F436720

General Info

Members Datasets Scaffolds Average Seq Length
408 264 816 483

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10089789|Ga0157378_100897892
Length 523
Sequence VKLSQFHLTFRVSRFTTILLKIISSVYLKNPFAMHKLTYLACLFLLAACSKNKVANETRTTTTDTSFSIDGKKVVVYTTADSTQLRLSATDTLSFADFDQPLETQASIFIDPSHTFQTFLGIGGALTDASAETFAKLPADKQKEVLQAYYDKDKGIGYTIGRTNINSCDFSSDTYTYVTDGDKELKSFNLAHDQKFKIPLIKKAMEAAGGKINLFVSPWSPPAWMKDNNDMLHGGKLKPEFYESWANYYVKFIQGYEKEGIPVWGLTVQNEPMAKQTWESCMYTAEDEKNFIKNSLGPTLQKNNLSDKKLIGWDHNRDLLYQRASSLLNDPDAAKYLWGIGFHWYEEWNGGRQYSNVELVHETFPDKNLMFTEGCNFPFSWQTFDNWKWGENYGENMIHDFNNGAVAWTDWNILLDETGGPNHVGNFCFAPIHAKTKEGTLHYMNSYYYIGHLSKFIRPGAKRIISSANRVQLLTTAFKNPDGKLSVVIMNPTGQKFSYRMYIGKKAVEATSLPHSISTLVVE

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
136 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
139 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
140 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
160 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
201 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
202 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
203 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
208 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
209 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
210 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
214 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
215 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
216 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
217 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
218 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
219 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
220 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
221 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
222 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
223 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
224 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
225 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
226 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
227 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
228 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
229 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
230 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
231 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
232 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
233 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
234 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
235 2738541278 Niastella sp. CF465 Isolate Unclassified
236 2738541283 Pedobacter sp. OK701 Isolate Unclassified
237 2738541302 Pedobacter sp. CF074 Isolate Unclassified
238 2739367651 Pedobacter sp. OK291 Isolate Unclassified
239 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
240 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
241 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
242 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
243 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
244 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
245 2818991437 Pedobacter terrae 518 Isolate Unclassified
246 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
247 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
248 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
249 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
250 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
251 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
252 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
253 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
254 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
255 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
256 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
257 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
258 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
259 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
260 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
261 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
262 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
263 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
264 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.99
Metatranscriptomes 0
Isolates 12.01

Biome Distribution

Category Percentage (%)
Aerial Root 0.49
Bulb 0
Endosphere 9.8
Nodule 0.49
Rhizoplane 0.25
Rhizosphere 75.49
Stem 0
Stem Tuber 0
Unclassified 1.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10089789 3300013297 Bacteria 2792
2 JGI25154J39366_1000817 3300002738 Bacteria 13585
3 JGI25157J39369_1000029 3300002741 Bacteria 146928
4 JGI25152J39213_1000128 3300002773 Bacteria 51965
5 JGI25150J39212_1000021 3300002774 Bacteria 133190
6 JGI25151J46595_10000078 3300003187 Bacteria 133190
7 JGI25153J46596_10000057 3300003215 Bacteria 133190
8 rootH1_10078411 3300003316 Bacteria 3560
9 rootH2_10041652 3300003320 Bacteria 8568
10 rootH2_10051986 3300003320 Bacteria 10715
11 rootH2_10054626 3300003320 Bacteria 4175
12 rootH1_10109720 3300003323 Bacteria 3443
13 rootH1_10110668 3300003323 Bacteria 14790
14 rootH1_10340325 3300003323 Unclassified 2464
15 Ga0055535_1005498 3300003761 Bacteria 2759
16 Ga0055542_1002086 3300003762 Bacteria 7444
17 Ga0055526_1003574 3300003771 Bacteria 9781
18 Ga0055536_1000009 3300003781 Bacteria 311572
19 Ga0055534_1011826 3300003784 Bacteria 1756
20 Ga0055528_1000694 3300003790 Bacteria 23961
21 Ga0055530_10001763 3300003791 Bacteria 15122
22 Ga0055530_10002396 3300003791 Bacteria 12131
23 Ga0065165_1000017 3300005262 Bacteria 278286
24 Ga0065714_10064467 3300005288 Bacteria 63317
25 Ga0065714_10083938 3300005288 Bacteria 2224
26 Ga0065707_10109826 3300005295 Bacteria 2454
27 Ga0070676_10023649 3300005328 Bacteria 3455
28 Ga0070683_100000385 3300005329 Bacteria 30659
29 Ga0070683_100005596 3300005329 Bacteria 10494
30 Ga0070683_100054689 3300005329 Bacteria 3702
31 Ga0070683_100059576 3300005329 Bacteria 3547
32 Ga0070677_10042078 3300005333 Bacteria 1807
33 Ga0068869_100003261 3300005334 Bacteria 9915
34 Ga0068869_100004654 3300005334 Bacteria 8559
35 Ga0068869_100022690 3300005334 Bacteria 4328
36 Ga0070666_10056461 3300005335 Bacteria 2651
37 Ga0070682_100001578 3300005337 Bacteria 12715
38 Ga0068868_100021099 3300005338 Bacteria 4904
39 Ga0068868_100034728 3300005338 Bacteria 3894
40 Ga0068868_100128595 3300005338 Bacteria 2071
41 Ga0070689_100001880 3300005340 Bacteria 13550
42 Ga0070689_100004250 3300005340 Bacteria 9651
43 Ga0070689_100020892 3300005340 Bacteria 4866
44 Ga0070661_100000521 3300005344 Bacteria 29488
45 Ga0070661_100008647 3300005344 Bacteria 7043
46 Ga0070661_100048783 3300005344 Bacteria 3100
47 Ga0070675_100071963 3300005354 Bacteria 2870
48 Ga0070671_100004285 3300005355 Bacteria 11287
49 Ga0070688_100015878 3300005365 Bacteria 4293
50 Ga0070659_100011491 3300005366 Bacteria 6549
51 Ga0070709_10000002 3300005434 Bacteria 322903
52 Ga0070663_100034542 3300005455 Bacteria 3502
53 Ga0070662_100005116 3300005457 Bacteria 8360
54 Ga0070662_100017037 3300005457 Bacteria 4889
55 Ga0070662_100040895 3300005457 Bacteria 3303
56 Ga0070662_100135170 3300005457 Bacteria 1905
57 Ga0070681_10020260 3300005458 Bacteria 6667
58 Ga0070698_100034668 3300005471 Bacteria 5223
59 Ga0070679_100056276 3300005530 Bacteria 3919
60 Ga0070684_100009989 3300005535 Bacteria 7504
61 Ga0068853_100003579 3300005539 Bacteria 11897
62 Ga0068853_100015944 3300005539 Bacteria 6177
63 Ga0068853_100111846 3300005539 Bacteria 2427
64 Ga0070672_100069123 3300005543 Bacteria 2803
65 Ga0070686_100097647 3300005544 Bacteria 1978
66 Ga0070695_100087025 3300005545 Bacteria 2078
67 Ga0070704_100121556 3300005549 Bacteria 2007
68 Ga0070664_100161713 3300005564 Unclassified 1981
69 Ga0070664_100211906 3300005564 Bacteria 1732
70 Ga0068857_100000097 3300005577 Bacteria 51356
71 Ga0068857_100007787 3300005577 Bacteria 9233
72 Ga0068857_100016176 3300005577 Bacteria 6532
73 Ga0068857_100042955 3300005577 Bacteria 4010
74 Ga0068854_100064645 3300005578 Bacteria 2658
75 Ga0068854_100120281 3300005578 Bacteria 1993
76 Ga0068856_100010911 3300005614 Bacteria 8818
77 Ga0068856_100128478 3300005614 Bacteria 2538
78 Ga0068852_100072587 3300005616 Bacteria 3025
79 Ga0068859_100067483 3300005617 Bacteria 3611
80 Ga0068864_100017282 3300005618 Bacteria 6012
81 Ga0068864_100037093 3300005618 Bacteria 4158
82 Ga0068864_100041783 3300005618 Unclassified 3921
83 Ga0068864_100059799 3300005618 Bacteria 3298
84 Ga0068866_10043294 3300005718 Bacteria 2246
85 Ga0068861_100023691 3300005719 Bacteria 4431
86 Ga0068870_10007053 3300005840 Bacteria 4990
87 Ga0068863_100126815 3300005841 Bacteria 2435
88 Ga0068858_100013636 3300005842 Bacteria 7671
89 Ga0068860_100060071 3300005843 Bacteria 3614
90 Ga0068860_100275521 3300005843 Bacteria 1643
91 Ga0081539_10010948 3300005985 Bacteria 7274
92 Ga0081539_10063336 3300005985 Bacteria 2018
93 Ga0070716_100094212 3300006173 Bacteria 1820
94 Ga0097621_100027966 3300006237 Bacteria 4439
95 Ga0097621_100123789 3300006237 Bacteria 2195
96 Ga0068871_100004751 3300006358 Bacteria 9495
97 Ga0068871_100052722 3300006358 Bacteria 3295
98 Ga0075434_100017821 3300006871 Bacteria 6850
99 Ga0075434_100190425 3300006871 Bacteria 2071
100 Ga0097620_100067484 3300006931 Bacteria 3611
101 Ga0099824_1001461 3300006942 Bacteria 33284
102 Ga0105244_10000114 3300009036 Bacteria 84368
103 Ga0105244_10000175 3300009036 Bacteria 65097
104 Ga0105244_10044681 3300009036 Bacteria 2281
105 Ga0114129_10128189 3300009147 Bacteria 3487
106 Ga0105243_10000485 3300009148 Bacteria 40540
107 Ga0105243_10212497 3300009148 Bacteria 1704
108 Ga0105237_10000723 3300009545 Bacteria 45657
109 Ga0105238_10051469 3300009551 Bacteria 4143
110 Ga0105239_10008004 3300010375 Bacteria 12064
111 Ga0105239_10054783 3300010375 Bacteria 4375
112 Ga0105246_10088068 3300011119 Bacteria 2230
113 Ga0157373_10000036 3300013100 Bacteria 122723
114 Ga0157370_10000241 3300013104 Bacteria 69817
115 Ga0157370_10004936 3300013104 Bacteria 15098
116 Ga0157370_10024727 3300013104 Bacteria 5947
117 Ga0157370_10052720 3300013104 Bacteria 3883
118 Ga0157370_10078822 3300013104 Bacteria 3102
119 Ga0157370_10118746 3300013104 Bacteria 2470
120 Ga0157369_10001697 3300013105 Bacteria 26845
121 Ga0157374_10004107 3300013296 Bacteria 12225
122 Ga0157374_10021600 3300013296 Bacteria 5730
123 Ga0157374_10108044 3300013296 Unclassified 2674
124 Ga0157378_10040834 3300013297 Bacteria 4115
125 Ga0157378_10044033 3300013297 Bacteria 3962
126 Ga0163162_10001345 3300013306 Bacteria 22882
127 Ga0163162_10001661 3300013306 Bacteria 20854
128 Ga0163162_10056079 3300013306 Bacteria 3969
129 Ga0163162_10065353 3300013306 Bacteria 3684
130 Ga0163162_10141245 3300013306 Bacteria 2522
131 Ga0157372_10065658 3300013307 Bacteria 4075
132 Ga0157375_10005733 3300013308 Bacteria 10806
133 Ga0157375_10009721 3300013308 Bacteria 8454
134 Ga0157375_10056849 3300013308 Bacteria 3865
135 Ga0157375_10203077 3300013308 Bacteria 2138
136 Ga0163163_10026797 3300014325 Bacteria 5513
137 Ga0157380_10000613 3300014326 Bacteria 21981
138 Ga0182008_10000039 3300014497 Bacteria 124930
139 Ga0182008_10000460 3300014497 Bacteria 31080
140 Ga0157377_10091790 3300014745 Bacteria 1794
141 Ga0157376_10107161 3300014969 Bacteria 2453
142 Ga0182006_1000011 3300015261 Bacteria 408647
143 Ga0182006_1000178 3300015261 Bacteria 66897
144 Ga0182006_1001691 3300015261 Bacteria 12905
145 Ga0183373_1003 3300015682 Bacteria 558813
146 Ga0163161_10000108 3300017792 Bacteria 78805
147 Ga0163161_10000955 3300017792 Bacteria 22177
148 Ga0163161_10002830 3300017792 Bacteria 12308
149 Ga0213876_10000366 3300021384 Bacteria 38521
150 Ga0209258_100333 3300025242 Bacteria 70926
151 Ga0207425_1000004 3300025245 Bacteria 1092421
152 Ga0209646_1000111 3300025246 Bacteria 155786
153 Ga0209026_1000054 3300025250 Bacteria 242508
154 Ga0209026_1000549 3300025250 Bacteria 25871
155 Ga0209026_1002350 3300025250 Bacteria 7158
156 Ga0209677_100105 3300025253 Bacteria 89277
157 Ga0209148_1000129 3300025254 Bacteria 175720
158 Ga0209759_1000043 3300025256 Bacteria 242513
159 Ga0209129_1000048 3300025258 Bacteria 270192
160 Ga0209455_1008118 3300025272 Bacteria 2886
161 Ga0209673_1000083 3300025273 Bacteria 216509
162 Ga0209675_1000367 3300025291 Bacteria 38392
163 Ga0209676_1000001 3300025292 Bacteria 1852142
164 Ga0209025_1000009 3300025294 Bacteria 1092561
165 Ga0209564_1004329 3300025295 Bacteria 8760
166 Ga0209758_1000010 3300025297 Bacteria 1092782
167 Ga0209758_1001318 3300025297 Bacteria 30178
168 Ga0209050_1000018 3300025298 Bacteria 723263
169 Ga0209050_1000273 3300025298 Bacteria 110451
170 Ga0207426_1001089 3300025302 Bacteria 25231
171 Ga0209257_1000308 3300025304 Bacteria 105012
172 Ga0207655_1003241 3300025728 Bacteria 12217
173 Ga0207643_10004031 3300025908 Bacteria 7904
174 Ga0207707_10038616 3300025912 Unclassified 4172
175 Ga0207695_10143104 3300025913 Bacteria 2338
176 Ga0207671_10001233 3300025914 Bacteria 30228
177 Ga0207657_10087213 3300025919 Bacteria 2611
178 Ga0207649_10004109 3300025920 Bacteria 7920
179 Ga0207659_10005427 3300025926 Bacteria 7726
180 Ga0207706_10030830 3300025933 Bacteria 4781
181 Ga0207706_10031447 3300025933 Bacteria 4728
182 Ga0207706_10067305 3300025933 Bacteria 3151
183 Ga0207686_10121091 3300025934 Bacteria 1781
184 Ga0207709_10000557 3300025935 Bacteria 31848
185 Ga0207670_10002959 3300025936 Bacteria 8969
186 Ga0207670_10004439 3300025936 Bacteria 7556
187 Ga0207691_10040969 3300025940 Bacteria 4279
188 Ga0207689_10001853 3300025942 Bacteria 20012
189 Ga0207689_10013102 3300025942 Bacteria 7079
190 Ga0207689_10040094 3300025942 Bacteria 3877
191 Ga0207689_10135752 3300025942 Bacteria 2026
192 Ga0207661_10002647 3300025944 Bacteria 12320
193 Ga0207661_10010507 3300025944 Bacteria 6666
194 Ga0207661_10086751 3300025944 Bacteria 2598
195 Ga0207661_10139618 3300025944 Bacteria 2084
196 Ga0207679_10021439 3300025945 Bacteria 4381
197 Ga0207679_10023164 3300025945 Bacteria 4241
198 Ga0207679_10064718 3300025945 Bacteria 2734
199 Ga0207667_10093176 3300025949 Bacteria 3111
200 Ga0207712_10040251 3300025961 Bacteria 3206
201 Ga0207712_10115543 3300025961 Bacteria 2020
202 Ga0207640_10004558 3300025981 Bacteria 7522
203 Ga0207640_10043984 3300025981 Bacteria 2858
204 Ga0207677_10080756 3300026023 Bacteria 2331
205 Ga0207703_10093405 3300026035 Bacteria 2534
206 Ga0207678_10018265 3300026067 Bacteria 6158
207 Ga0207702_10000376 3300026078 Bacteria 50989
208 Ga0207702_10041188 3300026078 Bacteria 3873
209 Ga0207641_10128449 3300026088 Bacteria 2272
210 Ga0207648_10116830 3300026089 Bacteria 2344
211 Ga0207676_10007689 3300026095 Bacteria 7657
212 Ga0207674_10009743 3300026116 Bacteria 10944
213 Ga0207674_10014698 3300026116 Bacteria 8632
214 Ga0207674_10038778 3300026116 Bacteria 4942
215 Ga0207674_10148780 3300026116 Bacteria 2299
216 Ga0207683_10001848 3300026121 Bacteria 18723
217 Ga0265319_1006597 3300028563 Bacteria 5355
218 Ga0265336_10000006 3300028666 Bacteria 348453
219 Ga0265336_10018486 3300028666 Bacteria 2258
220 Ga0307515_10000007 3300028794 Bacteria 719669
221 Ga0265324_10032195 3300029957 Bacteria 1833
222 Ga0307511_10001876 3300030521 Bacteria 22065
223 Ga0265332_10002104 3300031238 Bacteria 10309
224 Ga0265327_10000127 3300031251 Bacteria 166247
225 Ga0265327_10015613 3300031251 Bacteria 4887
226 Ga0265316_10134734 3300031344 Bacteria 1859
227 Ga0307513_10062773 3300031456 Bacteria 3925
228 Ga0307408_100000497 3300031548 Bacteria 34174
229 Ga0307508_10000677 3300031616 Bacteria 40943
230 Ga0307516_10002738 3300031730 Bacteria 23246
231 Ga0307405_10000031 3300031731 Bacteria 99176
232 Ga0307406_10082637 3300031901 Bacteria 2140
233 Ga0307407_10000036 3300031903 Bacteria 76457
234 Ga0307407_10030043 3300031903 Bacteria 2927
235 Ga0307412_10000012 3300031911 Bacteria 404180
236 Ga0307412_10000353 3300031911 Bacteria 28551
237 Ga0307412_10018587 3300031911 Bacteria 4187
238 Ga0307412_10087352 3300031911 Bacteria 2172
239 Ga0307416_100000007 3300032002 Bacteria 433284
240 Ga0307416_100000033 3300032002 Bacteria 156736
241 Ga0307414_10020645 3300032004 Bacteria 4110
242 Ga0307414_10124633 3300032004 Bacteria 1988
243 Ga0307507_10000071 3300033179 Bacteria 158391
244 Ga0373955_0033535 3300035172 Unclassified 2705
245 Ga0316584_0080369 3300036712 Bacteria 2442
246 Ga0373925_0106600 3300037068 Bacteria 2161
247 Ga0395900_0122723 3300037418 Bacteria 2665
248 Ga0436365_0603740 3300039437 Bacteria 61917
249 Ga0439465_0001960 3300041413 Bacteria 6750
250 Ga0439465_0003437 3300041413 Bacteria 5166
251 Ga0439445_0001428 3300042004 Bacteria 5187
252 Ga0439449_0014970 3300042007 Bacteria 2914
253 Ga0451577_0000044 3300042876 Bacteria 329357
254 Ga0451577_0000943 3300042876 Bacteria 42647
255 Ga0451577_0003129 3300042876 Bacteria 18667
256 Ga0451577_0003816 3300042876 Bacteria 16402
257 Ga0451577_0021567 3300042876 Bacteria 5893
258 Ga0466972_0000009 3300044658 Bacteria 256374
259 Ga0466972_0003760 3300044658 Bacteria 7550
260 Ga0453683_0000183 3300044673 Bacteria 86894
261 Ga0453683_0000311 3300044673 Bacteria 61262
262 Ga0453683_0001586 3300044673 Bacteria 19209
263 Ga0453683_0002945 3300044673 Bacteria 12814
264 Ga0453683_0010526 3300044673 Bacteria 6125
265 Ga0453683_0010728 3300044673 Bacteria 6066
266 Ga0453683_0085355 3300044673 Bacteria 1978
267 Ga0453684_0000661 3300044712 Bacteria 123767
268 Ga0453684_0001039 3300044712 Bacteria 88840
269 Ga0453684_0001154 3300044712 Bacteria 82455
270 Ga0453684_0001483 3300044712 Bacteria 66171
271 Ga0453684_0003340 3300044712 Bacteria 36413
272 Ga0453684_0006265 3300044712 Bacteria 22778
273 Ga0453684_0006891 3300044712 Bacteria 21318
274 Ga0453684_0010046 3300044712 Bacteria 16283
275 Ga0453684_0014940 3300044712 Bacteria 12342
276 Ga0453684_0018285 3300044712 Bacteria 10771
277 Ga0453684_0039894 3300044712 Bacteria 6386
278 Ga0453684_0052321 3300044712 Bacteria 5342
279 Ga0453684_0084263 3300044712 Bacteria 3954
280 Ga0453684_0168326 3300044712 Bacteria 2585
281 Ga0453684_0236899 3300044712 Bacteria 2104
282 Ga0451576_0000047 3300045051 Bacteria 329357
283 Ga0451576_0000283 3300045051 Bacteria 124222
284 Ga0451576_0001065 3300045051 Bacteria 50428
285 Ga0451576_0001534 3300045051 Bacteria 38886
286 Ga0451576_0001892 3300045051 Bacteria 33597
287 Ga0451576_0011780 3300045051 Bacteria 9903
288 Ga0451576_0043522 3300045051 Bacteria 4737
289 Ga0451576_0065945 3300045051 Bacteria 3769
290 Ga0451576_0211354 3300045051 Bacteria 2026
291 Ga0495627_000003 3300046453 Bacteria 704557
292 Ga0495638_0067323 3300046460 Bacteria 2199
293 Ga0495596_0001180 3300046500 Bacteria 15303
294 Ga0495606_0004470 3300046507 Bacteria 13940
295 Ga0495610_0000001 3300046512 Bacteria 1620061
296 Ga0495610_0000064 3300046512 Bacteria 125922
297 Ga0495610_0005260 3300046512 Bacteria 9261
298 Ga0495616_0018238 3300046513 Bacteria 3856
299 Ga0495618_0032228 3300046514 Unclassified 3282
300 Ga0495628_0025438 3300046516 Bacteria 4836
301 Ga0495630_0015501 3300046517 Bacteria 5566
302 Ga0495632_0021049 3300046519 Bacteria 3520
303 Ga0495643_0000794 3300046522 Bacteria 34957
304 Ga0495643_0010594 3300046522 Bacteria 5664
305 Ga0495663_0000075 3300046525 Bacteria 45194
306 Ga0495663_0001443 3300046525 Bacteria 7507
307 Ga0495654_0000001 3300046530 Bacteria 1513197
308 Ga0495609_0000083 3300046538 Bacteria 115045
309 Ga0495633_0000008 3300046558 Bacteria 301830
310 Ga0495668_0002556 3300046616 Bacteria 14798
311 Ga0495625_0023815 3300046660 Bacteria 4672
312 Ga0495625_0081490 3300046660 Bacteria 2252
313 Ga0495613_0071922 3300046689 Unclassified 2521
314 Ga0495671_0018463 3300046692 Bacteria 3701
315 Ga0495686_0000102 3300047472 Bacteria 177525
316 Ga0495686_0000118 3300047472 Bacteria 165897
317 Ga0495686_0014276 3300047472 Bacteria 5472
318 Ga0496102_0018278 3300048905 Bacteria 6159
319 Ga0496116_0000012 3300048919 Bacteria 611365
320 Ga0496117_0000050 3300048920 Bacteria 292727
321 Ga0496118_0000044 3300048921 Bacteria 283524
322 Ga0496119_0000002 3300048922 Bacteria 738385
323 Ga0496122_0000386 3300048925 Bacteria 93777
324 Ga0496122_0000412 3300048925 Bacteria 90921
325 Ga0496122_0001104 3300048925 Bacteria 46663
326 Ga0496122_0001883 3300048925 Bacteria 31781
327 Ga0496122_0008926 3300048925 Bacteria 10667
328 Ga0496123_0001375 3300048926 Bacteria 34102
329 Ga0496123_0001863 3300048926 Bacteria 27648
330 Ga0496123_0002630 3300048926 Bacteria 21752
331 Ga0496123_0015111 3300048926 Bacteria 6352
332 Ga0496123_0021250 3300048926 Bacteria 5049
333 Ga0496125_0001218 3300048928 Bacteria 38631
334 Ga0496125_0007974 3300048928 Bacteria 11185
335 Ga0496125_0040342 3300048928 Bacteria 4006
336 Ga0496126_0005440 3300048929 Bacteria 14522
337 Ga0501296_001919 3300049519 Bacteria 2126
338 Ga0501032_0032053 3300049569 Bacteria 3602
339 Ga0501043_0143673 3300049579 Bacteria 1868
340 Ga0501047_0077237 3300049581 Bacteria 3204
341 Ga0501047_0090057 3300049581 Bacteria 2945
342 Ga0501243_003311 3300049675 Bacteria 2379
343 Ga0501251_002929 3300049681 Bacteria 1680
344 Ga0501241_000013 3300049758 Bacteria 104728
345 Ga0501269_000311 3300049766 Bacteria 13021
346 Ga0501035_0014771 3300049822 Bacteria 7211
347 Ga0501044_0019470 3300049823 Bacteria 7259
348 Ga0501044_0046532 3300049823 Bacteria 4490
349 nmdc:mga05p37_8508_c1 3300050507 Bacteria 12125
350 Ga0500578_0000280 3300053086 Bacteria 62943
351 Ga0500644_0000217 3300053088 Bacteria 33352
352 Ga0500646_0004764 3300053090 Bacteria 3434
353 Ga0500583_0000035 3300053092 Bacteria 96248
354 Ga0500583_0046658 3300053092 Bacteria 1993
355 Ga0500568_0003469 3300053139 Bacteria 8770
356 Ga0500616_0009404 3300053153 Bacteria 5948
357 Ga0500622_0003534 3300053156 Bacteria 10355
358 Ga0500634_0017200 3300053161 Bacteria 3870
359 Ga0500636_0052941 3300053177 Bacteria 2383
360 2511234399 2511231000 Bacteria 4488346
361 2585142604 2582581278 Bacteria 5296881
362 2585159838 2582581281 Bacteria 4487904
363 2585164034 2582581282 Bacteria 4495830
364 2587678411 2585428045 Bacteria 5203023
365 2587748049 2585428060 Bacteria 5304711
366 2587752602 2585428061 Bacteria 3939663
367 2587866653 2585428095 Bacteria 3789702
368 2587943039 2585428115 Bacteria 4420269
369 2588208511 2585428182 Bacteria 5007281
370 2588212990 2585428183 Bacteria 5166119
371 2588219580 2585428184 Bacteria 4978681
372 2588224109 2585428185 Bacteria 4969476
373 2588233609 2585428187 Bacteria 4629388
374 2588446263 2588253712 Bacteria 5403181
375 2590600557 2588254255 Bacteria 5014294
376 2590611700 2588254257 Bacteria 5436094
377 2729201677 2728369107 Bacteria 5082720
378 2738713827 2738541276 Bacteria 4690596
379 2738725155 2738541278 Bacteria 9755573
380 2738755565 2738541283 Bacteria 7222293
381 2738856051 2738541302 Bacteria 5944758
382 2739588976 2739367651 Bacteria 6359826
383 2740057446 2739367874 Bacteria 4872888
384 2753672866 2751185877 Bacteria 4921427
385 2765572367 2765235839 Bacteria 5314748
386 2772603468 2772190705 Bacteria 4666226
387 2775673040 2775506739 Bacteria 3855222
388 2816872645 2816332188 Bacteria 5133218
389 2819547948 2818991437 Bacteria 5805520
390 2842084039 2842083920 Bacteria 4857652
391 2842726403 2842722452 Bacteria 6263924
392 2842910653 2842909656 Bacteria 6185908
393 2849284585 2849281842 Bacteria 6065644
394 2871721821 2871720351 Bacteria 4862476
395 2881363967 2881359912 Bacteria 4935907
396 2889291998 2889290771 Bacteria 5530962
397 2906000952 2905999023 Bacteria 4591259
398 2919099457 2919097161 Bacteria 3860339
399 2919402744 2919399522 Bacteria 5164947
400 2945927474 2945924605 Bacteria 4296724
401 2946000971 2945997725 Bacteria 6404843
402 2946021238 2946019816 Bacteria 4621265
403 2954018223 2954016120 Bacteria 6446024
404 2977246291 2977243572 Bacteria 4374394
405 2984575794 2984572630 Bacteria 4186940
406 2984609250 2984606641 Bacteria 4186971
407 2993373652 2993372514 Bacteria 4214139
408 2993484330 2993480792 Bacteria 4022225
409 Ga0157378_10089789
410 JGI25154J39366_1000817
411 JGI25157J39369_1000029
412 JGI25152J39213_1000128
413 JGI25150J39212_1000021
414 JGI25151J46595_10000078
415 JGI25153J46596_10000057
416 rootH1_10078411
417 rootH2_10041652
418 rootH2_10051986
419 rootH2_10054626
420 rootH1_10109720
421 rootH1_10110668
422 rootH1_10340325
423 Ga0055535_1005498
424 Ga0055542_1002086
425 Ga0055526_1003574
426 Ga0055536_1000009
427 Ga0055534_1011826
428 Ga0055528_1000694
429 Ga0055530_10001763
430 Ga0055530_10002396
431 Ga0065165_1000017
432 Ga0065714_10064467
433 Ga0065714_10083938
434 Ga0065707_10109826
435 Ga0070676_10023649
436 Ga0070683_100000385
437 Ga0070683_100005596
438 Ga0070683_100054689
439 Ga0070683_100059576
440 Ga0070677_10042078
441 Ga0068869_100003261
442 Ga0068869_100004654
443 Ga0068869_100022690
444 Ga0070666_10056461
445 Ga0070682_100001578
446 Ga0068868_100021099
447 Ga0068868_100034728
448 Ga0068868_100128595
449 Ga0070689_100001880
450 Ga0070689_100004250
451 Ga0070689_100020892
452 Ga0070661_100000521
453 Ga0070661_100008647
454 Ga0070661_100048783
455 Ga0070675_100071963
456 Ga0070671_100004285
457 Ga0070688_100015878
458 Ga0070659_100011491
459 Ga0070709_10000002
460 Ga0070663_100034542
461 Ga0070662_100005116
462 Ga0070662_100017037
463 Ga0070662_100040895
464 Ga0070662_100135170
465 Ga0070681_10020260
466 Ga0070698_100034668
467 Ga0070679_100056276
468 Ga0070684_100009989
469 Ga0068853_100003579
470 Ga0068853_100015944
471 Ga0068853_100111846
472 Ga0070672_100069123
473 Ga0070686_100097647
474 Ga0070695_100087025
475 Ga0070704_100121556
476 Ga0070664_100161713
477 Ga0070664_100211906
478 Ga0068857_100000097
479 Ga0068857_100007787
480 Ga0068857_100016176
481 Ga0068857_100042955
482 Ga0068854_100064645
483 Ga0068854_100120281
484 Ga0068856_100010911
485 Ga0068856_100128478
486 Ga0068852_100072587
487 Ga0068859_100067483
488 Ga0068864_100017282
489 Ga0068864_100037093
490 Ga0068864_100041783
491 Ga0068864_100059799
492 Ga0068866_10043294
493 Ga0068861_100023691
494 Ga0068870_10007053
495 Ga0068863_100126815
496 Ga0068858_100013636
497 Ga0068860_100060071
498 Ga0068860_100275521
499 Ga0081539_10010948
500 Ga0081539_10063336
501 Ga0070716_100094212
502 Ga0097621_100027966
503 Ga0097621_100123789
504 Ga0068871_100004751
505 Ga0068871_100052722
506 Ga0075434_100017821
507 Ga0075434_100190425
508 Ga0097620_100067484
509 Ga0099824_1001461
510 Ga0105244_10000114
511 Ga0105244_10000175
512 Ga0105244_10044681
513 Ga0114129_10128189
514 Ga0105243_10000485
515 Ga0105243_10212497
516 Ga0105237_10000723
517 Ga0105238_10051469
518 Ga0105239_10008004
519 Ga0105239_10054783
520 Ga0105246_10088068
521 Ga0157373_10000036
522 Ga0157370_10000241
523 Ga0157370_10004936
524 Ga0157370_10024727
525 Ga0157370_10052720
526 Ga0157370_10078822
527 Ga0157370_10118746
528 Ga0157369_10001697
529 Ga0157374_10004107
530 Ga0157374_10021600
531 Ga0157374_10108044
532 Ga0157378_10040834
533 Ga0157378_10044033
534 Ga0163162_10001345
535 Ga0163162_10001661
536 Ga0163162_10056079
537 Ga0163162_10065353
538 Ga0163162_10141245
539 Ga0157372_10065658
540 Ga0157375_10005733
541 Ga0157375_10009721
542 Ga0157375_10056849
543 Ga0157375_10203077
544 Ga0163163_10026797
545 Ga0157380_10000613
546 Ga0182008_10000039
547 Ga0182008_10000460
548 Ga0157377_10091790
549 Ga0157376_10107161
550 Ga0182006_1000011
551 Ga0182006_1000178
552 Ga0182006_1001691
553 Ga0183373_1003
554 Ga0163161_10000108
555 Ga0163161_10000955
556 Ga0163161_10002830
557 Ga0213876_10000366
558 Ga0209258_100333
559 Ga0207425_1000004
560 Ga0209646_1000111
561 Ga0209026_1000054
562 Ga0209026_1000549
563 Ga0209026_1002350
564 Ga0209677_100105
565 Ga0209148_1000129
566 Ga0209759_1000043
567 Ga0209129_1000048
568 Ga0209455_1008118
569 Ga0209673_1000083
570 Ga0209675_1000367
571 Ga0209676_1000001
572 Ga0209025_1000009
573 Ga0209564_1004329
574 Ga0209758_1000010
575 Ga0209758_1001318
576 Ga0209050_1000018
577 Ga0209050_1000273
578 Ga0207426_1001089
579 Ga0209257_1000308
580 Ga0207655_1003241
581 Ga0207643_10004031
582 Ga0207707_10038616
583 Ga0207695_10143104
584 Ga0207671_10001233
585 Ga0207657_10087213
586 Ga0207649_10004109
587 Ga0207659_10005427
588 Ga0207706_10030830
589 Ga0207706_10031447
590 Ga0207706_10067305
591 Ga0207686_10121091
592 Ga0207709_10000557
593 Ga0207670_10002959
594 Ga0207670_10004439
595 Ga0207691_10040969
596 Ga0207689_10001853
597 Ga0207689_10013102
598 Ga0207689_10040094
599 Ga0207689_10135752
600 Ga0207661_10002647
601 Ga0207661_10010507
602 Ga0207661_10086751
603 Ga0207661_10139618
604 Ga0207679_10021439
605 Ga0207679_10023164
606 Ga0207679_10064718
607 Ga0207667_10093176
608 Ga0207712_10040251
609 Ga0207712_10115543
610 Ga0207640_10004558
611 Ga0207640_10043984
612 Ga0207677_10080756
613 Ga0207703_10093405
614 Ga0207678_10018265
615 Ga0207702_10000376
616 Ga0207702_10041188
617 Ga0207641_10128449
618 Ga0207648_10116830
619 Ga0207676_10007689
620 Ga0207674_10009743
621 Ga0207674_10014698
622 Ga0207674_10038778
623 Ga0207674_10148780
624 Ga0207683_10001848
625 Ga0265319_1006597
626 Ga0265336_10000006
627 Ga0265336_10018486
628 Ga0307515_10000007
629 Ga0265324_10032195
630 Ga0307511_10001876
631 Ga0265332_10002104
632 Ga0265327_10000127
633 Ga0265327_10015613
634 Ga0265316_10134734
635 Ga0307513_10062773
636 Ga0307408_100000497
637 Ga0307508_10000677
638 Ga0307516_10002738
639 Ga0307405_10000031
640 Ga0307406_10082637
641 Ga0307407_10000036
642 Ga0307407_10030043
643 Ga0307412_10000012
644 Ga0307412_10000353
645 Ga0307412_10018587
646 Ga0307412_10087352
647 Ga0307416_100000007
648 Ga0307416_100000033
649 Ga0307414_10020645
650 Ga0307414_10124633
651 Ga0307507_10000071
652 Ga0373955_0033535
653 Ga0316584_0080369
654 Ga0373925_0106600
655 Ga0395900_0122723
656 Ga0436365_0603740
657 Ga0439465_0001960
658 Ga0439465_0003437
659 Ga0439445_0001428
660 Ga0439449_0014970
661 Ga0451577_0000044
662 Ga0451577_0000943
663 Ga0451577_0003129
664 Ga0451577_0003816
665 Ga0451577_0021567
666 Ga0466972_0000009
667 Ga0466972_0003760
668 Ga0453683_0000183
669 Ga0453683_0000311
670 Ga0453683_0001586
671 Ga0453683_0002945
672 Ga0453683_0010526
673 Ga0453683_0010728
674 Ga0453683_0085355
675 Ga0453684_0000661
676 Ga0453684_0001039
677 Ga0453684_0001154
678 Ga0453684_0001483
679 Ga0453684_0003340
680 Ga0453684_0006265
681 Ga0453684_0006891
682 Ga0453684_0010046
683 Ga0453684_0014940
684 Ga0453684_0018285
685 Ga0453684_0039894
686 Ga0453684_0052321
687 Ga0453684_0084263
688 Ga0453684_0168326
689 Ga0453684_0236899
690 Ga0451576_0000047
691 Ga0451576_0000283
692 Ga0451576_0001065
693 Ga0451576_0001534
694 Ga0451576_0001892
695 Ga0451576_0011780
696 Ga0451576_0043522
697 Ga0451576_0065945
698 Ga0451576_0211354
699 Ga0495627_000003
700 Ga0495638_0067323
701 Ga0495596_0001180
702 Ga0495606_0004470
703 Ga0495610_0000001
704 Ga0495610_0000064
705 Ga0495610_0005260
706 Ga0495616_0018238
707 Ga0495618_0032228
708 Ga0495628_0025438
709 Ga0495630_0015501
710 Ga0495632_0021049
711 Ga0495643_0000794
712 Ga0495643_0010594
713 Ga0495663_0000075
714 Ga0495663_0001443
715 Ga0495654_0000001
716 Ga0495609_0000083
717 Ga0495633_0000008
718 Ga0495668_0002556
719 Ga0495625_0023815
720 Ga0495625_0081490
721 Ga0495613_0071922
722 Ga0495671_0018463
723 Ga0495686_0000102
724 Ga0495686_0000118
725 Ga0495686_0014276
726 Ga0496102_0018278
727 Ga0496116_0000012
728 Ga0496117_0000050
729 Ga0496118_0000044
730 Ga0496119_0000002
731 Ga0496122_0000386
732 Ga0496122_0000412
733 Ga0496122_0001104
734 Ga0496122_0001883
735 Ga0496122_0008926
736 Ga0496123_0001375
737 Ga0496123_0001863
738 Ga0496123_0002630
739 Ga0496123_0015111
740 Ga0496123_0021250
741 Ga0496125_0001218
742 Ga0496125_0007974
743 Ga0496125_0040342
744 Ga0496126_0005440
745 Ga0501296_001919
746 Ga0501032_0032053
747 Ga0501043_0143673
748 Ga0501047_0077237
749 Ga0501047_0090057
750 Ga0501243_003311
751 Ga0501251_002929
752 Ga0501241_000013
753 Ga0501269_000311
754 Ga0501035_0014771
755 Ga0501044_0019470
756 Ga0501044_0046532
757 nmdc:mga05p37_8508_c1
758 Ga0500578_0000280
759 Ga0500644_0000217
760 Ga0500646_0004764
761 Ga0500583_0000035
762 Ga0500583_0046658
763 Ga0500568_0003469
764 Ga0500616_0009404
765 Ga0500622_0003534
766 Ga0500634_0017200
767 Ga0500636_0052941
768 2511234399
769 2585142604
770 2585159838
771 2585164034
772 2587678411
773 2587748049
774 2587752602
775 2587866653
776 2587943039
777 2588208511
778 2588212990
779 2588219580
780 2588224109
781 2588233609
782 2588446263
783 2590600557
784 2590611700
785 2729201677
786 2738713827
787 2738725155
788 2738755565
789 2738856051
790 2739588976
791 2740057446
792 2753672866
793 2765572367
794 2772603468
795 2775673040
796 2816872645
797 2819547948
798 2842084039
799 2842726403
800 2842910653
801 2849284585
802 2871721821
803 2881363967
804 2889291998
805 2906000952
806 2919099457
807 2919402744
808 2945927474
809 2946000971
810 2946021238
811 2954018223
812 2977246291
813 2984575794
814 2984609250
815 2993373652
816 2993484330

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02055

Glyco_hydro_30

Glycosyl hydrolase family 30 TIM-barrel domain

119

457

0.94

PF17189

Glyco_hydro_30C

Glycosyl hydrolase family 30 beta sandwich domain

460

520

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wnw-assembly1.cif.gz_B the crystal structure of srfj from salmonella typhimurium 0.9551 24 474
2wnw-assembly1.cif.gz_B the crystal structure of srfj from salmonella typhimurium 0.9467 24 474
2xwd-assembly1.cif.gz_A x-ray structure of acid-beta-glucosidase with 5n,6o-(n'-(n-octyl)imino)nojirimycin in the active site 0.9437 23 472
6q1p-assembly2.cif.gz_B glucocerebrosidase in complex with pharmacological chaperone norimx8 0.942 23 472
6yv3-assembly1.cif.gz_AAA structure of recombinant human beta-glucocerebrosidase in complex with galacto-configured cyclophellitol aziridine inhibitor 0.9417 23 474
ID Description Score Start End Superfamily
af_Q9VCJ4_494_561_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.9799 408 472 2.60.40.1180
2wnwB01 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.9497 414 474 2.60.40.1180
2wnwB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9455 67 412 3.20.20.80
2wnwB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9428 67 412 3.20.20.80
af_G5ECR8_80_454_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9282 49 411 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A7X7WQD0-F1-model_v4 Glycosyl hydrolase family 30 beta sandwich domain-containing protein 0.9922 381 472 GO:0004348
GO:0006680
GO:0016020
AF-A0A2W6RW51-F1-model_v4 Glycosyl hydrolase 0.991 381 472 GO:0004348
GO:0006680
GO:0016020
AF-A0A3C0HBR0-F1-model_v4 Glycosyl hydrolase family 30 beta sandwich domain-containing protein 0.9895 383 474 GO:0004348
GO:0006680
GO:0016020
AF-A0A7W4NNX6-F1-model_v4 deleted 0.9867 51 474
AF-A0A3C1YS78-F1-model_v4 Glycosyl hydrolase 0.9853 25 472 GO:0004348
GO:0006680
GO:0016020

Map