F436728

General Info

Members Datasets Scaffolds Average Seq Length
408 170 816 293

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10125082|Ga0182008_101250821
Length 313
Sequence LGKFIGGGIIGLLLKIDKMLMSDQSVFTIVNRQNGNLAFKLLWFDDNSYFDHIQRNNYYSLIWIRNGSGIVTADFSEHNFEKGSLFAFSPYQPFMVATKEKLGGIAFQFHPDFFCIHKHHKEVACHGVLFNNIYEPPFVRVSEAAASTFGMLAENMKTELQNPELAGYELLVSYLKIFLITASRLRKEERGAVLPVSIYEKTPFVLQRLKEAIETDFRKRHAARDYAEALSISVKALAKITKRYFNKTPTELISERIVIEAKRELYLTNKTIKEIAYELGYDDEYYFSRFFKINTDISPQTYRDTVGFAKGVA

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
120 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
131 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
132 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
162 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
163 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
164 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
165 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
166 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
167 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
168 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
169 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
170 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.04
Metatranscriptomes 0
Isolates 1.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.96
Nodule 0.25
Rhizoplane 1.23
Rhizosphere 94.12
Stem 0
Stem Tuber 0
Unclassified 10.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10125082 3300014497 Unclassified 1280
2 SwRhRL2b_contig_1596339 2162886007 Bacteria 98699
3 SwRhRL2b_contig_674713 2162886007 Bacteria 1151
4 MRS1b_contig_3726434 2162886011 Bacteria 1195
5 rootH2_10042807 3300003320 Bacteria 5922
6 rootL2_10351168 3300003322 Bacteria 2358
7 Ga0055531_10000198 3300003794 Bacteria 66737
8 Ga0065714_10006592 3300005288 Bacteria 3226
9 Ga0065714_10010546 3300005288 Bacteria 4998
10 Ga0065704_10070168 3300005289 Bacteria 171820
11 Ga0065704_10099580 3300005289 Bacteria 2306
12 Ga0065712_10093760 3300005290 Unclassified 2280
13 Ga0065712_10104964 3300005290 Bacteria 1949
14 Ga0065715_10091999 3300005293 Bacteria 5401
15 Ga0070676_10179801 3300005328 Bacteria 1374
16 Ga0070676_10206497 3300005328 Bacteria 1290
17 Ga0070683_100007310 3300005329 Bacteria 9322
18 Ga0070683_100050606 3300005329 Bacteria 3847
19 Ga0070690_100042808 3300005330 Bacteria 2869
20 Ga0070690_100045249 3300005330 Bacteria 2795
21 Ga0070670_100077608 3300005331 Bacteria 2853
22 Ga0070670_100095989 3300005331 Bacteria 2550
23 Ga0070670_100287883 3300005331 Bacteria 1435
24 Ga0070670_100359025 3300005331 Bacteria 1281
25 Ga0070670_100363321 3300005331 Unclassified 1273
26 Ga0068869_100003957 3300005334 Bacteria 9153
27 Ga0068869_100008954 3300005334 Bacteria 6480
28 Ga0068869_100184480 3300005334 Bacteria 1637
29 Ga0070666_10018913 3300005335 Bacteria 4439
30 Ga0070666_10059260 3300005335 Bacteria 2589
31 Ga0070666_10124771 3300005335 Bacteria 1787
32 Ga0068868_100015211 3300005338 Bacteria 5686
33 Ga0068868_100028880 3300005338 Bacteria 4245
34 Ga0068868_100061953 3300005338 Bacteria 2964
35 Ga0068868_100512383 3300005338 Bacteria 1052
36 Ga0070689_100023427 3300005340 Bacteria 4621
37 Ga0070689_100027880 3300005340 Bacteria 4262
38 Ga0070689_100035427 3300005340 Bacteria 3814
39 Ga0070687_100009976 3300005343 Bacteria 4086
40 Ga0070661_100002275 3300005344 Bacteria 13179
41 Ga0070661_100007764 3300005344 Bacteria 7401
42 Ga0070661_100011673 3300005344 Bacteria 6125
43 Ga0070661_100449871 3300005344 Bacteria 1025
44 Ga0070668_100039768 3300005347 Bacteria 3597
45 Ga0070668_100176527 3300005347 Bacteria 1742
46 Ga0070669_100010774 3300005353 Bacteria 6490
47 Ga0070669_100108812 3300005353 Bacteria 2101
48 Ga0070669_100534671 3300005353 Unclassified 976
49 Ga0070675_100021634 3300005354 Bacteria 5139
50 Ga0070675_100030175 3300005354 Bacteria 4375
51 Ga0070675_100076198 3300005354 Bacteria 2789
52 Ga0070675_100275857 3300005354 Bacteria 1476
53 Ga0070671_100030398 3300005355 Bacteria 4457
54 Ga0070671_100030845 3300005355 Unclassified 4425
55 Ga0070671_100141692 3300005355 Bacteria 2029
56 Ga0070674_100026888 3300005356 Bacteria 3765
57 Ga0070674_100315756 3300005356 Bacteria 1251
58 Ga0070673_100025786 3300005364 Bacteria 4332
59 Ga0070673_100046874 3300005364 Unclassified 3359
60 Ga0070673_100046963 3300005364 Bacteria 3357
61 Ga0070688_100002392 3300005365 Bacteria 9476
62 Ga0070688_100008249 3300005365 Bacteria 5648
63 Ga0070688_100010018 3300005365 Bacteria 5207
64 Ga0070688_100045490 3300005365 Unclassified 2712
65 Ga0070659_100078053 3300005366 Bacteria 2642
66 Ga0070667_100013142 3300005367 Bacteria 6844
67 Ga0070667_100016120 3300005367 Bacteria 6182
68 Ga0070667_100076597 3300005367 Bacteria 2856
69 Ga0070667_100110703 3300005367 Unclassified 2381
70 Ga0070667_100120878 3300005367 Bacteria 2278
71 Ga0070678_100174440 3300005456 Bacteria 1754
72 Ga0070678_100191282 3300005456 Bacteria 1683
73 Ga0070662_100007885 3300005457 Bacteria 6919
74 Ga0070662_100011594 3300005457 Bacteria 5818
75 Ga0070662_100103171 3300005457 Bacteria 2162
76 Ga0068867_100006733 3300005459 Bacteria 8122
77 Ga0068867_100068315 3300005459 Bacteria 2652
78 Ga0068867_100223398 3300005459 Bacteria 1519
79 Ga0068867_100322198 3300005459 Bacteria 1281
80 Ga0070698_100018562 3300005471 Bacteria 7322
81 Ga0070684_100001704 3300005535 Bacteria 16004
82 Ga0070684_100023837 3300005535 Bacteria 5126
83 Ga0070684_100026672 3300005535 Unclassified 4869
84 Ga0070684_100083739 3300005535 Bacteria 2826
85 Ga0068853_100526380 3300005539 Bacteria 1118
86 Ga0070672_100020447 3300005543 Bacteria 4828
87 Ga0070672_100092390 3300005543 Bacteria 2443
88 Ga0070686_100101776 3300005544 Unclassified 1942
89 Ga0068855_100629745 3300005563 Bacteria 1154
90 Ga0070664_100004400 3300005564 Bacteria 11316
91 Ga0070664_100027144 3300005564 Unclassified 4757
92 Ga0070664_100104422 3300005564 Bacteria 2467
93 Ga0068857_100007290 3300005577 Bacteria 9524
94 Ga0068857_100173811 3300005577 Bacteria 1959
95 Ga0068852_100064686 3300005616 Bacteria 3189
96 Ga0068852_100157208 3300005616 Bacteria 2119
97 Ga0068852_100167902 3300005616 Unclassified 2054
98 Ga0068859_100003346 3300005617 Bacteria 16312
99 Ga0068859_100005938 3300005617 Bacteria 12396
100 Ga0068859_100006389 3300005617 Bacteria 11958
101 Ga0068859_100012004 3300005617 Bacteria 8702
102 Ga0068859_100103039 3300005617 Bacteria 2912
103 Ga0068859_100116801 3300005617 Bacteria 2733
104 Ga0068859_100167042 3300005617 Unclassified 2280
105 Ga0068859_100467642 3300005617 Bacteria 1357
106 Ga0068864_100025093 3300005618 Bacteria 5018
107 Ga0068864_100199666 3300005618 Bacteria 1836
108 Ga0068864_100290520 3300005618 Bacteria 1528
109 Ga0068864_100329058 3300005618 Bacteria 1437
110 Ga0068866_10170163 3300005718 Bacteria 1278
111 Ga0068866_10210165 3300005718 Bacteria 1168
112 Ga0068861_100325600 3300005719 Bacteria 1340
113 Ga0068870_10018887 3300005840 Bacteria 3336
114 Ga0068863_100001806 3300005841 Bacteria 21231
115 Ga0068863_100023879 3300005841 Bacteria 5835
116 Ga0068863_100038687 3300005841 Bacteria 4537
117 Ga0068863_100061895 3300005841 Unclassified 3539
118 Ga0068863_100789845 3300005841 Viruses 947
119 Ga0068858_100007207 3300005842 Bacteria 10780
120 Ga0068858_100122853 3300005842 Bacteria 2429
121 Ga0068858_100459283 3300005842 Unclassified 1228
122 Ga0068860_100275890 3300005843 Unclassified 1642
123 Ga0068860_100323284 3300005843 Unclassified 1514
124 Ga0068860_100598624 3300005843 Bacteria 1108
125 Ga0068862_100008288 3300005844 Bacteria 8600
126 Ga0068862_100072076 3300005844 Bacteria 2983
127 Ga0068862_100279519 3300005844 Bacteria 1529
128 Ga0068862_100521394 3300005844 Bacteria 1131
129 Ga0075366_10001251 3300006195 Bacteria 12603
130 Ga0097621_100000730 3300006237 Bacteria 22991
131 Ga0097621_100008252 3300006237 Bacteria 7493
132 Ga0097621_100075713 3300006237 Bacteria 2790
133 Ga0097621_100098155 3300006237 Unclassified 2460
134 Ga0097621_100178662 3300006237 Bacteria 1833
135 Ga0068871_100001108 3300006358 Bacteria 18066
136 Ga0068871_100006473 3300006358 Bacteria 8288
137 Ga0068871_100056914 3300006358 Bacteria 3180
138 Ga0068871_100070827 3300006358 Bacteria 2866
139 Ga0068871_100076027 3300006358 Bacteria 2773
140 Ga0068871_100095104 3300006358 Bacteria 2487
141 Ga0068871_100342099 3300006358 Bacteria 1321
142 Ga0097620_100003346 3300006931 Bacteria 16312
143 Ga0097620_100005935 3300006931 Bacteria 12396
144 Ga0097620_100006389 3300006931 Bacteria 11958
145 Ga0097620_100012005 3300006931 Bacteria 8702
146 Ga0097620_100103042 3300006931 Bacteria 2912
147 Ga0097620_100116791 3300006931 Bacteria 2733
148 Ga0097620_100167041 3300006931 Unclassified 2280
149 Ga0097620_100467639 3300006931 Bacteria 1357
150 Ga0099824_1000108 3300006942 Bacteria 66974
151 Ga0105251_10107043 3300009011 Bacteria 1276
152 Ga0105241_10119776 3300009174 Bacteria 2118
153 Ga0105242_10006625 3300009176 Bacteria 8928
154 Ga0105242_10026503 3300009176 Bacteria 4595
155 Ga0105242_10081751 3300009176 Bacteria 2702
156 Ga0105242_10094287 3300009176 Bacteria 2525
157 Ga0105242_10281258 3300009176 Bacteria 1511
158 Ga0105248_10033655 3300009177 Bacteria 5726
159 Ga0105248_10133731 3300009177 Unclassified 2798
160 Ga0105237_10164508 3300009545 Bacteria 2217
161 Ga0105237_10301479 3300009545 Bacteria 1605
162 Ga0105249_10018002 3300009553 Bacteria 6279
163 Ga0105249_10023287 3300009553 Bacteria 5556
164 Ga0105249_10068920 3300009553 Bacteria 3263
165 Ga0105249_10077516 3300009553 Bacteria 3082
166 Ga0105249_10229072 3300009553 Bacteria 1832
167 Ga0105249_10230541 3300009553 Unclassified 1826
168 Ga0105249_10302303 3300009553 Bacteria 1605
169 Ga0105249_10543237 3300009553 Bacteria 1212
170 Ga0105239_10000006 3300010375 Bacteria 442319
171 Ga0105239_10083418 3300010375 Bacteria 3520
172 Ga0105239_10101543 3300010375 Bacteria 3182
173 Ga0105239_10246518 3300010375 Bacteria 2006
174 Ga0105246_10035524 3300011119 Bacteria 3332
175 Ga0105246_10158472 3300011119 Bacteria 1722
176 Ga0105246_10205017 3300011119 Unclassified 1536
177 Ga0157373_10000026 3300013100 Bacteria 139930
178 Ga0157373_10000048 3300013100 Bacteria 110104
179 Ga0157373_10120129 3300013100 Bacteria 1847
180 Ga0157373_10240661 3300013100 Bacteria 1279
181 Ga0157371_10016459 3300013102 Bacteria 5518
182 Ga0157370_10001765 3300013104 Bacteria 26690
183 Ga0157370_10011251 3300013104 Bacteria 9381
184 Ga0157374_10001456 3300013296 Bacteria 20010
185 Ga0157374_10008082 3300013296 Bacteria 8994
186 Ga0157374_10009524 3300013296 Bacteria 8340
187 Ga0157374_10016256 3300013296 Bacteria 6539
188 Ga0157374_10134192 3300013296 Bacteria 2398
189 Ga0157378_10005638 3300013297 Bacteria 10969
190 Ga0157378_10020597 3300013297 Bacteria 5800
191 Ga0157378_10082072 3300013297 Bacteria 2915
192 Ga0157378_10092804 3300013297 Bacteria 2747
193 Ga0163162_10001942 3300013306 Bacteria 19416
194 Ga0163162_10002198 3300013306 Bacteria 18310
195 Ga0163162_10005199 3300013306 Bacteria 12550
196 Ga0163162_10007669 3300013306 Bacteria 10508
197 Ga0163162_10025063 3300013306 Bacteria 5894
198 Ga0163162_10109443 3300013306 Bacteria 2860
199 Ga0163162_10127572 3300013306 Bacteria 2651
200 Ga0163162_10384029 3300013306 Bacteria 1538
201 Ga0163162_10482370 3300013306 Bacteria 1371
202 Ga0157372_10404895 3300013307 Bacteria 1590
203 Ga0157375_10001463 3300013308 Bacteria 20315
204 Ga0157375_10002097 3300013308 Bacteria 17213
205 Ga0157375_10005334 3300013308 Bacteria 11170
206 Ga0157375_10060082 3300013308 Bacteria 3768
207 Ga0157375_10100439 3300013308 Unclassified 2974
208 Ga0157375_10116860 3300013308 Bacteria 2772
209 Ga0157375_10150935 3300013308 Bacteria 2459
210 Ga0163163_10000498 3300014325 Bacteria 35378
211 Ga0163163_10001802 3300014325 Bacteria 18058
212 Ga0163163_10018283 3300014325 Bacteria 6556
213 Ga0163163_10068845 3300014325 Bacteria 3523
214 Ga0163163_10130935 3300014325 Unclassified 2549
215 Ga0163163_10181029 3300014325 Bacteria 2155
216 Ga0163163_10637515 3300014325 Bacteria 1129
217 Ga0157380_10004127 3300014326 Bacteria 10035
218 Ga0157380_10059102 3300014326 Bacteria 3058
219 Ga0157380_10201018 3300014326 Bacteria 1768
220 Ga0182008_10000452 3300014497 Bacteria 31325
221 Ga0157377_10008786 3300014745 Bacteria 4939
222 Ga0157377_10038298 3300014745 Bacteria 2646
223 Ga0157377_10065872 3300014745 Bacteria 2082
224 Ga0157377_10069544 3300014745 Bacteria 2032
225 Ga0157377_10153233 3300014745 Unclassified 1427
226 Ga0157379_10009870 3300014968 Bacteria 8314
227 Ga0157379_10019981 3300014968 Bacteria 5919
228 Ga0157379_10030528 3300014968 Bacteria 4798
229 Ga0157379_10075663 3300014968 Bacteria 3015
230 Ga0157376_10000944 3300014969 Bacteria 18916
231 Ga0157376_10029802 3300014969 Bacteria 4350
232 Ga0157376_10033069 3300014969 Bacteria 4159
233 Ga0157376_10055354 3300014969 Bacteria 3309
234 Ga0157376_10074219 3300014969 Bacteria 2899
235 Ga0157376_10106752 3300014969 Unclassified 2457
236 Ga0157376_10123756 3300014969 Bacteria 2296
237 Ga0157376_10131997 3300014969 Bacteria 2230
238 Ga0157376_10142190 3300014969 Unclassified 2154
239 Ga0182006_1006710 3300015261 Bacteria 5319
240 Ga0163161_10000235 3300017792 Bacteria 51172
241 Ga0163161_10011840 3300017792 Bacteria 6050
242 Ga0163161_10013460 3300017792 Bacteria 5694
243 Ga0163161_10013973 3300017792 Bacteria 5590
244 Ga0163161_10030545 3300017792 Bacteria 3836
245 Ga0163161_10035966 3300017792 Bacteria 3545
246 Ga0163161_10073133 3300017792 Unclassified 2511
247 Ga0163161_10088347 3300017792 Bacteria 2291
248 Ga0209026_1000612 3300025250 Bacteria 22906
249 Ga0209026_1001863 3300025250 Bacteria 8604
250 Ga0209129_1024081 3300025258 Unclassified 1076
251 Ga0209257_1000008 3300025304 Bacteria 1294570
252 Ga0207697_10041197 3300025315 Bacteria 1897
253 Ga0207697_10133959 3300025315 Bacteria 1072
254 Ga0207680_10022080 3300025903 Bacteria 3456
255 Ga0207647_10009346 3300025904 Bacteria 6968
256 Ga0207647_10009716 3300025904 Bacteria 6825
257 Ga0207643_10005351 3300025908 Bacteria 6869
258 Ga0207643_10032327 3300025908 Bacteria 2922
259 Ga0207695_10229591 3300025913 Bacteria 1761
260 Ga0207662_10010275 3300025918 Bacteria 5166
261 Ga0207649_10072243 3300025920 Bacteria 2207
262 Ga0207650_10008134 3300025925 Bacteria 7148
263 Ga0207650_10015433 3300025925 Bacteria 5320
264 Ga0207650_10055730 3300025925 Bacteria 2935
265 Ga0207650_10068601 3300025925 Bacteria 2663
266 Ga0207650_10490743 3300025925 Bacteria 1026
267 Ga0207659_10072543 3300025926 Bacteria 2517
268 Ga0207659_10264863 3300025926 Bacteria 1400
269 Ga0207644_10012190 3300025931 Bacteria 5704
270 Ga0207644_10039791 3300025931 Bacteria 3320
271 Ga0207690_10316050 3300025932 Bacteria 1226
272 Ga0207706_10009970 3300025933 Bacteria 8708
273 Ga0207706_10032169 3300025933 Bacteria 4671
274 Ga0207706_10187301 3300025933 Bacteria 1817
275 Ga0207686_10012546 3300025934 Bacteria 4660
276 Ga0207686_10014504 3300025934 Bacteria 4388
277 Ga0207670_10011054 3300025936 Bacteria 5224
278 Ga0207670_10013025 3300025936 Bacteria 4890
279 Ga0207670_10056391 3300025936 Bacteria 2659
280 Ga0207669_10054869 3300025937 Bacteria 2410
281 Ga0207691_10034529 3300025940 Bacteria 4702
282 Ga0207691_10138339 3300025940 Bacteria 2147
283 Ga0207691_10283202 3300025940 Unclassified 1426
284 Ga0207711_10023254 3300025941 Bacteria 5187
285 Ga0207711_10245672 3300025941 Unclassified 1642
286 Ga0207689_10003767 3300025942 Bacteria 13815
287 Ga0207689_10004950 3300025942 Bacteria 12000
288 Ga0207689_10010093 3300025942 Bacteria 8140
289 Ga0207689_10014840 3300025942 Bacteria 6613
290 Ga0207661_10030966 3300025944 Bacteria 4127
291 Ga0207661_10050778 3300025944 Unclassified 3306
292 Ga0207661_10241963 3300025944 Bacteria 1601
293 Ga0207661_10261592 3300025944 Bacteria 1541
294 Ga0207661_10365582 3300025944 Bacteria 1304
295 Ga0207679_10006721 3300025945 Bacteria 7284
296 Ga0207679_10052361 3300025945 Bacteria 2993
297 Ga0207679_10091769 3300025945 Bacteria 2351
298 Ga0207679_10239830 3300025945 Bacteria 1536
299 Ga0207651_10033712 3300025960 Unclassified 3306
300 Ga0207651_10055346 3300025960 Bacteria 2724
301 Ga0207651_10176758 3300025960 Bacteria 1689
302 Ga0207651_10264087 3300025960 Unclassified 1415
303 Ga0207712_10008917 3300025961 Bacteria 6342
304 Ga0207712_10018771 3300025961 Bacteria 4509
305 Ga0207712_10021908 3300025961 Bacteria 4200
306 Ga0207712_10038489 3300025961 Bacteria 3271
307 Ga0207668_10129634 3300025972 Bacteria 1924
308 Ga0207658_10020725 3300025986 Unclassified 4554
309 Ga0207658_10047963 3300025986 Bacteria 3129
310 Ga0207658_10107895 3300025986 Bacteria 2195
311 Ga0207677_10026111 3300026023 Bacteria 3657
312 Ga0207677_10028527 3300026023 Bacteria 3532
313 Ga0207677_10053189 3300026023 Bacteria 2755
314 Ga0207677_10417438 3300026023 Bacteria 1142
315 Ga0207703_10049113 3300026035 Bacteria 3410
316 Ga0207703_10323469 3300026035 Unclassified 1413
317 Ga0207703_10400614 3300026035 Bacteria 1273
318 Ga0207639_10350456 3300026041 Unclassified 1318
319 Ga0207639_10414337 3300026041 Bacteria 1217
320 Ga0207639_10421541 3300026041 Bacteria 1207
321 Ga0207678_10021730 3300026067 Bacteria 5628
322 Ga0207708_10050332 3300026075 Bacteria 3171
323 Ga0207708_10146885 3300026075 Bacteria 1853
324 Ga0207708_10169500 3300026075 Bacteria 1728
325 Ga0207641_10000213 3300026088 Bacteria 75051
326 Ga0207641_10000391 3300026088 Bacteria 51728
327 Ga0207641_10162681 3300026088 Bacteria 2030
328 Ga0207641_10412189 3300026088 Bacteria 1299
329 Ga0207648_10011770 3300026089 Bacteria 8223
330 Ga0207648_10052104 3300026089 Bacteria 3578
331 Ga0207648_10069180 3300026089 Bacteria 3076
332 Ga0207648_10099911 3300026089 Unclassified 2541
333 Ga0207648_10134789 3300026089 Bacteria 2175
334 Ga0207648_10373445 3300026089 Bacteria 1288
335 Ga0207676_10009334 3300026095 Bacteria 6980
336 Ga0207676_10011051 3300026095 Bacteria 6442
337 Ga0207676_10020461 3300026095 Bacteria 4842
338 Ga0207676_10178075 3300026095 Bacteria 1859
339 Ga0207676_10287555 3300026095 Bacteria 1495
340 Ga0207674_10005755 3300026116 Bacteria 14710
341 Ga0207674_10046605 3300026116 Bacteria 4450
342 Ga0207674_10068062 3300026116 Bacteria 3584
343 Ga0207674_10121273 3300026116 Bacteria 2582
344 Ga0207675_100022651 3300026118 Bacteria 5847
345 Ga0207675_100277464 3300026118 Unclassified 1628
346 Ga0207683_10249278 3300026121 Bacteria 1620
347 Ga0207683_10292358 3300026121 Bacteria 1490
348 Ga0268265_10027841 3300028380 Bacteria 4039
349 Ga0268265_10384221 3300028380 Bacteria 1293
350 Ga0268265_10465211 3300028380 Bacteria 1184
351 Ga0268265_10489006 3300028380 Unclassified 1157
352 Ga0268264_10037934 3300028381 Bacteria 3974
353 Ga0316177_1078208 3300030731 Bacteria 4238
354 Ga0316176_1124656 3300030732 Bacteria 38772
355 Ga0265327_10000207 3300031251 Bacteria 123193
356 Ga0307413_10098218 3300031824 Bacteria 1927
357 Ga0307414_10025301 3300032004 Bacteria 3800
358 Ga0307414_10162086 3300032004 Bacteria 1777
359 Ga0373955_0027696 3300035172 Bacteria 2933
360 Ga0373935_0194658 3300035692 Bacteria 1398
361 Ga0373937_0012356 3300036401 Bacteria 7509
362 Ga0373937_0617997 3300036401 Bacteria 1028
363 Ga0373925_0135238 3300037068 Unclassified 1926
364 Ga0451802_1309639 3300041460 Bacteria 1470
365 Ga0451853_1422469 3300041512 Bacteria 2264
366 Ga0439441_004633 3300042001 Bacteria 2094
367 Ga0439457_002466 3300042014 Bacteria 5276
368 Ga0439462_0011842 3300042015 Bacteria 2224
369 Ga0451577_0060431 3300042876 Bacteria 3379
370 Ga0453683_0024682 3300044673 Bacteria 3822
371 Ga0453684_0001542 3300044712 Bacteria 64357
372 Ga0451576_0016888 3300045051 Bacteria 8040
373 Ga0495638_0000008 3300046460 Bacteria 565643
374 Ga0495650_0006109 3300046471 Bacteria 7588
375 Ga0495662_0138670 3300046476 Bacteria 1197
376 Ga0495585_0154695 3300046492 Unclassified 1194
377 Ga0495608_0224049 3300046511 Bacteria 1179
378 Ga0495618_0134412 3300046514 Bacteria 1582
379 Ga0495628_0023646 3300046516 Bacteria 5042
380 Ga0495630_0009510 3300046517 Bacteria 6992
381 Ga0495652_0188698 3300046529 Bacteria 1575
382 Ga0495640_0401009 3300046533 Viruses 842
383 Ga0495634_0061278 3300046642 Bacteria 2501
384 Ga0495599_0089699 3300046678 Bacteria 1919
385 Ga0495674_0025531 3300047319 Bacteria 5416
386 Ga0495680_0114570 3300047322 Bacteria 1995
387 Ga0495684_0011350 3300047471 Bacteria 6878
388 Ga0495686_0033652 3300047472 Bacteria 3307
389 Ga0496101_0018594 3300048904 Bacteria 4728
390 Ga0496110_0029502 3300048913 Bacteria 4722
391 Ga0496112_0072575 3300048915 Unclassified 3403
392 Ga0496114_0188466 3300048917 Bacteria 1804
393 Ga0496126_0016120 3300048929 Bacteria 7488
394 Ga0496126_0020780 3300048929 Bacteria 6427
395 Ga0501241_002453 3300049758 Bacteria 3588
396 nmdc:mga0k408_1778_c1 3300050493 Bacteria 11562
397 Ga0495619_0008622 3300053085 Bacteria 6450
398 Ga0500616_0000004 3300053153 Bacteria 1002714
399 Ga0500616_0010252 3300053153 Bacteria 5619
400 Ga0500611_000167 3300053727 Bacteria 9605
401 2590612386 2588254257 Bacteria 5436094
402 2644011266 2643221600 Bacteria 5530138
403 2740057295 2739367874 Bacteria 4872888
404 2881363950 2881359912 Bacteria 4935907
405 2904556975 2904555929 Bacteria 5218588
406 2993375343 2993372514 Bacteria 4214139
407 8003152600 8003151029 Bacteria 8187759
408 8055595863 8055592153 Bacteria 5961247
409 Ga0182008_10125082
410 SwRhRL2b_contig_1596339
411 SwRhRL2b_contig_674713
412 MRS1b_contig_3726434
413 rootH2_10042807
414 rootL2_10351168
415 Ga0055531_10000198
416 Ga0065714_10006592
417 Ga0065714_10010546
418 Ga0065704_10070168
419 Ga0065704_10099580
420 Ga0065712_10093760
421 Ga0065712_10104964
422 Ga0065715_10091999
423 Ga0070676_10179801
424 Ga0070676_10206497
425 Ga0070683_100007310
426 Ga0070683_100050606
427 Ga0070690_100042808
428 Ga0070690_100045249
429 Ga0070670_100077608
430 Ga0070670_100095989
431 Ga0070670_100287883
432 Ga0070670_100359025
433 Ga0070670_100363321
434 Ga0068869_100003957
435 Ga0068869_100008954
436 Ga0068869_100184480
437 Ga0070666_10018913
438 Ga0070666_10059260
439 Ga0070666_10124771
440 Ga0068868_100015211
441 Ga0068868_100028880
442 Ga0068868_100061953
443 Ga0068868_100512383
444 Ga0070689_100023427
445 Ga0070689_100027880
446 Ga0070689_100035427
447 Ga0070687_100009976
448 Ga0070661_100002275
449 Ga0070661_100007764
450 Ga0070661_100011673
451 Ga0070661_100449871
452 Ga0070668_100039768
453 Ga0070668_100176527
454 Ga0070669_100010774
455 Ga0070669_100108812
456 Ga0070669_100534671
457 Ga0070675_100021634
458 Ga0070675_100030175
459 Ga0070675_100076198
460 Ga0070675_100275857
461 Ga0070671_100030398
462 Ga0070671_100030845
463 Ga0070671_100141692
464 Ga0070674_100026888
465 Ga0070674_100315756
466 Ga0070673_100025786
467 Ga0070673_100046874
468 Ga0070673_100046963
469 Ga0070688_100002392
470 Ga0070688_100008249
471 Ga0070688_100010018
472 Ga0070688_100045490
473 Ga0070659_100078053
474 Ga0070667_100013142
475 Ga0070667_100016120
476 Ga0070667_100076597
477 Ga0070667_100110703
478 Ga0070667_100120878
479 Ga0070678_100174440
480 Ga0070678_100191282
481 Ga0070662_100007885
482 Ga0070662_100011594
483 Ga0070662_100103171
484 Ga0068867_100006733
485 Ga0068867_100068315
486 Ga0068867_100223398
487 Ga0068867_100322198
488 Ga0070698_100018562
489 Ga0070684_100001704
490 Ga0070684_100023837
491 Ga0070684_100026672
492 Ga0070684_100083739
493 Ga0068853_100526380
494 Ga0070672_100020447
495 Ga0070672_100092390
496 Ga0070686_100101776
497 Ga0068855_100629745
498 Ga0070664_100004400
499 Ga0070664_100027144
500 Ga0070664_100104422
501 Ga0068857_100007290
502 Ga0068857_100173811
503 Ga0068852_100064686
504 Ga0068852_100157208
505 Ga0068852_100167902
506 Ga0068859_100003346
507 Ga0068859_100005938
508 Ga0068859_100006389
509 Ga0068859_100012004
510 Ga0068859_100103039
511 Ga0068859_100116801
512 Ga0068859_100167042
513 Ga0068859_100467642
514 Ga0068864_100025093
515 Ga0068864_100199666
516 Ga0068864_100290520
517 Ga0068864_100329058
518 Ga0068866_10170163
519 Ga0068866_10210165
520 Ga0068861_100325600
521 Ga0068870_10018887
522 Ga0068863_100001806
523 Ga0068863_100023879
524 Ga0068863_100038687
525 Ga0068863_100061895
526 Ga0068863_100789845
527 Ga0068858_100007207
528 Ga0068858_100122853
529 Ga0068858_100459283
530 Ga0068860_100275890
531 Ga0068860_100323284
532 Ga0068860_100598624
533 Ga0068862_100008288
534 Ga0068862_100072076
535 Ga0068862_100279519
536 Ga0068862_100521394
537 Ga0075366_10001251
538 Ga0097621_100000730
539 Ga0097621_100008252
540 Ga0097621_100075713
541 Ga0097621_100098155
542 Ga0097621_100178662
543 Ga0068871_100001108
544 Ga0068871_100006473
545 Ga0068871_100056914
546 Ga0068871_100070827
547 Ga0068871_100076027
548 Ga0068871_100095104
549 Ga0068871_100342099
550 Ga0097620_100003346
551 Ga0097620_100005935
552 Ga0097620_100006389
553 Ga0097620_100012005
554 Ga0097620_100103042
555 Ga0097620_100116791
556 Ga0097620_100167041
557 Ga0097620_100467639
558 Ga0099824_1000108
559 Ga0105251_10107043
560 Ga0105241_10119776
561 Ga0105242_10006625
562 Ga0105242_10026503
563 Ga0105242_10081751
564 Ga0105242_10094287
565 Ga0105242_10281258
566 Ga0105248_10033655
567 Ga0105248_10133731
568 Ga0105237_10164508
569 Ga0105237_10301479
570 Ga0105249_10018002
571 Ga0105249_10023287
572 Ga0105249_10068920
573 Ga0105249_10077516
574 Ga0105249_10229072
575 Ga0105249_10230541
576 Ga0105249_10302303
577 Ga0105249_10543237
578 Ga0105239_10000006
579 Ga0105239_10083418
580 Ga0105239_10101543
581 Ga0105239_10246518
582 Ga0105246_10035524
583 Ga0105246_10158472
584 Ga0105246_10205017
585 Ga0157373_10000026
586 Ga0157373_10000048
587 Ga0157373_10120129
588 Ga0157373_10240661
589 Ga0157371_10016459
590 Ga0157370_10001765
591 Ga0157370_10011251
592 Ga0157374_10001456
593 Ga0157374_10008082
594 Ga0157374_10009524
595 Ga0157374_10016256
596 Ga0157374_10134192
597 Ga0157378_10005638
598 Ga0157378_10020597
599 Ga0157378_10082072
600 Ga0157378_10092804
601 Ga0163162_10001942
602 Ga0163162_10002198
603 Ga0163162_10005199
604 Ga0163162_10007669
605 Ga0163162_10025063
606 Ga0163162_10109443
607 Ga0163162_10127572
608 Ga0163162_10384029
609 Ga0163162_10482370
610 Ga0157372_10404895
611 Ga0157375_10001463
612 Ga0157375_10002097
613 Ga0157375_10005334
614 Ga0157375_10060082
615 Ga0157375_10100439
616 Ga0157375_10116860
617 Ga0157375_10150935
618 Ga0163163_10000498
619 Ga0163163_10001802
620 Ga0163163_10018283
621 Ga0163163_10068845
622 Ga0163163_10130935
623 Ga0163163_10181029
624 Ga0163163_10637515
625 Ga0157380_10004127
626 Ga0157380_10059102
627 Ga0157380_10201018
628 Ga0182008_10000452
629 Ga0157377_10008786
630 Ga0157377_10038298
631 Ga0157377_10065872
632 Ga0157377_10069544
633 Ga0157377_10153233
634 Ga0157379_10009870
635 Ga0157379_10019981
636 Ga0157379_10030528
637 Ga0157379_10075663
638 Ga0157376_10000944
639 Ga0157376_10029802
640 Ga0157376_10033069
641 Ga0157376_10055354
642 Ga0157376_10074219
643 Ga0157376_10106752
644 Ga0157376_10123756
645 Ga0157376_10131997
646 Ga0157376_10142190
647 Ga0182006_1006710
648 Ga0163161_10000235
649 Ga0163161_10011840
650 Ga0163161_10013460
651 Ga0163161_10013973
652 Ga0163161_10030545
653 Ga0163161_10035966
654 Ga0163161_10073133
655 Ga0163161_10088347
656 Ga0209026_1000612
657 Ga0209026_1001863
658 Ga0209129_1024081
659 Ga0209257_1000008
660 Ga0207697_10041197
661 Ga0207697_10133959
662 Ga0207680_10022080
663 Ga0207647_10009346
664 Ga0207647_10009716
665 Ga0207643_10005351
666 Ga0207643_10032327
667 Ga0207695_10229591
668 Ga0207662_10010275
669 Ga0207649_10072243
670 Ga0207650_10008134
671 Ga0207650_10015433
672 Ga0207650_10055730
673 Ga0207650_10068601
674 Ga0207650_10490743
675 Ga0207659_10072543
676 Ga0207659_10264863
677 Ga0207644_10012190
678 Ga0207644_10039791
679 Ga0207690_10316050
680 Ga0207706_10009970
681 Ga0207706_10032169
682 Ga0207706_10187301
683 Ga0207686_10012546
684 Ga0207686_10014504
685 Ga0207670_10011054
686 Ga0207670_10013025
687 Ga0207670_10056391
688 Ga0207669_10054869
689 Ga0207691_10034529
690 Ga0207691_10138339
691 Ga0207691_10283202
692 Ga0207711_10023254
693 Ga0207711_10245672
694 Ga0207689_10003767
695 Ga0207689_10004950
696 Ga0207689_10010093
697 Ga0207689_10014840
698 Ga0207661_10030966
699 Ga0207661_10050778
700 Ga0207661_10241963
701 Ga0207661_10261592
702 Ga0207661_10365582
703 Ga0207679_10006721
704 Ga0207679_10052361
705 Ga0207679_10091769
706 Ga0207679_10239830
707 Ga0207651_10033712
708 Ga0207651_10055346
709 Ga0207651_10176758
710 Ga0207651_10264087
711 Ga0207712_10008917
712 Ga0207712_10018771
713 Ga0207712_10021908
714 Ga0207712_10038489
715 Ga0207668_10129634
716 Ga0207658_10020725
717 Ga0207658_10047963
718 Ga0207658_10107895
719 Ga0207677_10026111
720 Ga0207677_10028527
721 Ga0207677_10053189
722 Ga0207677_10417438
723 Ga0207703_10049113
724 Ga0207703_10323469
725 Ga0207703_10400614
726 Ga0207639_10350456
727 Ga0207639_10414337
728 Ga0207639_10421541
729 Ga0207678_10021730
730 Ga0207708_10050332
731 Ga0207708_10146885
732 Ga0207708_10169500
733 Ga0207641_10000213
734 Ga0207641_10000391
735 Ga0207641_10162681
736 Ga0207641_10412189
737 Ga0207648_10011770
738 Ga0207648_10052104
739 Ga0207648_10069180
740 Ga0207648_10099911
741 Ga0207648_10134789
742 Ga0207648_10373445
743 Ga0207676_10009334
744 Ga0207676_10011051
745 Ga0207676_10020461
746 Ga0207676_10178075
747 Ga0207676_10287555
748 Ga0207674_10005755
749 Ga0207674_10046605
750 Ga0207674_10068062
751 Ga0207674_10121273
752 Ga0207675_100022651
753 Ga0207675_100277464
754 Ga0207683_10249278
755 Ga0207683_10292358
756 Ga0268265_10027841
757 Ga0268265_10384221
758 Ga0268265_10465211
759 Ga0268265_10489006
760 Ga0268264_10037934
761 Ga0316177_1078208
762 Ga0316176_1124656
763 Ga0265327_10000207
764 Ga0307413_10098218
765 Ga0307414_10025301
766 Ga0307414_10162086
767 Ga0373955_0027696
768 Ga0373935_0194658
769 Ga0373937_0012356
770 Ga0373937_0617997
771 Ga0373925_0135238
772 Ga0451802_1309639
773 Ga0451853_1422469
774 Ga0439441_004633
775 Ga0439457_002466
776 Ga0439462_0011842
777 Ga0451577_0060431
778 Ga0453683_0024682
779 Ga0453684_0001542
780 Ga0451576_0016888
781 Ga0495638_0000008
782 Ga0495650_0006109
783 Ga0495662_0138670
784 Ga0495585_0154695
785 Ga0495608_0224049
786 Ga0495618_0134412
787 Ga0495628_0023646
788 Ga0495630_0009510
789 Ga0495652_0188698
790 Ga0495640_0401009
791 Ga0495634_0061278
792 Ga0495599_0089699
793 Ga0495674_0025531
794 Ga0495680_0114570
795 Ga0495684_0011350
796 Ga0495686_0033652
797 Ga0496101_0018594
798 Ga0496110_0029502
799 Ga0496112_0072575
800 Ga0496114_0188466
801 Ga0496126_0016120
802 Ga0496126_0020780
803 Ga0501241_002453
804 nmdc:mga0k408_1778_c1
805 Ga0495619_0008622
806 Ga0500616_0000004
807 Ga0500616_0010252
808 Ga0500611_000167
809 2590612386
810 2644011266
811 2740057295
812 2881363950
813 2904556975
814 2993375343
815 8003152600
816 8055595863

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

226

305

0.97

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

263

304

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.956 185 288
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.955 189 283
3lsg-assembly2.cif.gz_D the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9348 189 273
3lsg-assembly3.cif.gz_E the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9308 189 278
3oou-assembly1.cif.gz_A the structure of a protein with unkown function from listeria innocua 0.9087 186 286
ID Description Score Start End Superfamily
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9747 239 283 1.10.10.60
1d5yD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9646 236 283 1.10.10.60
1bl0A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9629 240 283 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9479 236 285 1.10.10.60
1xs9A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.947 240 283 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A3C1YJM9-F1-model_v4 AraC family transcriptional regulator 0.9583 184 284 GO:0003700
GO:0043565
AF-A0A5S5CLG3-F1-model_v4 AraC family transcriptional regulator of adaptative response / methylphosphotriester-DNA alkyltransferase methyltransferase 0.9497 182 285 GO:0003700
GO:0006281
GO:0008168
GO:0008270
GO:0032259
GO:0043565
AF-A0A8B1B359-F1-model_v4 deleted 0.9478 191 285
AF-A0A2D8UXM9-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9468 184 292 GO:0000976
GO:0003700
AF-A0A7W3MX04-F1-model_v4 AraC family transcriptional activator FtrA 0.9417 189 285 GO:0003700
GO:0043565

Map