F436720
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 408 | 264 | 816 | 483 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10089789|Ga0157378_100897892 |
| Length | 523 |
| Sequence | VKLSQFHLTFRVSRFTTILLKIISSVYLKNPFAMHKLTYLACLFLLAACSKNKVANETRTTTTDTSFSIDGKKVVVYTTADSTQLRLSATDTLSFADFDQPLETQASIFIDPSHTFQTFLGIGGALTDASAETFAKLPADKQKEVLQAYYDKDKGIGYTIGRTNINSCDFSSDTYTYVTDGDKELKSFNLAHDQKFKIPLIKKAMEAAGGKINLFVSPWSPPAWMKDNNDMLHGGKLKPEFYESWANYYVKFIQGYEKEGIPVWGLTVQNEPMAKQTWESCMYTAEDEKNFIKNSLGPTLQKNNLSDKKLIGWDHNRDLLYQRASSLLNDPDAAKYLWGIGFHWYEEWNGGRQYSNVELVHETFPDKNLMFTEGCNFPFSWQTFDNWKWGENYGENMIHDFNNGAVAWTDWNILLDETGGPNHVGNFCFAPIHAKTKEGTLHYMNSYYYIGHLSKFIRPGAKRIISSANRVQLLTTAFKNPDGKLSVVIMNPTGQKFSYRMYIGKKAVEATSLPHSISTLVVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 3 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 4 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 66 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 89 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 92 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 93 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 96 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 136 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 138 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 139 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 140 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 142 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 143 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 144 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 145 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 146 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 147 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 149 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 150 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 151 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 152 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 153 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 154 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 155 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 156 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 158 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 159 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 160 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 161 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 162 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 163 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 164 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 165 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 166 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 167 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 188 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 189 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 190 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 191 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 192 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 193 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 194 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 195 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 196 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 197 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 201 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 202 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 203 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 204 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 208 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 209 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 210 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 211 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 212 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 213 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 214 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 215 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 216 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 217 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 218 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 219 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 220 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 221 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 222 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 223 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 224 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 225 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 226 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 227 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 228 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 229 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 230 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 231 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 232 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 233 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 234 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 235 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 236 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 237 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 238 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 239 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 240 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 241 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 242 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 243 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 244 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 245 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 246 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 247 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 248 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 249 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 250 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 251 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 252 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 253 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 254 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 255 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 256 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 257 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 258 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 259 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 260 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 261 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 262 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 263 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 264 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.99 |
| Metatranscriptomes | 0 |
| Isolates | 12.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.49 |
| Bulb | 0 |
| Endosphere | 9.8 |
| Nodule | 0.49 |
| Rhizoplane | 0.25 |
| Rhizosphere | 75.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157378_10089789 | 3300013297 | Bacteria | 2792 |
| 2 | JGI25154J39366_1000817 | 3300002738 | Bacteria | 13585 |
| 3 | JGI25157J39369_1000029 | 3300002741 | Bacteria | 146928 |
| 4 | JGI25152J39213_1000128 | 3300002773 | Bacteria | 51965 |
| 5 | JGI25150J39212_1000021 | 3300002774 | Bacteria | 133190 |
| 6 | JGI25151J46595_10000078 | 3300003187 | Bacteria | 133190 |
| 7 | JGI25153J46596_10000057 | 3300003215 | Bacteria | 133190 |
| 8 | rootH1_10078411 | 3300003316 | Bacteria | 3560 |
| 9 | rootH2_10041652 | 3300003320 | Bacteria | 8568 |
| 10 | rootH2_10051986 | 3300003320 | Bacteria | 10715 |
| 11 | rootH2_10054626 | 3300003320 | Bacteria | 4175 |
| 12 | rootH1_10109720 | 3300003323 | Bacteria | 3443 |
| 13 | rootH1_10110668 | 3300003323 | Bacteria | 14790 |
| 14 | rootH1_10340325 | 3300003323 | Unclassified | 2464 |
| 15 | Ga0055535_1005498 | 3300003761 | Bacteria | 2759 |
| 16 | Ga0055542_1002086 | 3300003762 | Bacteria | 7444 |
| 17 | Ga0055526_1003574 | 3300003771 | Bacteria | 9781 |
| 18 | Ga0055536_1000009 | 3300003781 | Bacteria | 311572 |
| 19 | Ga0055534_1011826 | 3300003784 | Bacteria | 1756 |
| 20 | Ga0055528_1000694 | 3300003790 | Bacteria | 23961 |
| 21 | Ga0055530_10001763 | 3300003791 | Bacteria | 15122 |
| 22 | Ga0055530_10002396 | 3300003791 | Bacteria | 12131 |
| 23 | Ga0065165_1000017 | 3300005262 | Bacteria | 278286 |
| 24 | Ga0065714_10064467 | 3300005288 | Bacteria | 63317 |
| 25 | Ga0065714_10083938 | 3300005288 | Bacteria | 2224 |
| 26 | Ga0065707_10109826 | 3300005295 | Bacteria | 2454 |
| 27 | Ga0070676_10023649 | 3300005328 | Bacteria | 3455 |
| 28 | Ga0070683_100000385 | 3300005329 | Bacteria | 30659 |
| 29 | Ga0070683_100005596 | 3300005329 | Bacteria | 10494 |
| 30 | Ga0070683_100054689 | 3300005329 | Bacteria | 3702 |
| 31 | Ga0070683_100059576 | 3300005329 | Bacteria | 3547 |
| 32 | Ga0070677_10042078 | 3300005333 | Bacteria | 1807 |
| 33 | Ga0068869_100003261 | 3300005334 | Bacteria | 9915 |
| 34 | Ga0068869_100004654 | 3300005334 | Bacteria | 8559 |
| 35 | Ga0068869_100022690 | 3300005334 | Bacteria | 4328 |
| 36 | Ga0070666_10056461 | 3300005335 | Bacteria | 2651 |
| 37 | Ga0070682_100001578 | 3300005337 | Bacteria | 12715 |
| 38 | Ga0068868_100021099 | 3300005338 | Bacteria | 4904 |
| 39 | Ga0068868_100034728 | 3300005338 | Bacteria | 3894 |
| 40 | Ga0068868_100128595 | 3300005338 | Bacteria | 2071 |
| 41 | Ga0070689_100001880 | 3300005340 | Bacteria | 13550 |
| 42 | Ga0070689_100004250 | 3300005340 | Bacteria | 9651 |
| 43 | Ga0070689_100020892 | 3300005340 | Bacteria | 4866 |
| 44 | Ga0070661_100000521 | 3300005344 | Bacteria | 29488 |
| 45 | Ga0070661_100008647 | 3300005344 | Bacteria | 7043 |
| 46 | Ga0070661_100048783 | 3300005344 | Bacteria | 3100 |
| 47 | Ga0070675_100071963 | 3300005354 | Bacteria | 2870 |
| 48 | Ga0070671_100004285 | 3300005355 | Bacteria | 11287 |
| 49 | Ga0070688_100015878 | 3300005365 | Bacteria | 4293 |
| 50 | Ga0070659_100011491 | 3300005366 | Bacteria | 6549 |
| 51 | Ga0070709_10000002 | 3300005434 | Bacteria | 322903 |
| 52 | Ga0070663_100034542 | 3300005455 | Bacteria | 3502 |
| 53 | Ga0070662_100005116 | 3300005457 | Bacteria | 8360 |
| 54 | Ga0070662_100017037 | 3300005457 | Bacteria | 4889 |
| 55 | Ga0070662_100040895 | 3300005457 | Bacteria | 3303 |
| 56 | Ga0070662_100135170 | 3300005457 | Bacteria | 1905 |
| 57 | Ga0070681_10020260 | 3300005458 | Bacteria | 6667 |
| 58 | Ga0070698_100034668 | 3300005471 | Bacteria | 5223 |
| 59 | Ga0070679_100056276 | 3300005530 | Bacteria | 3919 |
| 60 | Ga0070684_100009989 | 3300005535 | Bacteria | 7504 |
| 61 | Ga0068853_100003579 | 3300005539 | Bacteria | 11897 |
| 62 | Ga0068853_100015944 | 3300005539 | Bacteria | 6177 |
| 63 | Ga0068853_100111846 | 3300005539 | Bacteria | 2427 |
| 64 | Ga0070672_100069123 | 3300005543 | Bacteria | 2803 |
| 65 | Ga0070686_100097647 | 3300005544 | Bacteria | 1978 |
| 66 | Ga0070695_100087025 | 3300005545 | Bacteria | 2078 |
| 67 | Ga0070704_100121556 | 3300005549 | Bacteria | 2007 |
| 68 | Ga0070664_100161713 | 3300005564 | Unclassified | 1981 |
| 69 | Ga0070664_100211906 | 3300005564 | Bacteria | 1732 |
| 70 | Ga0068857_100000097 | 3300005577 | Bacteria | 51356 |
| 71 | Ga0068857_100007787 | 3300005577 | Bacteria | 9233 |
| 72 | Ga0068857_100016176 | 3300005577 | Bacteria | 6532 |
| 73 | Ga0068857_100042955 | 3300005577 | Bacteria | 4010 |
| 74 | Ga0068854_100064645 | 3300005578 | Bacteria | 2658 |
| 75 | Ga0068854_100120281 | 3300005578 | Bacteria | 1993 |
| 76 | Ga0068856_100010911 | 3300005614 | Bacteria | 8818 |
| 77 | Ga0068856_100128478 | 3300005614 | Bacteria | 2538 |
| 78 | Ga0068852_100072587 | 3300005616 | Bacteria | 3025 |
| 79 | Ga0068859_100067483 | 3300005617 | Bacteria | 3611 |
| 80 | Ga0068864_100017282 | 3300005618 | Bacteria | 6012 |
| 81 | Ga0068864_100037093 | 3300005618 | Bacteria | 4158 |
| 82 | Ga0068864_100041783 | 3300005618 | Unclassified | 3921 |
| 83 | Ga0068864_100059799 | 3300005618 | Bacteria | 3298 |
| 84 | Ga0068866_10043294 | 3300005718 | Bacteria | 2246 |
| 85 | Ga0068861_100023691 | 3300005719 | Bacteria | 4431 |
| 86 | Ga0068870_10007053 | 3300005840 | Bacteria | 4990 |
| 87 | Ga0068863_100126815 | 3300005841 | Bacteria | 2435 |
| 88 | Ga0068858_100013636 | 3300005842 | Bacteria | 7671 |
| 89 | Ga0068860_100060071 | 3300005843 | Bacteria | 3614 |
| 90 | Ga0068860_100275521 | 3300005843 | Bacteria | 1643 |
| 91 | Ga0081539_10010948 | 3300005985 | Bacteria | 7274 |
| 92 | Ga0081539_10063336 | 3300005985 | Bacteria | 2018 |
| 93 | Ga0070716_100094212 | 3300006173 | Bacteria | 1820 |
| 94 | Ga0097621_100027966 | 3300006237 | Bacteria | 4439 |
| 95 | Ga0097621_100123789 | 3300006237 | Bacteria | 2195 |
| 96 | Ga0068871_100004751 | 3300006358 | Bacteria | 9495 |
| 97 | Ga0068871_100052722 | 3300006358 | Bacteria | 3295 |
| 98 | Ga0075434_100017821 | 3300006871 | Bacteria | 6850 |
| 99 | Ga0075434_100190425 | 3300006871 | Bacteria | 2071 |
| 100 | Ga0097620_100067484 | 3300006931 | Bacteria | 3611 |
| 101 | Ga0099824_1001461 | 3300006942 | Bacteria | 33284 |
| 102 | Ga0105244_10000114 | 3300009036 | Bacteria | 84368 |
| 103 | Ga0105244_10000175 | 3300009036 | Bacteria | 65097 |
| 104 | Ga0105244_10044681 | 3300009036 | Bacteria | 2281 |
| 105 | Ga0114129_10128189 | 3300009147 | Bacteria | 3487 |
| 106 | Ga0105243_10000485 | 3300009148 | Bacteria | 40540 |
| 107 | Ga0105243_10212497 | 3300009148 | Bacteria | 1704 |
| 108 | Ga0105237_10000723 | 3300009545 | Bacteria | 45657 |
| 109 | Ga0105238_10051469 | 3300009551 | Bacteria | 4143 |
| 110 | Ga0105239_10008004 | 3300010375 | Bacteria | 12064 |
| 111 | Ga0105239_10054783 | 3300010375 | Bacteria | 4375 |
| 112 | Ga0105246_10088068 | 3300011119 | Bacteria | 2230 |
| 113 | Ga0157373_10000036 | 3300013100 | Bacteria | 122723 |
| 114 | Ga0157370_10000241 | 3300013104 | Bacteria | 69817 |
| 115 | Ga0157370_10004936 | 3300013104 | Bacteria | 15098 |
| 116 | Ga0157370_10024727 | 3300013104 | Bacteria | 5947 |
| 117 | Ga0157370_10052720 | 3300013104 | Bacteria | 3883 |
| 118 | Ga0157370_10078822 | 3300013104 | Bacteria | 3102 |
| 119 | Ga0157370_10118746 | 3300013104 | Bacteria | 2470 |
| 120 | Ga0157369_10001697 | 3300013105 | Bacteria | 26845 |
| 121 | Ga0157374_10004107 | 3300013296 | Bacteria | 12225 |
| 122 | Ga0157374_10021600 | 3300013296 | Bacteria | 5730 |
| 123 | Ga0157374_10108044 | 3300013296 | Unclassified | 2674 |
| 124 | Ga0157378_10040834 | 3300013297 | Bacteria | 4115 |
| 125 | Ga0157378_10044033 | 3300013297 | Bacteria | 3962 |
| 126 | Ga0163162_10001345 | 3300013306 | Bacteria | 22882 |
| 127 | Ga0163162_10001661 | 3300013306 | Bacteria | 20854 |
| 128 | Ga0163162_10056079 | 3300013306 | Bacteria | 3969 |
| 129 | Ga0163162_10065353 | 3300013306 | Bacteria | 3684 |
| 130 | Ga0163162_10141245 | 3300013306 | Bacteria | 2522 |
| 131 | Ga0157372_10065658 | 3300013307 | Bacteria | 4075 |
| 132 | Ga0157375_10005733 | 3300013308 | Bacteria | 10806 |
| 133 | Ga0157375_10009721 | 3300013308 | Bacteria | 8454 |
| 134 | Ga0157375_10056849 | 3300013308 | Bacteria | 3865 |
| 135 | Ga0157375_10203077 | 3300013308 | Bacteria | 2138 |
| 136 | Ga0163163_10026797 | 3300014325 | Bacteria | 5513 |
| 137 | Ga0157380_10000613 | 3300014326 | Bacteria | 21981 |
| 138 | Ga0182008_10000039 | 3300014497 | Bacteria | 124930 |
| 139 | Ga0182008_10000460 | 3300014497 | Bacteria | 31080 |
| 140 | Ga0157377_10091790 | 3300014745 | Bacteria | 1794 |
| 141 | Ga0157376_10107161 | 3300014969 | Bacteria | 2453 |
| 142 | Ga0182006_1000011 | 3300015261 | Bacteria | 408647 |
| 143 | Ga0182006_1000178 | 3300015261 | Bacteria | 66897 |
| 144 | Ga0182006_1001691 | 3300015261 | Bacteria | 12905 |
| 145 | Ga0183373_1003 | 3300015682 | Bacteria | 558813 |
| 146 | Ga0163161_10000108 | 3300017792 | Bacteria | 78805 |
| 147 | Ga0163161_10000955 | 3300017792 | Bacteria | 22177 |
| 148 | Ga0163161_10002830 | 3300017792 | Bacteria | 12308 |
| 149 | Ga0213876_10000366 | 3300021384 | Bacteria | 38521 |
| 150 | Ga0209258_100333 | 3300025242 | Bacteria | 70926 |
| 151 | Ga0207425_1000004 | 3300025245 | Bacteria | 1092421 |
| 152 | Ga0209646_1000111 | 3300025246 | Bacteria | 155786 |
| 153 | Ga0209026_1000054 | 3300025250 | Bacteria | 242508 |
| 154 | Ga0209026_1000549 | 3300025250 | Bacteria | 25871 |
| 155 | Ga0209026_1002350 | 3300025250 | Bacteria | 7158 |
| 156 | Ga0209677_100105 | 3300025253 | Bacteria | 89277 |
| 157 | Ga0209148_1000129 | 3300025254 | Bacteria | 175720 |
| 158 | Ga0209759_1000043 | 3300025256 | Bacteria | 242513 |
| 159 | Ga0209129_1000048 | 3300025258 | Bacteria | 270192 |
| 160 | Ga0209455_1008118 | 3300025272 | Bacteria | 2886 |
| 161 | Ga0209673_1000083 | 3300025273 | Bacteria | 216509 |
| 162 | Ga0209675_1000367 | 3300025291 | Bacteria | 38392 |
| 163 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 164 | Ga0209025_1000009 | 3300025294 | Bacteria | 1092561 |
| 165 | Ga0209564_1004329 | 3300025295 | Bacteria | 8760 |
| 166 | Ga0209758_1000010 | 3300025297 | Bacteria | 1092782 |
| 167 | Ga0209758_1001318 | 3300025297 | Bacteria | 30178 |
| 168 | Ga0209050_1000018 | 3300025298 | Bacteria | 723263 |
| 169 | Ga0209050_1000273 | 3300025298 | Bacteria | 110451 |
| 170 | Ga0207426_1001089 | 3300025302 | Bacteria | 25231 |
| 171 | Ga0209257_1000308 | 3300025304 | Bacteria | 105012 |
| 172 | Ga0207655_1003241 | 3300025728 | Bacteria | 12217 |
| 173 | Ga0207643_10004031 | 3300025908 | Bacteria | 7904 |
| 174 | Ga0207707_10038616 | 3300025912 | Unclassified | 4172 |
| 175 | Ga0207695_10143104 | 3300025913 | Bacteria | 2338 |
| 176 | Ga0207671_10001233 | 3300025914 | Bacteria | 30228 |
| 177 | Ga0207657_10087213 | 3300025919 | Bacteria | 2611 |
| 178 | Ga0207649_10004109 | 3300025920 | Bacteria | 7920 |
| 179 | Ga0207659_10005427 | 3300025926 | Bacteria | 7726 |
| 180 | Ga0207706_10030830 | 3300025933 | Bacteria | 4781 |
| 181 | Ga0207706_10031447 | 3300025933 | Bacteria | 4728 |
| 182 | Ga0207706_10067305 | 3300025933 | Bacteria | 3151 |
| 183 | Ga0207686_10121091 | 3300025934 | Bacteria | 1781 |
| 184 | Ga0207709_10000557 | 3300025935 | Bacteria | 31848 |
| 185 | Ga0207670_10002959 | 3300025936 | Bacteria | 8969 |
| 186 | Ga0207670_10004439 | 3300025936 | Bacteria | 7556 |
| 187 | Ga0207691_10040969 | 3300025940 | Bacteria | 4279 |
| 188 | Ga0207689_10001853 | 3300025942 | Bacteria | 20012 |
| 189 | Ga0207689_10013102 | 3300025942 | Bacteria | 7079 |
| 190 | Ga0207689_10040094 | 3300025942 | Bacteria | 3877 |
| 191 | Ga0207689_10135752 | 3300025942 | Bacteria | 2026 |
| 192 | Ga0207661_10002647 | 3300025944 | Bacteria | 12320 |
| 193 | Ga0207661_10010507 | 3300025944 | Bacteria | 6666 |
| 194 | Ga0207661_10086751 | 3300025944 | Bacteria | 2598 |
| 195 | Ga0207661_10139618 | 3300025944 | Bacteria | 2084 |
| 196 | Ga0207679_10021439 | 3300025945 | Bacteria | 4381 |
| 197 | Ga0207679_10023164 | 3300025945 | Bacteria | 4241 |
| 198 | Ga0207679_10064718 | 3300025945 | Bacteria | 2734 |
| 199 | Ga0207667_10093176 | 3300025949 | Bacteria | 3111 |
| 200 | Ga0207712_10040251 | 3300025961 | Bacteria | 3206 |
| 201 | Ga0207712_10115543 | 3300025961 | Bacteria | 2020 |
| 202 | Ga0207640_10004558 | 3300025981 | Bacteria | 7522 |
| 203 | Ga0207640_10043984 | 3300025981 | Bacteria | 2858 |
| 204 | Ga0207677_10080756 | 3300026023 | Bacteria | 2331 |
| 205 | Ga0207703_10093405 | 3300026035 | Bacteria | 2534 |
| 206 | Ga0207678_10018265 | 3300026067 | Bacteria | 6158 |
| 207 | Ga0207702_10000376 | 3300026078 | Bacteria | 50989 |
| 208 | Ga0207702_10041188 | 3300026078 | Bacteria | 3873 |
| 209 | Ga0207641_10128449 | 3300026088 | Bacteria | 2272 |
| 210 | Ga0207648_10116830 | 3300026089 | Bacteria | 2344 |
| 211 | Ga0207676_10007689 | 3300026095 | Bacteria | 7657 |
| 212 | Ga0207674_10009743 | 3300026116 | Bacteria | 10944 |
| 213 | Ga0207674_10014698 | 3300026116 | Bacteria | 8632 |
| 214 | Ga0207674_10038778 | 3300026116 | Bacteria | 4942 |
| 215 | Ga0207674_10148780 | 3300026116 | Bacteria | 2299 |
| 216 | Ga0207683_10001848 | 3300026121 | Bacteria | 18723 |
| 217 | Ga0265319_1006597 | 3300028563 | Bacteria | 5355 |
| 218 | Ga0265336_10000006 | 3300028666 | Bacteria | 348453 |
| 219 | Ga0265336_10018486 | 3300028666 | Bacteria | 2258 |
| 220 | Ga0307515_10000007 | 3300028794 | Bacteria | 719669 |
| 221 | Ga0265324_10032195 | 3300029957 | Bacteria | 1833 |
| 222 | Ga0307511_10001876 | 3300030521 | Bacteria | 22065 |
| 223 | Ga0265332_10002104 | 3300031238 | Bacteria | 10309 |
| 224 | Ga0265327_10000127 | 3300031251 | Bacteria | 166247 |
| 225 | Ga0265327_10015613 | 3300031251 | Bacteria | 4887 |
| 226 | Ga0265316_10134734 | 3300031344 | Bacteria | 1859 |
| 227 | Ga0307513_10062773 | 3300031456 | Bacteria | 3925 |
| 228 | Ga0307408_100000497 | 3300031548 | Bacteria | 34174 |
| 229 | Ga0307508_10000677 | 3300031616 | Bacteria | 40943 |
| 230 | Ga0307516_10002738 | 3300031730 | Bacteria | 23246 |
| 231 | Ga0307405_10000031 | 3300031731 | Bacteria | 99176 |
| 232 | Ga0307406_10082637 | 3300031901 | Bacteria | 2140 |
| 233 | Ga0307407_10000036 | 3300031903 | Bacteria | 76457 |
| 234 | Ga0307407_10030043 | 3300031903 | Bacteria | 2927 |
| 235 | Ga0307412_10000012 | 3300031911 | Bacteria | 404180 |
| 236 | Ga0307412_10000353 | 3300031911 | Bacteria | 28551 |
| 237 | Ga0307412_10018587 | 3300031911 | Bacteria | 4187 |
| 238 | Ga0307412_10087352 | 3300031911 | Bacteria | 2172 |
| 239 | Ga0307416_100000007 | 3300032002 | Bacteria | 433284 |
| 240 | Ga0307416_100000033 | 3300032002 | Bacteria | 156736 |
| 241 | Ga0307414_10020645 | 3300032004 | Bacteria | 4110 |
| 242 | Ga0307414_10124633 | 3300032004 | Bacteria | 1988 |
| 243 | Ga0307507_10000071 | 3300033179 | Bacteria | 158391 |
| 244 | Ga0373955_0033535 | 3300035172 | Unclassified | 2705 |
| 245 | Ga0316584_0080369 | 3300036712 | Bacteria | 2442 |
| 246 | Ga0373925_0106600 | 3300037068 | Bacteria | 2161 |
| 247 | Ga0395900_0122723 | 3300037418 | Bacteria | 2665 |
| 248 | Ga0436365_0603740 | 3300039437 | Bacteria | 61917 |
| 249 | Ga0439465_0001960 | 3300041413 | Bacteria | 6750 |
| 250 | Ga0439465_0003437 | 3300041413 | Bacteria | 5166 |
| 251 | Ga0439445_0001428 | 3300042004 | Bacteria | 5187 |
| 252 | Ga0439449_0014970 | 3300042007 | Bacteria | 2914 |
| 253 | Ga0451577_0000044 | 3300042876 | Bacteria | 329357 |
| 254 | Ga0451577_0000943 | 3300042876 | Bacteria | 42647 |
| 255 | Ga0451577_0003129 | 3300042876 | Bacteria | 18667 |
| 256 | Ga0451577_0003816 | 3300042876 | Bacteria | 16402 |
| 257 | Ga0451577_0021567 | 3300042876 | Bacteria | 5893 |
| 258 | Ga0466972_0000009 | 3300044658 | Bacteria | 256374 |
| 259 | Ga0466972_0003760 | 3300044658 | Bacteria | 7550 |
| 260 | Ga0453683_0000183 | 3300044673 | Bacteria | 86894 |
| 261 | Ga0453683_0000311 | 3300044673 | Bacteria | 61262 |
| 262 | Ga0453683_0001586 | 3300044673 | Bacteria | 19209 |
| 263 | Ga0453683_0002945 | 3300044673 | Bacteria | 12814 |
| 264 | Ga0453683_0010526 | 3300044673 | Bacteria | 6125 |
| 265 | Ga0453683_0010728 | 3300044673 | Bacteria | 6066 |
| 266 | Ga0453683_0085355 | 3300044673 | Bacteria | 1978 |
| 267 | Ga0453684_0000661 | 3300044712 | Bacteria | 123767 |
| 268 | Ga0453684_0001039 | 3300044712 | Bacteria | 88840 |
| 269 | Ga0453684_0001154 | 3300044712 | Bacteria | 82455 |
| 270 | Ga0453684_0001483 | 3300044712 | Bacteria | 66171 |
| 271 | Ga0453684_0003340 | 3300044712 | Bacteria | 36413 |
| 272 | Ga0453684_0006265 | 3300044712 | Bacteria | 22778 |
| 273 | Ga0453684_0006891 | 3300044712 | Bacteria | 21318 |
| 274 | Ga0453684_0010046 | 3300044712 | Bacteria | 16283 |
| 275 | Ga0453684_0014940 | 3300044712 | Bacteria | 12342 |
| 276 | Ga0453684_0018285 | 3300044712 | Bacteria | 10771 |
| 277 | Ga0453684_0039894 | 3300044712 | Bacteria | 6386 |
| 278 | Ga0453684_0052321 | 3300044712 | Bacteria | 5342 |
| 279 | Ga0453684_0084263 | 3300044712 | Bacteria | 3954 |
| 280 | Ga0453684_0168326 | 3300044712 | Bacteria | 2585 |
| 281 | Ga0453684_0236899 | 3300044712 | Bacteria | 2104 |
| 282 | Ga0451576_0000047 | 3300045051 | Bacteria | 329357 |
| 283 | Ga0451576_0000283 | 3300045051 | Bacteria | 124222 |
| 284 | Ga0451576_0001065 | 3300045051 | Bacteria | 50428 |
| 285 | Ga0451576_0001534 | 3300045051 | Bacteria | 38886 |
| 286 | Ga0451576_0001892 | 3300045051 | Bacteria | 33597 |
| 287 | Ga0451576_0011780 | 3300045051 | Bacteria | 9903 |
| 288 | Ga0451576_0043522 | 3300045051 | Bacteria | 4737 |
| 289 | Ga0451576_0065945 | 3300045051 | Bacteria | 3769 |
| 290 | Ga0451576_0211354 | 3300045051 | Bacteria | 2026 |
| 291 | Ga0495627_000003 | 3300046453 | Bacteria | 704557 |
| 292 | Ga0495638_0067323 | 3300046460 | Bacteria | 2199 |
| 293 | Ga0495596_0001180 | 3300046500 | Bacteria | 15303 |
| 294 | Ga0495606_0004470 | 3300046507 | Bacteria | 13940 |
| 295 | Ga0495610_0000001 | 3300046512 | Bacteria | 1620061 |
| 296 | Ga0495610_0000064 | 3300046512 | Bacteria | 125922 |
| 297 | Ga0495610_0005260 | 3300046512 | Bacteria | 9261 |
| 298 | Ga0495616_0018238 | 3300046513 | Bacteria | 3856 |
| 299 | Ga0495618_0032228 | 3300046514 | Unclassified | 3282 |
| 300 | Ga0495628_0025438 | 3300046516 | Bacteria | 4836 |
| 301 | Ga0495630_0015501 | 3300046517 | Bacteria | 5566 |
| 302 | Ga0495632_0021049 | 3300046519 | Bacteria | 3520 |
| 303 | Ga0495643_0000794 | 3300046522 | Bacteria | 34957 |
| 304 | Ga0495643_0010594 | 3300046522 | Bacteria | 5664 |
| 305 | Ga0495663_0000075 | 3300046525 | Bacteria | 45194 |
| 306 | Ga0495663_0001443 | 3300046525 | Bacteria | 7507 |
| 307 | Ga0495654_0000001 | 3300046530 | Bacteria | 1513197 |
| 308 | Ga0495609_0000083 | 3300046538 | Bacteria | 115045 |
| 309 | Ga0495633_0000008 | 3300046558 | Bacteria | 301830 |
| 310 | Ga0495668_0002556 | 3300046616 | Bacteria | 14798 |
| 311 | Ga0495625_0023815 | 3300046660 | Bacteria | 4672 |
| 312 | Ga0495625_0081490 | 3300046660 | Bacteria | 2252 |
| 313 | Ga0495613_0071922 | 3300046689 | Unclassified | 2521 |
| 314 | Ga0495671_0018463 | 3300046692 | Bacteria | 3701 |
| 315 | Ga0495686_0000102 | 3300047472 | Bacteria | 177525 |
| 316 | Ga0495686_0000118 | 3300047472 | Bacteria | 165897 |
| 317 | Ga0495686_0014276 | 3300047472 | Bacteria | 5472 |
| 318 | Ga0496102_0018278 | 3300048905 | Bacteria | 6159 |
| 319 | Ga0496116_0000012 | 3300048919 | Bacteria | 611365 |
| 320 | Ga0496117_0000050 | 3300048920 | Bacteria | 292727 |
| 321 | Ga0496118_0000044 | 3300048921 | Bacteria | 283524 |
| 322 | Ga0496119_0000002 | 3300048922 | Bacteria | 738385 |
| 323 | Ga0496122_0000386 | 3300048925 | Bacteria | 93777 |
| 324 | Ga0496122_0000412 | 3300048925 | Bacteria | 90921 |
| 325 | Ga0496122_0001104 | 3300048925 | Bacteria | 46663 |
| 326 | Ga0496122_0001883 | 3300048925 | Bacteria | 31781 |
| 327 | Ga0496122_0008926 | 3300048925 | Bacteria | 10667 |
| 328 | Ga0496123_0001375 | 3300048926 | Bacteria | 34102 |
| 329 | Ga0496123_0001863 | 3300048926 | Bacteria | 27648 |
| 330 | Ga0496123_0002630 | 3300048926 | Bacteria | 21752 |
| 331 | Ga0496123_0015111 | 3300048926 | Bacteria | 6352 |
| 332 | Ga0496123_0021250 | 3300048926 | Bacteria | 5049 |
| 333 | Ga0496125_0001218 | 3300048928 | Bacteria | 38631 |
| 334 | Ga0496125_0007974 | 3300048928 | Bacteria | 11185 |
| 335 | Ga0496125_0040342 | 3300048928 | Bacteria | 4006 |
| 336 | Ga0496126_0005440 | 3300048929 | Bacteria | 14522 |
| 337 | Ga0501296_001919 | 3300049519 | Bacteria | 2126 |
| 338 | Ga0501032_0032053 | 3300049569 | Bacteria | 3602 |
| 339 | Ga0501043_0143673 | 3300049579 | Bacteria | 1868 |
| 340 | Ga0501047_0077237 | 3300049581 | Bacteria | 3204 |
| 341 | Ga0501047_0090057 | 3300049581 | Bacteria | 2945 |
| 342 | Ga0501243_003311 | 3300049675 | Bacteria | 2379 |
| 343 | Ga0501251_002929 | 3300049681 | Bacteria | 1680 |
| 344 | Ga0501241_000013 | 3300049758 | Bacteria | 104728 |
| 345 | Ga0501269_000311 | 3300049766 | Bacteria | 13021 |
| 346 | Ga0501035_0014771 | 3300049822 | Bacteria | 7211 |
| 347 | Ga0501044_0019470 | 3300049823 | Bacteria | 7259 |
| 348 | Ga0501044_0046532 | 3300049823 | Bacteria | 4490 |
| 349 | nmdc:mga05p37_8508_c1 | 3300050507 | Bacteria | 12125 |
| 350 | Ga0500578_0000280 | 3300053086 | Bacteria | 62943 |
| 351 | Ga0500644_0000217 | 3300053088 | Bacteria | 33352 |
| 352 | Ga0500646_0004764 | 3300053090 | Bacteria | 3434 |
| 353 | Ga0500583_0000035 | 3300053092 | Bacteria | 96248 |
| 354 | Ga0500583_0046658 | 3300053092 | Bacteria | 1993 |
| 355 | Ga0500568_0003469 | 3300053139 | Bacteria | 8770 |
| 356 | Ga0500616_0009404 | 3300053153 | Bacteria | 5948 |
| 357 | Ga0500622_0003534 | 3300053156 | Bacteria | 10355 |
| 358 | Ga0500634_0017200 | 3300053161 | Bacteria | 3870 |
| 359 | Ga0500636_0052941 | 3300053177 | Bacteria | 2383 |
| 360 | 2511234399 | 2511231000 | Bacteria | 4488346 |
| 361 | 2585142604 | 2582581278 | Bacteria | 5296881 |
| 362 | 2585159838 | 2582581281 | Bacteria | 4487904 |
| 363 | 2585164034 | 2582581282 | Bacteria | 4495830 |
| 364 | 2587678411 | 2585428045 | Bacteria | 5203023 |
| 365 | 2587748049 | 2585428060 | Bacteria | 5304711 |
| 366 | 2587752602 | 2585428061 | Bacteria | 3939663 |
| 367 | 2587866653 | 2585428095 | Bacteria | 3789702 |
| 368 | 2587943039 | 2585428115 | Bacteria | 4420269 |
| 369 | 2588208511 | 2585428182 | Bacteria | 5007281 |
| 370 | 2588212990 | 2585428183 | Bacteria | 5166119 |
| 371 | 2588219580 | 2585428184 | Bacteria | 4978681 |
| 372 | 2588224109 | 2585428185 | Bacteria | 4969476 |
| 373 | 2588233609 | 2585428187 | Bacteria | 4629388 |
| 374 | 2588446263 | 2588253712 | Bacteria | 5403181 |
| 375 | 2590600557 | 2588254255 | Bacteria | 5014294 |
| 376 | 2590611700 | 2588254257 | Bacteria | 5436094 |
| 377 | 2729201677 | 2728369107 | Bacteria | 5082720 |
| 378 | 2738713827 | 2738541276 | Bacteria | 4690596 |
| 379 | 2738725155 | 2738541278 | Bacteria | 9755573 |
| 380 | 2738755565 | 2738541283 | Bacteria | 7222293 |
| 381 | 2738856051 | 2738541302 | Bacteria | 5944758 |
| 382 | 2739588976 | 2739367651 | Bacteria | 6359826 |
| 383 | 2740057446 | 2739367874 | Bacteria | 4872888 |
| 384 | 2753672866 | 2751185877 | Bacteria | 4921427 |
| 385 | 2765572367 | 2765235839 | Bacteria | 5314748 |
| 386 | 2772603468 | 2772190705 | Bacteria | 4666226 |
| 387 | 2775673040 | 2775506739 | Bacteria | 3855222 |
| 388 | 2816872645 | 2816332188 | Bacteria | 5133218 |
| 389 | 2819547948 | 2818991437 | Bacteria | 5805520 |
| 390 | 2842084039 | 2842083920 | Bacteria | 4857652 |
| 391 | 2842726403 | 2842722452 | Bacteria | 6263924 |
| 392 | 2842910653 | 2842909656 | Bacteria | 6185908 |
| 393 | 2849284585 | 2849281842 | Bacteria | 6065644 |
| 394 | 2871721821 | 2871720351 | Bacteria | 4862476 |
| 395 | 2881363967 | 2881359912 | Bacteria | 4935907 |
| 396 | 2889291998 | 2889290771 | Bacteria | 5530962 |
| 397 | 2906000952 | 2905999023 | Bacteria | 4591259 |
| 398 | 2919099457 | 2919097161 | Bacteria | 3860339 |
| 399 | 2919402744 | 2919399522 | Bacteria | 5164947 |
| 400 | 2945927474 | 2945924605 | Bacteria | 4296724 |
| 401 | 2946000971 | 2945997725 | Bacteria | 6404843 |
| 402 | 2946021238 | 2946019816 | Bacteria | 4621265 |
| 403 | 2954018223 | 2954016120 | Bacteria | 6446024 |
| 404 | 2977246291 | 2977243572 | Bacteria | 4374394 |
| 405 | 2984575794 | 2984572630 | Bacteria | 4186940 |
| 406 | 2984609250 | 2984606641 | Bacteria | 4186971 |
| 407 | 2993373652 | 2993372514 | Bacteria | 4214139 |
| 408 | 2993484330 | 2993480792 | Bacteria | 4022225 |
| 409 | Ga0157378_10089789 | |||
| 410 | JGI25154J39366_1000817 | |||
| 411 | JGI25157J39369_1000029 | |||
| 412 | JGI25152J39213_1000128 | |||
| 413 | JGI25150J39212_1000021 | |||
| 414 | JGI25151J46595_10000078 | |||
| 415 | JGI25153J46596_10000057 | |||
| 416 | rootH1_10078411 | |||
| 417 | rootH2_10041652 | |||
| 418 | rootH2_10051986 | |||
| 419 | rootH2_10054626 | |||
| 420 | rootH1_10109720 | |||
| 421 | rootH1_10110668 | |||
| 422 | rootH1_10340325 | |||
| 423 | Ga0055535_1005498 | |||
| 424 | Ga0055542_1002086 | |||
| 425 | Ga0055526_1003574 | |||
| 426 | Ga0055536_1000009 | |||
| 427 | Ga0055534_1011826 | |||
| 428 | Ga0055528_1000694 | |||
| 429 | Ga0055530_10001763 | |||
| 430 | Ga0055530_10002396 | |||
| 431 | Ga0065165_1000017 | |||
| 432 | Ga0065714_10064467 | |||
| 433 | Ga0065714_10083938 | |||
| 434 | Ga0065707_10109826 | |||
| 435 | Ga0070676_10023649 | |||
| 436 | Ga0070683_100000385 | |||
| 437 | Ga0070683_100005596 | |||
| 438 | Ga0070683_100054689 | |||
| 439 | Ga0070683_100059576 | |||
| 440 | Ga0070677_10042078 | |||
| 441 | Ga0068869_100003261 | |||
| 442 | Ga0068869_100004654 | |||
| 443 | Ga0068869_100022690 | |||
| 444 | Ga0070666_10056461 | |||
| 445 | Ga0070682_100001578 | |||
| 446 | Ga0068868_100021099 | |||
| 447 | Ga0068868_100034728 | |||
| 448 | Ga0068868_100128595 | |||
| 449 | Ga0070689_100001880 | |||
| 450 | Ga0070689_100004250 | |||
| 451 | Ga0070689_100020892 | |||
| 452 | Ga0070661_100000521 | |||
| 453 | Ga0070661_100008647 | |||
| 454 | Ga0070661_100048783 | |||
| 455 | Ga0070675_100071963 | |||
| 456 | Ga0070671_100004285 | |||
| 457 | Ga0070688_100015878 | |||
| 458 | Ga0070659_100011491 | |||
| 459 | Ga0070709_10000002 | |||
| 460 | Ga0070663_100034542 | |||
| 461 | Ga0070662_100005116 | |||
| 462 | Ga0070662_100017037 | |||
| 463 | Ga0070662_100040895 | |||
| 464 | Ga0070662_100135170 | |||
| 465 | Ga0070681_10020260 | |||
| 466 | Ga0070698_100034668 | |||
| 467 | Ga0070679_100056276 | |||
| 468 | Ga0070684_100009989 | |||
| 469 | Ga0068853_100003579 | |||
| 470 | Ga0068853_100015944 | |||
| 471 | Ga0068853_100111846 | |||
| 472 | Ga0070672_100069123 | |||
| 473 | Ga0070686_100097647 | |||
| 474 | Ga0070695_100087025 | |||
| 475 | Ga0070704_100121556 | |||
| 476 | Ga0070664_100161713 | |||
| 477 | Ga0070664_100211906 | |||
| 478 | Ga0068857_100000097 | |||
| 479 | Ga0068857_100007787 | |||
| 480 | Ga0068857_100016176 | |||
| 481 | Ga0068857_100042955 | |||
| 482 | Ga0068854_100064645 | |||
| 483 | Ga0068854_100120281 | |||
| 484 | Ga0068856_100010911 | |||
| 485 | Ga0068856_100128478 | |||
| 486 | Ga0068852_100072587 | |||
| 487 | Ga0068859_100067483 | |||
| 488 | Ga0068864_100017282 | |||
| 489 | Ga0068864_100037093 | |||
| 490 | Ga0068864_100041783 | |||
| 491 | Ga0068864_100059799 | |||
| 492 | Ga0068866_10043294 | |||
| 493 | Ga0068861_100023691 | |||
| 494 | Ga0068870_10007053 | |||
| 495 | Ga0068863_100126815 | |||
| 496 | Ga0068858_100013636 | |||
| 497 | Ga0068860_100060071 | |||
| 498 | Ga0068860_100275521 | |||
| 499 | Ga0081539_10010948 | |||
| 500 | Ga0081539_10063336 | |||
| 501 | Ga0070716_100094212 | |||
| 502 | Ga0097621_100027966 | |||
| 503 | Ga0097621_100123789 | |||
| 504 | Ga0068871_100004751 | |||
| 505 | Ga0068871_100052722 | |||
| 506 | Ga0075434_100017821 | |||
| 507 | Ga0075434_100190425 | |||
| 508 | Ga0097620_100067484 | |||
| 509 | Ga0099824_1001461 | |||
| 510 | Ga0105244_10000114 | |||
| 511 | Ga0105244_10000175 | |||
| 512 | Ga0105244_10044681 | |||
| 513 | Ga0114129_10128189 | |||
| 514 | Ga0105243_10000485 | |||
| 515 | Ga0105243_10212497 | |||
| 516 | Ga0105237_10000723 | |||
| 517 | Ga0105238_10051469 | |||
| 518 | Ga0105239_10008004 | |||
| 519 | Ga0105239_10054783 | |||
| 520 | Ga0105246_10088068 | |||
| 521 | Ga0157373_10000036 | |||
| 522 | Ga0157370_10000241 | |||
| 523 | Ga0157370_10004936 | |||
| 524 | Ga0157370_10024727 | |||
| 525 | Ga0157370_10052720 | |||
| 526 | Ga0157370_10078822 | |||
| 527 | Ga0157370_10118746 | |||
| 528 | Ga0157369_10001697 | |||
| 529 | Ga0157374_10004107 | |||
| 530 | Ga0157374_10021600 | |||
| 531 | Ga0157374_10108044 | |||
| 532 | Ga0157378_10040834 | |||
| 533 | Ga0157378_10044033 | |||
| 534 | Ga0163162_10001345 | |||
| 535 | Ga0163162_10001661 | |||
| 536 | Ga0163162_10056079 | |||
| 537 | Ga0163162_10065353 | |||
| 538 | Ga0163162_10141245 | |||
| 539 | Ga0157372_10065658 | |||
| 540 | Ga0157375_10005733 | |||
| 541 | Ga0157375_10009721 | |||
| 542 | Ga0157375_10056849 | |||
| 543 | Ga0157375_10203077 | |||
| 544 | Ga0163163_10026797 | |||
| 545 | Ga0157380_10000613 | |||
| 546 | Ga0182008_10000039 | |||
| 547 | Ga0182008_10000460 | |||
| 548 | Ga0157377_10091790 | |||
| 549 | Ga0157376_10107161 | |||
| 550 | Ga0182006_1000011 | |||
| 551 | Ga0182006_1000178 | |||
| 552 | Ga0182006_1001691 | |||
| 553 | Ga0183373_1003 | |||
| 554 | Ga0163161_10000108 | |||
| 555 | Ga0163161_10000955 | |||
| 556 | Ga0163161_10002830 | |||
| 557 | Ga0213876_10000366 | |||
| 558 | Ga0209258_100333 | |||
| 559 | Ga0207425_1000004 | |||
| 560 | Ga0209646_1000111 | |||
| 561 | Ga0209026_1000054 | |||
| 562 | Ga0209026_1000549 | |||
| 563 | Ga0209026_1002350 | |||
| 564 | Ga0209677_100105 | |||
| 565 | Ga0209148_1000129 | |||
| 566 | Ga0209759_1000043 | |||
| 567 | Ga0209129_1000048 | |||
| 568 | Ga0209455_1008118 | |||
| 569 | Ga0209673_1000083 | |||
| 570 | Ga0209675_1000367 | |||
| 571 | Ga0209676_1000001 | |||
| 572 | Ga0209025_1000009 | |||
| 573 | Ga0209564_1004329 | |||
| 574 | Ga0209758_1000010 | |||
| 575 | Ga0209758_1001318 | |||
| 576 | Ga0209050_1000018 | |||
| 577 | Ga0209050_1000273 | |||
| 578 | Ga0207426_1001089 | |||
| 579 | Ga0209257_1000308 | |||
| 580 | Ga0207655_1003241 | |||
| 581 | Ga0207643_10004031 | |||
| 582 | Ga0207707_10038616 | |||
| 583 | Ga0207695_10143104 | |||
| 584 | Ga0207671_10001233 | |||
| 585 | Ga0207657_10087213 | |||
| 586 | Ga0207649_10004109 | |||
| 587 | Ga0207659_10005427 | |||
| 588 | Ga0207706_10030830 | |||
| 589 | Ga0207706_10031447 | |||
| 590 | Ga0207706_10067305 | |||
| 591 | Ga0207686_10121091 | |||
| 592 | Ga0207709_10000557 | |||
| 593 | Ga0207670_10002959 | |||
| 594 | Ga0207670_10004439 | |||
| 595 | Ga0207691_10040969 | |||
| 596 | Ga0207689_10001853 | |||
| 597 | Ga0207689_10013102 | |||
| 598 | Ga0207689_10040094 | |||
| 599 | Ga0207689_10135752 | |||
| 600 | Ga0207661_10002647 | |||
| 601 | Ga0207661_10010507 | |||
| 602 | Ga0207661_10086751 | |||
| 603 | Ga0207661_10139618 | |||
| 604 | Ga0207679_10021439 | |||
| 605 | Ga0207679_10023164 | |||
| 606 | Ga0207679_10064718 | |||
| 607 | Ga0207667_10093176 | |||
| 608 | Ga0207712_10040251 | |||
| 609 | Ga0207712_10115543 | |||
| 610 | Ga0207640_10004558 | |||
| 611 | Ga0207640_10043984 | |||
| 612 | Ga0207677_10080756 | |||
| 613 | Ga0207703_10093405 | |||
| 614 | Ga0207678_10018265 | |||
| 615 | Ga0207702_10000376 | |||
| 616 | Ga0207702_10041188 | |||
| 617 | Ga0207641_10128449 | |||
| 618 | Ga0207648_10116830 | |||
| 619 | Ga0207676_10007689 | |||
| 620 | Ga0207674_10009743 | |||
| 621 | Ga0207674_10014698 | |||
| 622 | Ga0207674_10038778 | |||
| 623 | Ga0207674_10148780 | |||
| 624 | Ga0207683_10001848 | |||
| 625 | Ga0265319_1006597 | |||
| 626 | Ga0265336_10000006 | |||
| 627 | Ga0265336_10018486 | |||
| 628 | Ga0307515_10000007 | |||
| 629 | Ga0265324_10032195 | |||
| 630 | Ga0307511_10001876 | |||
| 631 | Ga0265332_10002104 | |||
| 632 | Ga0265327_10000127 | |||
| 633 | Ga0265327_10015613 | |||
| 634 | Ga0265316_10134734 | |||
| 635 | Ga0307513_10062773 | |||
| 636 | Ga0307408_100000497 | |||
| 637 | Ga0307508_10000677 | |||
| 638 | Ga0307516_10002738 | |||
| 639 | Ga0307405_10000031 | |||
| 640 | Ga0307406_10082637 | |||
| 641 | Ga0307407_10000036 | |||
| 642 | Ga0307407_10030043 | |||
| 643 | Ga0307412_10000012 | |||
| 644 | Ga0307412_10000353 | |||
| 645 | Ga0307412_10018587 | |||
| 646 | Ga0307412_10087352 | |||
| 647 | Ga0307416_100000007 | |||
| 648 | Ga0307416_100000033 | |||
| 649 | Ga0307414_10020645 | |||
| 650 | Ga0307414_10124633 | |||
| 651 | Ga0307507_10000071 | |||
| 652 | Ga0373955_0033535 | |||
| 653 | Ga0316584_0080369 | |||
| 654 | Ga0373925_0106600 | |||
| 655 | Ga0395900_0122723 | |||
| 656 | Ga0436365_0603740 | |||
| 657 | Ga0439465_0001960 | |||
| 658 | Ga0439465_0003437 | |||
| 659 | Ga0439445_0001428 | |||
| 660 | Ga0439449_0014970 | |||
| 661 | Ga0451577_0000044 | |||
| 662 | Ga0451577_0000943 | |||
| 663 | Ga0451577_0003129 | |||
| 664 | Ga0451577_0003816 | |||
| 665 | Ga0451577_0021567 | |||
| 666 | Ga0466972_0000009 | |||
| 667 | Ga0466972_0003760 | |||
| 668 | Ga0453683_0000183 | |||
| 669 | Ga0453683_0000311 | |||
| 670 | Ga0453683_0001586 | |||
| 671 | Ga0453683_0002945 | |||
| 672 | Ga0453683_0010526 | |||
| 673 | Ga0453683_0010728 | |||
| 674 | Ga0453683_0085355 | |||
| 675 | Ga0453684_0000661 | |||
| 676 | Ga0453684_0001039 | |||
| 677 | Ga0453684_0001154 | |||
| 678 | Ga0453684_0001483 | |||
| 679 | Ga0453684_0003340 | |||
| 680 | Ga0453684_0006265 | |||
| 681 | Ga0453684_0006891 | |||
| 682 | Ga0453684_0010046 | |||
| 683 | Ga0453684_0014940 | |||
| 684 | Ga0453684_0018285 | |||
| 685 | Ga0453684_0039894 | |||
| 686 | Ga0453684_0052321 | |||
| 687 | Ga0453684_0084263 | |||
| 688 | Ga0453684_0168326 | |||
| 689 | Ga0453684_0236899 | |||
| 690 | Ga0451576_0000047 | |||
| 691 | Ga0451576_0000283 | |||
| 692 | Ga0451576_0001065 | |||
| 693 | Ga0451576_0001534 | |||
| 694 | Ga0451576_0001892 | |||
| 695 | Ga0451576_0011780 | |||
| 696 | Ga0451576_0043522 | |||
| 697 | Ga0451576_0065945 | |||
| 698 | Ga0451576_0211354 | |||
| 699 | Ga0495627_000003 | |||
| 700 | Ga0495638_0067323 | |||
| 701 | Ga0495596_0001180 | |||
| 702 | Ga0495606_0004470 | |||
| 703 | Ga0495610_0000001 | |||
| 704 | Ga0495610_0000064 | |||
| 705 | Ga0495610_0005260 | |||
| 706 | Ga0495616_0018238 | |||
| 707 | Ga0495618_0032228 | |||
| 708 | Ga0495628_0025438 | |||
| 709 | Ga0495630_0015501 | |||
| 710 | Ga0495632_0021049 | |||
| 711 | Ga0495643_0000794 | |||
| 712 | Ga0495643_0010594 | |||
| 713 | Ga0495663_0000075 | |||
| 714 | Ga0495663_0001443 | |||
| 715 | Ga0495654_0000001 | |||
| 716 | Ga0495609_0000083 | |||
| 717 | Ga0495633_0000008 | |||
| 718 | Ga0495668_0002556 | |||
| 719 | Ga0495625_0023815 | |||
| 720 | Ga0495625_0081490 | |||
| 721 | Ga0495613_0071922 | |||
| 722 | Ga0495671_0018463 | |||
| 723 | Ga0495686_0000102 | |||
| 724 | Ga0495686_0000118 | |||
| 725 | Ga0495686_0014276 | |||
| 726 | Ga0496102_0018278 | |||
| 727 | Ga0496116_0000012 | |||
| 728 | Ga0496117_0000050 | |||
| 729 | Ga0496118_0000044 | |||
| 730 | Ga0496119_0000002 | |||
| 731 | Ga0496122_0000386 | |||
| 732 | Ga0496122_0000412 | |||
| 733 | Ga0496122_0001104 | |||
| 734 | Ga0496122_0001883 | |||
| 735 | Ga0496122_0008926 | |||
| 736 | Ga0496123_0001375 | |||
| 737 | Ga0496123_0001863 | |||
| 738 | Ga0496123_0002630 | |||
| 739 | Ga0496123_0015111 | |||
| 740 | Ga0496123_0021250 | |||
| 741 | Ga0496125_0001218 | |||
| 742 | Ga0496125_0007974 | |||
| 743 | Ga0496125_0040342 | |||
| 744 | Ga0496126_0005440 | |||
| 745 | Ga0501296_001919 | |||
| 746 | Ga0501032_0032053 | |||
| 747 | Ga0501043_0143673 | |||
| 748 | Ga0501047_0077237 | |||
| 749 | Ga0501047_0090057 | |||
| 750 | Ga0501243_003311 | |||
| 751 | Ga0501251_002929 | |||
| 752 | Ga0501241_000013 | |||
| 753 | Ga0501269_000311 | |||
| 754 | Ga0501035_0014771 | |||
| 755 | Ga0501044_0019470 | |||
| 756 | Ga0501044_0046532 | |||
| 757 | nmdc:mga05p37_8508_c1 | |||
| 758 | Ga0500578_0000280 | |||
| 759 | Ga0500644_0000217 | |||
| 760 | Ga0500646_0004764 | |||
| 761 | Ga0500583_0000035 | |||
| 762 | Ga0500583_0046658 | |||
| 763 | Ga0500568_0003469 | |||
| 764 | Ga0500616_0009404 | |||
| 765 | Ga0500622_0003534 | |||
| 766 | Ga0500634_0017200 | |||
| 767 | Ga0500636_0052941 | |||
| 768 | 2511234399 | |||
| 769 | 2585142604 | |||
| 770 | 2585159838 | |||
| 771 | 2585164034 | |||
| 772 | 2587678411 | |||
| 773 | 2587748049 | |||
| 774 | 2587752602 | |||
| 775 | 2587866653 | |||
| 776 | 2587943039 | |||
| 777 | 2588208511 | |||
| 778 | 2588212990 | |||
| 779 | 2588219580 | |||
| 780 | 2588224109 | |||
| 781 | 2588233609 | |||
| 782 | 2588446263 | |||
| 783 | 2590600557 | |||
| 784 | 2590611700 | |||
| 785 | 2729201677 | |||
| 786 | 2738713827 | |||
| 787 | 2738725155 | |||
| 788 | 2738755565 | |||
| 789 | 2738856051 | |||
| 790 | 2739588976 | |||
| 791 | 2740057446 | |||
| 792 | 2753672866 | |||
| 793 | 2765572367 | |||
| 794 | 2772603468 | |||
| 795 | 2775673040 | |||
| 796 | 2816872645 | |||
| 797 | 2819547948 | |||
| 798 | 2842084039 | |||
| 799 | 2842726403 | |||
| 800 | 2842910653 | |||
| 801 | 2849284585 | |||
| 802 | 2871721821 | |||
| 803 | 2881363967 | |||
| 804 | 2889291998 | |||
| 805 | 2906000952 | |||
| 806 | 2919099457 | |||
| 807 | 2919402744 | |||
| 808 | 2945927474 | |||
| 809 | 2946000971 | |||
| 810 | 2946021238 | |||
| 811 | 2954018223 | |||
| 812 | 2977246291 | |||
| 813 | 2984575794 | |||
| 814 | 2984609250 | |||
| 815 | 2993373652 | |||
| 816 | 2993484330 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wnw-assembly1.cif.gz_B | the crystal structure of srfj from salmonella typhimurium | 0.9551 | 24 | 474 |
| 2wnw-assembly1.cif.gz_B | the crystal structure of srfj from salmonella typhimurium | 0.9467 | 24 | 474 |
| 2xwd-assembly1.cif.gz_A | x-ray structure of acid-beta-glucosidase with 5n,6o-(n'-(n-octyl)imino)nojirimycin in the active site | 0.9437 | 23 | 472 |
| 6q1p-assembly2.cif.gz_B | glucocerebrosidase in complex with pharmacological chaperone norimx8 | 0.942 | 23 | 472 |
| 6yv3-assembly1.cif.gz_AAA | structure of recombinant human beta-glucocerebrosidase in complex with galacto-configured cyclophellitol aziridine inhibitor | 0.9417 | 23 | 474 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VCJ4_494_561_2.60.40.1180 | Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II | 0.9799 | 408 | 472 | 2.60.40.1180 |
| 2wnwB01 | Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II | 0.9497 | 414 | 474 | 2.60.40.1180 |
| 2wnwB02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9455 | 67 | 412 | 3.20.20.80 |
| 2wnwB02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9428 | 67 | 412 | 3.20.20.80 |
| af_G5ECR8_80_454_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9282 | 49 | 411 | 3.20.20.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X7WQD0-F1-model_v4 | Glycosyl hydrolase family 30 beta sandwich domain-containing protein | 0.9922 | 381 | 472 |
GO:0004348
GO:0006680 GO:0016020 |
| AF-A0A2W6RW51-F1-model_v4 | Glycosyl hydrolase | 0.991 | 381 | 472 |
GO:0004348
GO:0006680 GO:0016020 |
| AF-A0A3C0HBR0-F1-model_v4 | Glycosyl hydrolase family 30 beta sandwich domain-containing protein | 0.9895 | 383 | 474 |
GO:0004348
GO:0006680 GO:0016020 |
| AF-A0A7W4NNX6-F1-model_v4 | deleted | 0.9867 | 51 | 474 |
|
| AF-A0A3C1YS78-F1-model_v4 | Glycosyl hydrolase | 0.9853 | 25 | 472 |
GO:0004348
GO:0006680 GO:0016020 |