405
341 3300025912 Ga0207707_10000487 Ga0207707_1000048713 405
342 3300025912 Ga0207707_10026274 Ga0207707_100262743 405
343 3300025913 Ga0207695_10015715 Ga0207695_100157155 405
344 3300025917 Ga0207660_10000332 Ga0207660_1000033215 405
345 3300025917 Ga0207660_10167073 Ga0207660_101670732 405
346 3300025921 Ga0207652_10000296 Ga0207652_100002969 405
347 3300025944 Ga0207661_10096245 Ga0207661_100962452 405
348 3300025949 Ga0207667_10193974 Ga0207667_101939742 405
349 3300025961 Ga0207712_10001143 Ga0207712_100011432 405
350 3300026041 Ga0207639_10044739 Ga0207639_100447392 405
351 3300044673 Ga0453683_0000784 Ga0453683_0000784_863_2116 405
352 3300049586 Ga0501070_0045436 Ga0501070_0045436_1045_2301 405
353 iso_pu_bacteria 3003665799 3003667968 405
354 3300036401 Ga0373937_0013644 Ga0373937_0013644_3152_4405 406
355 3300049574 Ga0501038_0150670 Ga0501038_0150670_407_1657 406
356 3300031548 Ga0307408_100174514 Ga0307408_1001745142 407
357 iso_pu_bacteria 2511231003 2511251090 407
358 iso_pu_bacteria 2684623219 2687234565 407
359 iso_pu_bacteria 2818991445 2819591494 407
360 iso_pu_bacteria 2839094727 2839096861 407
361 iso_pu_bacteria 2884811622 2884816608 407
362 iso_pu_bacteria 2884836552 2884837303 407
363 iso_pu_bacteria 2884852848 2884853594 407
364 iso_pu_bacteria 2896154374 2896155289 407
365 3300006946 Ga0079104_1021933 Ga0079104_10219332 408
366 3300049822 Ga0501035_0036581 Ga0501035_0036581_2097_3377 408
367 3300005435 Ga0070714_100026121 Ga0070714_1000261213 409
368 3300005436 Ga0070713_100011004 Ga0070713_1000110043 409
369 3300025929 Ga0207664_10175049 Ga0207664_101750491 409
370 3300047472 Ga0495686_0005918 Ga0495686_0005918_2671_3972 409
371 3300053087 Ga0500643_003723 Ga0500643_003723_3207_4508 409
372 3300053120 Ga0500597_000435 Ga0500597_000435_7308_8609 409
373 iso_pu_bacteria 2808606386 2808981531 409
374 iso_pu_bacteria 2808606415 2809129114 409
375 iso_pu_bacteria 2808606419 2809148734 409
376 iso_pu_bacteria 2852618963 2852621272 409
377 3300002704 JGI25155J39150_1000080 JGI25155J39150_100008049 411
378 3300002704 JGI25155J39150_1000156 JGI25155J39150_100015612 411
379 3300002705 JGI25156J39149_1000112 JGI25156J39149_100011243 411
380 3300002705 JGI25156J39149_1000128 JGI25156J39149_100012849 411
381 3300002705 JGI25156J39149_1005221 JGI25156J39149_10052213 411
382 3300002738 JGI25154J39366_1000125 JGI25154J39366_100012551 411
383 3300002738 JGI25154J39366_1000143 JGI25154J39366_100014349 411
384 3300002738 JGI25154J39366_1000228 JGI25154J39366_100022819 411
385 3300002741 JGI25157J39369_1000134 JGI25157J39369_100013449 411
386 3300003758 Ga0055532_1000101 Ga0055532_100010148 411
387 3300003761 Ga0055535_1006081 Ga0055535_10060811 411
388 3300025206 Ga0209435_100016 Ga0209435_100016260 411
389 3300025206 Ga0209435_100101 Ga0209435_1001017 411
390 3300025229 Ga0209147_100023 Ga0209147_10002368 411
391 3300025233 Ga0209437_100166 Ga0209437_100166124 411
392 3300025242 Ga0209258_100345 Ga0209258_10034555 411
393 3300025246 Ga0209646_1000033 Ga0209646_100003349 411
394 3300025246 Ga0209646_1000093 Ga0209646_1000093147 411
395 3300025250 Ga0209026_1000031 Ga0209026_100003168 411
396 3300025250 Ga0209026_1003180 Ga0209026_10031802 411
397 3300025256 Ga0209759_1000227 Ga0209759_100022719 411
398 3300025256 Ga0209759_1000346 Ga0209759_100034628 411
399 3300025913 Ga0207695_10017376 Ga0207695_100173765 411
400 3300025949 Ga0207667_10026316 Ga0207667_100263165 411
401 3300026142 Ga0207698_10159462 Ga0207698_101594622 411
402 3300046660 Ga0495625_0001333 Ga0495625_0001333_5330_6571 411
403 3300048919 Ga0496116_0013017 Ga0496116_0013017_2385_3620 411
404 3300048924 Ga0496121_0069591 Ga0496121_0069591_1342_2577 411
405 3300048925 Ga0496122_0000457 Ga0496122_0000457_18183_19418 411
406 3300048926 Ga0496123_0000321 Ga0496123_0000321_58523_59758 411
407 3300048928 Ga0496125_0000895 Ga0496125_0000895_38243_39478 411
408 3300048928 Ga0496125_0031013 Ga0496125_0031013_479_1714 411

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

26

365

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.8437 23 411
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.8238 23 411
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8191 19 401
6g9x-assembly2.cif.gz_B crystal structure of a mfs transporter at 2.54 angstroem resolution 0.819 26 407
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.8142 26 403
ID Description Score Start End Superfamily
af_P52067_17_206_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9915 23 205 1.20.1250.20
af_P52067_222_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9731 224 411 1.20.1250.20
af_P52067_222_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9679 224 411 1.20.1250.20
af_P52067_17_206_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9502 23 205 1.20.1250.20
af_P0AA78_1_199_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9068 23 195 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3A9JEU6-F1-model_v4 MFS transporter 0.9844 24 402 GO:0005886
GO:0022857
AF-R7H0R1-F1-model_v4 Fosmidomycin resistance protein 0.9842 24 407 GO:0005886
GO:0022857
AF-A0A1W2AHR8-F1-model_v4 MFS transporter, FSR family, fosmidomycin resistance protein 0.9817 24 405 GO:0005886
GO:0022857
AF-A0A6N8L4I8-F1-model_v4 MFS transporter 0.9787 24 409 GO:0005886
GO:0022857
AF-A0A2T5Y5H1-F1-model_v4 deleted 0.9756 24 408

Feature Viewer

pLDDT pTM Quality
89.5 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map