F436862

General Info

Members Datasets Scaffolds Average Seq Length
408 229 816 161

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2808606447|2809226211
Length 180
Sequence ERVRVWATALIRQHLDPSWSFGFDNAKRRAGLCDFRRKRISVSRYLSARYDDDTNHQTLLHEVAHALAGPAAGHGAEWKRIARSLGYVGGTTHDGETAVELAPWVGVCPAGHTAYRHRRPPRATSCVACAPHFDRRHLFTWTRREISAATRLAAMTPRADAASRASEPDDAGPAHDRHRV

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
52 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
80 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
81 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
82 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
83 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
84 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
85 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
86 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
87 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
102 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
103 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
104 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
122 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
123 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
124 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
125 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
126 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
127 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
128 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
129 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
160 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
161 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
162 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
163 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
166 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
169 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
170 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
171 2643221546 Microbacterium sp. Root53 Isolate Unclassified
172 2643221553 Microbacterium sp. Root553 Isolate Unclassified
173 2643221566 Microbacterium sp. Root166 Isolate Unclassified
174 2643221572 Leifsonia sp. Root60 Isolate Unclassified
175 2643221575 Microbacterium sp. Root61 Isolate Unclassified
176 2643221597 Microbacterium sp. Root180 Isolate Unclassified
177 2643221616 Leifsonia sp. Root227 Isolate Unclassified
178 2643221619 Agromyces sp. Root81 Isolate Unclassified
179 2643221630 Microbacterium sp. Root322 Isolate Unclassified
180 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
181 2643221649 Leifsonia sp. Root4 Isolate Unclassified
182 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
183 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
184 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
185 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
186 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
187 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
188 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
189 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
190 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
191 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
192 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
193 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
194 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
195 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
196 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
197 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
198 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
199 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
200 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
201 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
202 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
203 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
204 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
205 2919069694 Microbacterium sp. 1154 Isolate Unclassified
206 2919395869 Microbacterium resistens 2980 Isolate Unclassified
207 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
208 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
209 2928153084 Leifsonia sp. 563 Isolate Unclassified
210 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
211 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
212 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
213 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
214 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
215 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
216 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
217 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
218 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
219 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
220 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
221 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
222 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
223 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
224 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
225 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
226 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
227 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
228 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
229 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 83.09
Metatranscriptomes 1.72
Isolates 15.2

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 14.46
Nodule 0
Rhizoplane 11.76
Rhizosphere 47.3
Stem 0
Stem Tuber 0.25
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10014430 3300001990 Bacteria 2565
2 JGI24735J21928_10013419 3300002067 Bacteria 2576
3 JGI25154J39366_1000583 3300002738 Bacteria 17718
4 JGI25164J39214_1001692 3300002772 Bacteria 4485
5 JGI25165J46597_1000269 3300003214 Bacteria 67008
6 rootH1_10087931 3300003316 Bacteria 1215
7 Ga0006562J51391_1193684 3300003578 Bacteria 8992
8 Ga0006562J51391_1193685 3300003578 Bacteria 8950
9 Ga0055539_1000090 3300003752 Bacteria 112260
10 Ga0055533_1000001 3300003756 Bacteria 1863437
11 Ga0055532_1008061 3300003758 Bacteria 1329
12 Ga0055525_1000126 3300003759 Bacteria 115430
13 Ga0055527_1000064 3300003760 Bacteria 88552
14 Ga0055542_1000023 3300003762 Bacteria 292964
15 Ga0055529_1000050 3300003763 Bacteria 206297
16 Ga0055529_1023164 3300003763 Bacteria 769
17 Ga0065714_10016783 3300005288 Bacteria 1725
18 Ga0070658_10032547 3300005327 Bacteria 4192
19 Ga0070660_100141865 3300005339 Bacteria 1928
20 Ga0070659_100367799 3300005366 Bacteria 1209
21 Ga0070714_100412629 3300005435 Bacteria 1278
22 Ga0068853_100057965 3300005539 Bacteria 3343
23 Ga0070665_100123244 3300005548 Bacteria 2594
24 Ga0070664_100799185 3300005564 Bacteria 882
25 Ga0075365_10088244 3300006038 Bacteria 2110
26 Ga0075368_10098866 3300006042 Bacteria 1197
27 Ga0075364_10003400 3300006051 Bacteria 9039
28 Ga0075364_10052725 3300006051 Bacteria 2659
29 Ga0075364_10211061 3300006051 Bacteria 1317
30 Ga0075364_10257156 3300006051 Bacteria 1187
31 Ga0075367_10174568 3300006178 Bacteria 1339
32 Ga0075369_10010891 3300006186 Bacteria 3564
33 Ga0075369_10013418 3300006186 Bacteria 3252
34 Ga0075369_10239114 3300006186 Bacteria 842
35 Ga0075370_10131832 3300006353 Bacteria 1458
36 Ga0105244_10018680 3300009036 Bacteria 3883
37 Ga0105244_10058384 3300009036 Bacteria 1947
38 Ga0105237_10070287 3300009545 Bacteria 3496
39 Ga0157370_10267141 3300013104 Bacteria 1581
40 Ga0157370_10293729 3300013104 Bacteria 1501
41 Ga0157370_10367856 3300013104 Bacteria 1325
42 Ga0157369_10024848 3300013105 Bacteria 6656
43 Ga0157369_10111107 3300013105 Bacteria 2913
44 Ga0157369_10241071 3300013105 Bacteria 1889
45 Ga0157369_10739413 3300013105 Bacteria 1012
46 Ga0171462_1001 3300013250 Bacteria 1135406
47 Ga0163162_10118835 3300013306 Bacteria 2746
48 Ga0157372_10109028 3300013307 Bacteria 3170
49 Ga0157372_10121293 3300013307 Bacteria 3003
50 Ga0157372_10240471 3300013307 Bacteria 2101
51 Ga0157372_11281465 3300013307 Bacteria 846
52 Ga0157375_10691187 3300013308 Bacteria 1174
53 Ga0157375_11019999 3300013308 Bacteria 966
54 Ga0157375_12749930 3300013308 Bacteria 588
55 Ga0163163_11559959 3300014325 Bacteria 721
56 Ga0163161_10086799 3300017792 Bacteria 2310
57 Ga0197907_10669710 3300020069 Bacteria 1357
58 Ga0206354_10426408 3300020081 Bacteria 4480
59 Ga0206353_11263019 3300020082 Bacteria 1167
60 Ga0206353_11519977 3300020082 Bacteria 1522
61 Ga0224712_10013001 3300022467 Bacteria 2638
62 Ga0209566_100066 3300025225 Bacteria 186951
63 Ga0209674_100001 3300025226 Bacteria 4013750
64 Ga0209672_100116 3300025228 Bacteria 87706
65 Ga0209147_105105 3300025229 Bacteria 2029
66 Ga0209563_100001 3300025230 Bacteria 4013775
67 Ga0209563_105220 3300025230 Bacteria 2381
68 Ga0207427_100054 3300025231 Bacteria 216315
69 Ga0209437_104104 3300025233 Bacteria 2581
70 Ga0209258_102773 3300025242 Bacteria 4233
71 Ga0209646_1000041 3300025246 Bacteria 346024
72 Ga0209677_100001 3300025253 Bacteria 4013787
73 Ga0209677_102888 3300025253 Bacteria 6034
74 Ga0209148_1000240 3300025254 Bacteria 87706
75 Ga0209233_1000001 3300025261 Bacteria 2992747
76 Ga0209455_1000197 3300025272 Bacteria 87706
77 Ga0209455_1000681 3300025272 Bacteria 20165
78 Ga0207655_1024481 3300025728 Bacteria 2957
79 Ga0207647_10033043 3300025904 Bacteria 3317
80 Ga0207647_10308500 3300025904 Bacteria 900
81 Ga0207671_10081003 3300025914 Bacteria 2434
82 Ga0207657_10144192 3300025919 Bacteria 1944
83 Ga0207650_10657675 3300025925 Bacteria 884
84 Ga0207664_10350838 3300025929 Bacteria 1306
85 Ga0207679_10495107 3300025945 Bacteria 1090
86 Ga0209813_10165033 3300027866 Bacteria 801
87 Ga0268266_10170911 3300028379 Bacteria 1973
88 Ga0307408_100307392 3300031548 Bacteria 1331
89 Ga0307514_10008865 3300031649 Bacteria 8508
90 Ga0307405_10109406 3300031731 Bacteria 1869
91 Ga0307405_10357623 3300031731 Bacteria 1129
92 Ga0307413_10284418 3300031824 Bacteria 1246
93 Ga0307406_10004625 3300031901 Bacteria 7493
94 Ga0307406_10639420 3300031901 Bacteria 882
95 Ga0307406_10744112 3300031901 Bacteria 822
96 Ga0307407_10386947 3300031903 Bacteria 1000
97 Ga0307407_10497904 3300031903 Bacteria 893
98 Ga0307412_10107998 3300031911 Bacteria 1982
99 Ga0307412_10332522 3300031911 Bacteria 1213
100 Ga0307412_10346071 3300031911 Bacteria 1192
101 Ga0307412_10403011 3300031911 Bacteria 1114
102 Ga0307409_100227005 3300031995 Bacteria 1690
103 Ga0307409_100518859 3300031995 Bacteria 1164
104 Ga0307409_101262957 3300031995 Bacteria 763
105 Ga0307416_100624223 3300032002 Bacteria 1160
106 Ga0307416_100700351 3300032002 Bacteria 1102
107 Ga0307414_10102763 3300032004 Bacteria 2155
108 Ga0307414_10138642 3300032004 Bacteria 1901
109 Ga0307414_10570677 3300032004 Bacteria 1011
110 Ga0307414_10775161 3300032004 Bacteria 873
111 Ga0307414_11030742 3300032004 Bacteria 758
112 Ga0307414_11034530 3300032004 Bacteria 757
113 Ga0395899_0021959 3300037312 Bacteria 4840
114 Ga0395899_0066486 3300037312 Bacteria 2647
115 Ga0395900_0006363 3300037418 Bacteria 12311
116 Ga0395900_0221038 3300037418 Bacteria 1909
117 Ga0395898_0000060 3300037466 Bacteria 273835
118 Ga0395898_0575453 3300037466 Bacteria 1069
119 Ga0395901_0271327 3300038443 Bacteria 1764
120 Ga0395901_1053430 3300038443 Bacteria 786
121 Ga0439465_0009501 3300041413 Bacteria 3063
122 Ga0439465_0138662 3300041413 Bacteria 863
123 Ga0451789_0428685 3300041443 Bacteria 1805
124 Ga0451789_0583784 3300041443 Bacteria 931
125 Ga0451791_1825207 3300041451 Bacteria 895
126 Ga0451793_1295235 3300041452 Bacteria 1088
127 Ga0451793_1405135 3300041452 Bacteria 619
128 Ga0451797_0449651 3300041453 Bacteria 525
129 Ga0451797_0702840 3300041453 Bacteria 700
130 Ga0451797_0782388 3300041453 Bacteria 526
131 Ga0451837_0115120 3300041494 Bacteria 909
132 Ga0451841_0646979 3300041498 Bacteria 1022
133 Ga0451849_0307891 3300041505 Bacteria 637
134 Ga0451843_0087126 3300041509 Bacteria 827
135 Ga0451853_0116608 3300041512 Bacteria 601
136 Ga0451853_1929312 3300041512 Bacteria 1437
137 Ga0451853_2648805 3300041512 Bacteria 1316
138 Ga0466972_0012956 3300044658 Bacteria 4189
139 Ga0466965_0000003 3300044683 Bacteria 265985
140 Ga0466965_0024011 3300044683 Bacteria 2947
141 Ga0466965_0349677 3300044683 Bacteria 809
142 Ga0466966_0040063 3300044684 Bacteria 3015
143 Ga0466966_0163760 3300044684 Bacteria 1353
144 Ga0466961_0026029 3300044693 Bacteria 3761
145 Ga0466961_0116646 3300044693 Bacteria 1678
146 Ga0466971_0097020 3300044719 Bacteria 1352
147 Ga0466968_0015706 3300044735 Bacteria 3006
148 Ga0466970_0000001 3300044765 Bacteria 252791
149 Ga0466970_0002959 3300044765 Bacteria 8236
150 Ga0466970_0030407 3300044765 Bacteria 2847
151 Ga0466970_0042721 3300044765 Bacteria 2411
152 Ga0466970_0067470 3300044765 Bacteria 1921
153 Ga0466957_0018878 3300044842 Bacteria 4053
154 Ga0466960_0019953 3300044901 Bacteria 2962
155 Ga0466960_0141600 3300044901 Bacteria 1278
156 Ga0466960_0313388 3300044901 Bacteria 887
157 Ga0466960_0326225 3300044901 Bacteria 870
158 Ga0466959_0006693 3300045049 Bacteria 8015
159 Ga0466959_0088679 3300045049 Bacteria 2223
160 Ga0466959_0293268 3300045049 Bacteria 1115
161 Ga0466959_0423139 3300045049 Bacteria 904
162 Ga0466967_1117980 3300045976 Bacteria 785
163 Ga0495638_0463508 3300046460 Bacteria 645
164 Ga0495620_0074209 3300046515 Bacteria 1386
165 Ga0495633_0163480 3300046558 Bacteria 1027
166 Ga0495633_0429111 3300046558 Bacteria 597
167 Ga0495656_0435423 3300046615 Bacteria 689
168 Ga0495672_0012519 3300047320 Bacteria 5915
169 Ga0495686_0071097 3300047472 Bacteria 2143
170 Ga0495686_0222865 3300047472 Bacteria 1072
171 Ga0495615_0097746 3300048090 Bacteria 826
172 Ga0496100_0004294 3300048903 Bacteria 7542
173 Ga0496100_0071415 3300048903 Bacteria 2318
174 Ga0496101_0145840 3300048904 Bacteria 1807
175 Ga0496101_0536273 3300048904 Bacteria 925
176 Ga0496102_0028824 3300048905 Bacteria 4963
177 Ga0496103_0011502 3300048906 Bacteria 5244
178 Ga0496103_0130142 3300048906 Bacteria 1607
179 Ga0496104_0064110 3300048907 Bacteria 3486
180 Ga0496104_0101230 3300048907 Bacteria 2758
181 Ga0496104_0497932 3300048907 Bacteria 1129
182 Ga0496104_0505138 3300048907 Bacteria 1120
183 Ga0496104_0530334 3300048907 Bacteria 1088
184 Ga0496104_1251160 3300048907 Bacteria 645
185 Ga0496105_0095269 3300048908 Bacteria 2459
186 Ga0496105_0149002 3300048908 Bacteria 1924
187 Ga0496105_0205320 3300048908 Bacteria 1607
188 Ga0496105_0205661 3300048908 Bacteria 1606
189 Ga0496105_0395616 3300048908 Bacteria 1097
190 Ga0496105_0733853 3300048908 Bacteria 756
191 Ga0496107_0050676 3300048910 Bacteria 2993
192 Ga0496108_0030968 3300048911 Bacteria 4435
193 Ga0496108_0038406 3300048911 Bacteria 3989
194 Ga0496109_0150724 3300048912 Bacteria 2177
195 Ga0496109_0270318 3300048912 Bacteria 1601
196 Ga0496110_0119485 3300048913 Bacteria 2374
197 Ga0496111_0142970 3300048914 Bacteria 1773
198 Ga0496111_0145419 3300048914 Bacteria 1757
199 Ga0496111_0802246 3300048914 Bacteria 681
200 Ga0496112_0518810 3300048915 Bacteria 1126
201 Ga0496112_0803868 3300048915 Bacteria 865
202 Ga0496113_0174451 3300048916 Bacteria 1703
203 Ga0496113_1120674 3300048916 Bacteria 617
204 Ga0496114_0036002 3300048917 Bacteria 4090
205 Ga0496114_0320501 3300048917 Bacteria 1369
206 Ga0496114_0428656 3300048917 Bacteria 1171
207 Ga0496115_0102704 3300048918 Bacteria 2345
208 Ga0496115_0134292 3300048918 Bacteria 2040
209 Ga0496115_0489030 3300048918 Bacteria 990
210 Ga0496115_0643960 3300048918 Bacteria 838
211 Ga0496115_1138922 3300048918 Bacteria 589
212 Ga0496116_0181844 3300048919 Bacteria 1125
213 Ga0496117_0000070 3300048920 Bacteria 245027
214 Ga0496117_0000823 3300048920 Bacteria 48067
215 Ga0496117_0009501 3300048920 Bacteria 9036
216 Ga0496117_0013867 3300048920 Bacteria 6988
217 Ga0496117_0015984 3300048920 Bacteria 6357
218 Ga0496117_0038218 3300048920 Bacteria 3564
219 Ga0496117_0171733 3300048920 Bacteria 1257
220 Ga0496118_0014687 3300048921 Bacteria 7317
221 Ga0496118_0017619 3300048921 Bacteria 6488
222 Ga0496118_0049884 3300048921 Bacteria 3218
223 Ga0496118_0055285 3300048921 Bacteria 2997
224 Ga0496118_0359046 3300048921 Bacteria 773
225 Ga0496118_0367837 3300048921 Bacteria 760
226 Ga0496119_0000817 3300048922 Bacteria 41568
227 Ga0496119_0005000 3300048922 Bacteria 12940
228 Ga0496119_0007035 3300048922 Bacteria 10237
229 Ga0496119_0034308 3300048922 Bacteria 3346
230 Ga0496119_0044145 3300048922 Bacteria 2809
231 Ga0496119_0049025 3300048922 Bacteria 2614
232 Ga0496119_0081458 3300048922 Bacteria 1864
233 Ga0496119_0284917 3300048922 Bacteria 820
234 Ga0496119_0482482 3300048922 Bacteria 579
235 Ga0496120_0001681 3300048923 Bacteria 25390
236 Ga0496120_0002074 3300048923 Bacteria 21539
237 Ga0496120_0041830 3300048923 Bacteria 2680
238 Ga0496121_0447142 3300048924 Bacteria 834
239 Ga0496122_0000022 3300048925 Bacteria 388704
240 Ga0496122_0000814 3300048925 Bacteria 59717
241 Ga0496122_0006310 3300048925 Bacteria 13664
242 Ga0496122_0006599 3300048925 Bacteria 13243
243 Ga0496122_0015336 3300048925 Bacteria 7332
244 Ga0496122_0065251 3300048925 Bacteria 2641
245 Ga0496122_0132280 3300048925 Bacteria 1582
246 Ga0496122_0208419 3300048925 Bacteria 1135
247 Ga0496123_0000009 3300048926 Bacteria 509486
248 Ga0496123_0000016 3300048926 Bacteria 424330
249 Ga0496123_0003217 3300048926 Bacteria 18606
250 Ga0496123_0141230 3300048926 Bacteria 1316
251 Ga0496124_0002146 3300048927 Bacteria 26489
252 Ga0496124_0003499 3300048927 Bacteria 19129
253 Ga0496124_0003966 3300048927 Bacteria 17645
254 Ga0496124_0546965 3300048927 Bacteria 765
255 Ga0496125_0008047 3300048928 Bacteria 11130
256 Ga0496125_0040352 3300048928 Bacteria 4006
257 Ga0496125_0050689 3300048928 Bacteria 3433
258 Ga0496125_0064155 3300048928 Bacteria 2921
259 Ga0496125_0078226 3300048928 Bacteria 2543
260 Ga0496125_0259439 3300048928 Bacteria 1090
261 Ga0496125_0630216 3300048928 Bacteria 580
262 Ga0496126_0016547 3300048929 Bacteria 7371
263 Ga0496126_0017372 3300048929 Bacteria 7169
264 Ga0496126_0031926 3300048929 Bacteria 4968
265 Ga0496126_0043294 3300048929 Bacteria 4153
266 Ga0496126_0047992 3300048929 Bacteria 3907
267 Ga0496126_0054594 3300048929 Bacteria 3617
268 Ga0496126_0065054 3300048929 Bacteria 3264
269 Ga0496126_0225858 3300048929 Bacteria 1570
270 Ga0496126_0433116 3300048929 Bacteria 1061
271 Ga0501031_0025283 3300049568 Bacteria 3874
272 Ga0501032_0116387 3300049569 Bacteria 1767
273 Ga0501033_0028850 3300049570 Bacteria 4169
274 Ga0501033_0030477 3300049570 Bacteria 4054
275 Ga0501033_0051228 3300049570 Bacteria 3060
276 Ga0501033_0058709 3300049570 Bacteria 2841
277 Ga0501033_0682624 3300049570 Bacteria 700
278 Ga0501033_0775766 3300049570 Bacteria 649
279 Ga0501034_0025846 3300049571 Bacteria 5980
280 Ga0501034_0068410 3300049571 Bacteria 3561
281 Ga0501034_0089253 3300049571 Bacteria 3080
282 Ga0501034_0416761 3300049571 Bacteria 1264
283 Ga0501034_0977187 3300049571 Bacteria 731
284 Ga0501036_0069469 3300049572 Bacteria 2979
285 Ga0501037_0006093 3300049573 Bacteria 8814
286 Ga0501037_0231861 3300049573 Bacteria 1296
287 Ga0501037_0278348 3300049573 Bacteria 1166
288 Ga0501037_0303051 3300049573 Bacteria 1109
289 Ga0501038_0018602 3300049574 Bacteria 6275
290 Ga0501038_0021407 3300049574 Bacteria 5804
291 Ga0501038_0040920 3300049574 Bacteria 4044
292 Ga0501038_0054617 3300049574 Bacteria 3435
293 Ga0501039_0018880 3300049575 Bacteria 5294
294 Ga0501039_0104086 3300049575 Bacteria 2216
295 Ga0501039_0796089 3300049575 Bacteria 738
296 Ga0501039_1195402 3300049575 Bacteria 588
297 Ga0501042_0001194 3300049578 Bacteria 15042
298 Ga0501043_0070573 3300049579 Bacteria 2744
299 Ga0501046_0013427 3300049580 Bacteria 6934
300 Ga0501046_0017044 3300049580 Bacteria 6072
301 Ga0501047_0045030 3300049581 Bacteria 4265
302 Ga0501047_0047883 3300049581 Bacteria 4129
303 Ga0501047_0083327 3300049581 Bacteria 3073
304 Ga0501070_0001615 3300049586 Bacteria 19994
305 Ga0501070_0001882 3300049586 Bacteria 18547
306 Ga0501070_0009122 3300049586 Bacteria 8389
307 Ga0501070_0054406 3300049586 Bacteria 3319
308 Ga0501070_0152356 3300049586 Bacteria 1907
309 Ga0501071_0002104 3300049587 Bacteria 11944
310 Ga0501073_0175056 3300049589 Bacteria 1485
311 Ga0501079_0483037 3300049741 Bacteria 974
312 Ga0501083_0000076 3300049744 Bacteria 65990
313 Ga0501083_0078835 3300049744 Bacteria 2184
314 Ga0501083_0089429 3300049744 Bacteria 2035
315 Ga0501035_0026444 3300049822 Bacteria 5308
316 Ga0501035_0038236 3300049822 Bacteria 4345
317 Ga0501035_0975076 3300049822 Bacteria 668
318 Ga0501044_0071216 3300049823 Bacteria 3535
319 Ga0501044_0137108 3300049823 Bacteria 2438
320 Ga0501044_0433506 3300049823 Bacteria 1223
321 Ga0501044_0965659 3300049823 Bacteria 725
322 Ga0501045_0026394 3300049824 Bacteria 4178
323 nmdc:mga03n38_298462_c1 3300050490 Bacteria 864
324 nmdc:mga00v17_202204_c1 3300050491 Bacteria 1284
325 nmdc:mga00v17_22738_c1 3300050491 Bacteria 3621
326 nmdc:mga00v17_25309_c1 3300050491 Bacteria 3449
327 nmdc:mga00v17_33107_c1 3300050491 Bacteria 3060
328 nmdc:mga00v17_335875_c1 3300050491 Bacteria 982
329 nmdc:mga0yw44_441536_c1 3300050492 Bacteria 881
330 nmdc:mga06z11_218727_c1 3300050494 Bacteria 1112
331 nmdc:mga06z11_77807_c1 3300050494 Bacteria 1772
332 nmdc:mga04h51_255250_c1 3300050495 Bacteria 704
333 nmdc:mga07m45_282128_c1 3300050496 Bacteria 966
334 nmdc:mga0sz30_1437_c2 3300050516 Bacteria 6774
335 nmdc:mga0sz30_51993_c1 3300050516 Bacteria 1739
336 Ga0500635_0000108 3300053080 Bacteria 49899
337 Ga0500556_0000020 3300053104 Bacteria 185929
338 Ga0500655_021150 3300053133 Bacteria 1219
339 Ga0500559_0000132 3300053136 Bacteria 57521
340 Ga0500559_0036456 3300053136 Bacteria 2127
341 Ga0500568_0000012 3300053139 Bacteria 225711
342 Ga0500573_0000052 3300053140 Bacteria 94687
343 Ga0500573_0009329 3300053140 Bacteria 5438
344 Ga0500577_0012849 3300053142 Bacteria 2542
345 Ga0501082_0644997 3300060353 Bacteria 927
346 Ga0501082_0889119 3300060353 Bacteria 779
347 2809226211 2808606447 Bacteria 3572005
348 2588107922 2585428157 Bacteria 3018951
349 2643734714 2643221542 Bacteria 3563959
350 2643753686 2643221546 Bacteria 2910897
351 2643783621 2643221553 Bacteria 3544260
352 2643847746 2643221566 Bacteria 3460379
353 2643876490 2643221572 Bacteria 3614809
354 2643888060 2643221575 Bacteria 4022601
355 2643994774 2643221597 Bacteria 3347721
356 2644096354 2643221616 Bacteria 4066575
357 2644112045 2643221619 Bacteria 4158469
358 2644172879 2643221630 Bacteria 3601215
359 2644182342 2643221632 Bacteria 3406696
360 2644277854 2643221649 Bacteria 3867359
361 2644383545 2643221669 Bacteria 3611286
362 2723643200 2721755702 Bacteria 4373124
363 2747952963 2747842429 Bacteria 3914386
364 2758224905 2757320536 Bacteria 3629334
365 2774378956 2773857758 Bacteria 3592392
366 2774400816 2773857763 Bacteria 4180068
367 2808628813 2808606306 Bacteria 3608896
368 2812322050 2811994872 Bacteria 4121241
369 2821268956 2821268502 Bacteria 3750023
370 2833709849 2833709550 Bacteria 4008291
371 2844843417 2844841374 Bacteria 3917147
372 2852632470 2852632344 Bacteria 3463163
373 2852648430 2852646457 Bacteria 3408613
374 2852666032 2852663356 Bacteria 4090475
375 2852678551 2852677369 Bacteria 3768884
376 2857724549 2857723135 Bacteria 4217853
377 2857733317 2857729791 Bacteria 4040535
378 2870629355 2870628048 Bacteria 3696012
379 2884766442 2884763398 Bacteria 4091164
380 2895660665 2895660088 Bacteria 3782833
381 2904510418 2904509784 Bacteria 3520416
382 2908678364 2908678064 Bacteria 3482747
383 2919055395 2919055335 Bacteria 3875751
384 2919070688 2919069694 Bacteria 3622919
385 2919397812 2919395869 Bacteria 3704152
386 2919525472 2919523602 Bacteria 3788128
387 2928121511 2928121344 Bacteria 3972376
388 2928153554 2928153084 Bacteria 4020257
389 2935412067 2935409751 Bacteria 4179611
390 2939659492 2939657138 Bacteria 3740283
391 2939662673 2939660829 Bacteria 3784848
392 2945970708 2945968032 Bacteria 4111363
393 2946034859 2946033335 Bacteria 3835514
394 2946043048 2946041624 Bacteria 4191385
395 2946081920 2946080515 Bacteria 4310960
396 2964328417 2964326757 Bacteria 3290868
397 2966926444 2966924647 Bacteria 3268643
398 2974294906 2974294766 Bacteria 3767688
399 2974325293 2974324384 Bacteria 3750535
400 2977230261 2977228692 Bacteria 3450105
401 2977239063 2977236895 Bacteria 3569373
402 2977265460 2977264416 Bacteria 3750737
403 2984543152 2984542743 Bacteria 3569378
404 2995728333 2995726249 Bacteria 3470435
405 8004183427 8004182704 Bacteria 3391155
406 8004213174 8004212874 Bacteria 2861420
407 8016255238 8016254467 Bacteria 3797036
408 8045832139 8045830549 Bacteria 4444727
409 JGI24737J22298_10014430
410 JGI24735J21928_10013419
411 JGI25154J39366_1000583
412 JGI25164J39214_1001692
413 JGI25165J46597_1000269
414 rootH1_10087931
415 Ga0006562J51391_1193684
416 Ga0006562J51391_1193685
417 Ga0055539_1000090
418 Ga0055533_1000001
419 Ga0055532_1008061
420 Ga0055525_1000126
421 Ga0055527_1000064
422 Ga0055542_1000023
423 Ga0055529_1000050
424 Ga0055529_1023164
425 Ga0065714_10016783
426 Ga0070658_10032547
427 Ga0070660_100141865
428 Ga0070659_100367799
429 Ga0070714_100412629
430 Ga0068853_100057965
431 Ga0070665_100123244
432 Ga0070664_100799185
433 Ga0075365_10088244
434 Ga0075368_10098866
435 Ga0075364_10003400
436 Ga0075364_10052725
437 Ga0075364_10211061
438 Ga0075364_10257156
439 Ga0075367_10174568
440 Ga0075369_10010891
441 Ga0075369_10013418
442 Ga0075369_10239114
443 Ga0075370_10131832
444 Ga0105244_10018680
445 Ga0105244_10058384
446 Ga0105237_10070287
447 Ga0157370_10267141
448 Ga0157370_10293729
449 Ga0157370_10367856
450 Ga0157369_10024848
451 Ga0157369_10111107
452 Ga0157369_10241071
453 Ga0157369_10739413
454 Ga0171462_1001
455 Ga0163162_10118835
456 Ga0157372_10109028
457 Ga0157372_10121293
458 Ga0157372_10240471
459 Ga0157372_11281465
460 Ga0157375_10691187
461 Ga0157375_11019999
462 Ga0157375_12749930
463 Ga0163163_11559959
464 Ga0163161_10086799
465 Ga0197907_10669710
466 Ga0206354_10426408
467 Ga0206353_11263019
468 Ga0206353_11519977
469 Ga0224712_10013001
470 Ga0209566_100066
471 Ga0209674_100001
472 Ga0209672_100116
473 Ga0209147_105105
474 Ga0209563_100001
475 Ga0209563_105220
476 Ga0207427_100054
477 Ga0209437_104104
478 Ga0209258_102773
479 Ga0209646_1000041
480 Ga0209677_100001
481 Ga0209677_102888
482 Ga0209148_1000240
483 Ga0209233_1000001
484 Ga0209455_1000197
485 Ga0209455_1000681
486 Ga0207655_1024481
487 Ga0207647_10033043
488 Ga0207647_10308500
489 Ga0207671_10081003
490 Ga0207657_10144192
491 Ga0207650_10657675
492 Ga0207664_10350838
493 Ga0207679_10495107
494 Ga0209813_10165033
495 Ga0268266_10170911
496 Ga0307408_100307392
497 Ga0307514_10008865
498 Ga0307405_10109406
499 Ga0307405_10357623
500 Ga0307413_10284418
501 Ga0307406_10004625
502 Ga0307406_10639420
503 Ga0307406_10744112
504 Ga0307407_10386947
505 Ga0307407_10497904
506 Ga0307412_10107998
507 Ga0307412_10332522
508 Ga0307412_10346071
509 Ga0307412_10403011
510 Ga0307409_100227005
511 Ga0307409_100518859
512 Ga0307409_101262957
513 Ga0307416_100624223
514 Ga0307416_100700351
515 Ga0307414_10102763
516 Ga0307414_10138642
517 Ga0307414_10570677
518 Ga0307414_10775161
519 Ga0307414_11030742
520 Ga0307414_11034530
521 Ga0395899_0021959
522 Ga0395899_0066486
523 Ga0395900_0006363
524 Ga0395900_0221038
525 Ga0395898_0000060
526 Ga0395898_0575453
527 Ga0395901_0271327
528 Ga0395901_1053430
529 Ga0439465_0009501
530 Ga0439465_0138662
531 Ga0451789_0428685
532 Ga0451789_0583784
533 Ga0451791_1825207
534 Ga0451793_1295235
535 Ga0451793_1405135
536 Ga0451797_0449651
537 Ga0451797_0702840
538 Ga0451797_0782388
539 Ga0451837_0115120
540 Ga0451841_0646979
541 Ga0451849_0307891
542 Ga0451843_0087126
543 Ga0451853_0116608
544 Ga0451853_1929312
545 Ga0451853_2648805
546 Ga0466972_0012956
547 Ga0466965_0000003
548 Ga0466965_0024011
549 Ga0466965_0349677
550 Ga0466966_0040063
551 Ga0466966_0163760
552 Ga0466961_0026029
553 Ga0466961_0116646
554 Ga0466971_0097020
555 Ga0466968_0015706
556 Ga0466970_0000001
557 Ga0466970_0002959
558 Ga0466970_0030407
559 Ga0466970_0042721
560 Ga0466970_0067470
561 Ga0466957_0018878
562 Ga0466960_0019953
563 Ga0466960_0141600
564 Ga0466960_0313388
565 Ga0466960_0326225
566 Ga0466959_0006693
567 Ga0466959_0088679
568 Ga0466959_0293268
569 Ga0466959_0423139
570 Ga0466967_1117980
571 Ga0495638_0463508
572 Ga0495620_0074209
573 Ga0495633_0163480
574 Ga0495633_0429111
575 Ga0495656_0435423
576 Ga0495672_0012519
577 Ga0495686_0071097
578 Ga0495686_0222865
579 Ga0495615_0097746
580 Ga0496100_0004294
581 Ga0496100_0071415
582 Ga0496101_0145840
583 Ga0496101_0536273
584 Ga0496102_0028824
585 Ga0496103_0011502
586 Ga0496103_0130142
587 Ga0496104_0064110
588 Ga0496104_0101230
589 Ga0496104_0497932
590 Ga0496104_0505138
591 Ga0496104_0530334
592 Ga0496104_1251160
593 Ga0496105_0095269
594 Ga0496105_0149002
595 Ga0496105_0205320
596 Ga0496105_0205661
597 Ga0496105_0395616
598 Ga0496105_0733853
599 Ga0496107_0050676
600 Ga0496108_0030968
601 Ga0496108_0038406
602 Ga0496109_0150724
603 Ga0496109_0270318
604 Ga0496110_0119485
605 Ga0496111_0142970
606 Ga0496111_0145419
607 Ga0496111_0802246
608 Ga0496112_0518810
609 Ga0496112_0803868
610 Ga0496113_0174451
611 Ga0496113_1120674
612 Ga0496114_0036002
613 Ga0496114_0320501
614 Ga0496114_0428656
615 Ga0496115_0102704
616 Ga0496115_0134292
617 Ga0496115_0489030
618 Ga0496115_0643960
619 Ga0496115_1138922
620 Ga0496116_0181844
621 Ga0496117_0000070
622 Ga0496117_0000823
623 Ga0496117_0009501
624 Ga0496117_0013867
625 Ga0496117_0015984
626 Ga0496117_0038218
627 Ga0496117_0171733
628 Ga0496118_0014687
629 Ga0496118_0017619
630 Ga0496118_0049884
631 Ga0496118_0055285
632 Ga0496118_0359046
633 Ga0496118_0367837
634 Ga0496119_0000817
635 Ga0496119_0005000
636 Ga0496119_0007035
637 Ga0496119_0034308
638 Ga0496119_0044145
639 Ga0496119_0049025
640 Ga0496119_0081458
641 Ga0496119_0284917
642 Ga0496119_0482482
643 Ga0496120_0001681
644 Ga0496120_0002074
645 Ga0496120_0041830
646 Ga0496121_0447142
647 Ga0496122_0000022
648 Ga0496122_0000814
649 Ga0496122_0006310
650 Ga0496122_0006599
651 Ga0496122_0015336
652 Ga0496122_0065251
653 Ga0496122_0132280
654 Ga0496122_0208419
655 Ga0496123_0000009
656 Ga0496123_0000016
657 Ga0496123_0003217
658 Ga0496123_0141230
659 Ga0496124_0002146
660 Ga0496124_0003499
661 Ga0496124_0003966
662 Ga0496124_0546965
663 Ga0496125_0008047
664 Ga0496125_0040352
665 Ga0496125_0050689
666 Ga0496125_0064155
667 Ga0496125_0078226
668 Ga0496125_0259439
669 Ga0496125_0630216
670 Ga0496126_0016547
671 Ga0496126_0017372
672 Ga0496126_0031926
673 Ga0496126_0043294
674 Ga0496126_0047992
675 Ga0496126_0054594
676 Ga0496126_0065054
677 Ga0496126_0225858
678 Ga0496126_0433116
679 Ga0501031_0025283
680 Ga0501032_0116387
681 Ga0501033_0028850
682 Ga0501033_0030477
683 Ga0501033_0051228
684 Ga0501033_0058709
685 Ga0501033_0682624
686 Ga0501033_0775766
687 Ga0501034_0025846
688 Ga0501034_0068410
689 Ga0501034_0089253
690 Ga0501034_0416761
691 Ga0501034_0977187
692 Ga0501036_0069469
693 Ga0501037_0006093
694 Ga0501037_0231861
695 Ga0501037_0278348
696 Ga0501037_0303051
697 Ga0501038_0018602
698 Ga0501038_0021407
699 Ga0501038_0040920
700 Ga0501038_0054617
701 Ga0501039_0018880
702 Ga0501039_0104086
703 Ga0501039_0796089
704 Ga0501039_1195402
705 Ga0501042_0001194
706 Ga0501043_0070573
707 Ga0501046_0013427
708 Ga0501046_0017044
709 Ga0501047_0045030
710 Ga0501047_0047883
711 Ga0501047_0083327
712 Ga0501070_0001615
713 Ga0501070_0001882
714 Ga0501070_0009122
715 Ga0501070_0054406
716 Ga0501070_0152356
717 Ga0501071_0002104
718 Ga0501073_0175056
719 Ga0501079_0483037
720 Ga0501083_0000076
721 Ga0501083_0078835
722 Ga0501083_0089429
723 Ga0501035_0026444
724 Ga0501035_0038236
725 Ga0501035_0975076
726 Ga0501044_0071216
727 Ga0501044_0137108
728 Ga0501044_0433506
729 Ga0501044_0965659
730 Ga0501045_0026394
731 nmdc:mga03n38_298462_c1
732 nmdc:mga00v17_202204_c1
733 nmdc:mga00v17_22738_c1
734 nmdc:mga00v17_25309_c1
735 nmdc:mga00v17_33107_c1
736 nmdc:mga00v17_335875_c1
737 nmdc:mga0yw44_441536_c1
738 nmdc:mga06z11_218727_c1
739 nmdc:mga06z11_77807_c1
740 nmdc:mga04h51_255250_c1
741 nmdc:mga07m45_282128_c1
742 nmdc:mga0sz30_1437_c2
743 nmdc:mga0sz30_51993_c1
744 Ga0500635_0000108
745 Ga0500556_0000020
746 Ga0500655_021150
747 Ga0500559_0000132
748 Ga0500559_0036456
749 Ga0500568_0000012
750 Ga0500573_0000052
751 Ga0500573_0009329
752 Ga0500577_0012849
753 Ga0501082_0644997
754 Ga0501082_0889119
755 2809226211
756 2588107922
757 2643734714
758 2643753686
759 2643783621
760 2643847746
761 2643876490
762 2643888060
763 2643994774
764 2644096354
765 2644112045
766 2644172879
767 2644182342
768 2644277854
769 2644383545
770 2723643200
771 2747952963
772 2758224905
773 2774378956
774 2774400816
775 2808628813
776 2812322050
777 2821268956
778 2833709849
779 2844843417
780 2852632470
781 2852648430
782 2852666032
783 2852678551
784 2857724549
785 2857733317
786 2870629355
787 2884766442
788 2895660665
789 2904510418
790 2908678364
791 2919055395
792 2919070688
793 2919397812
794 2919525472
795 2928121511
796 2928153554
797 2935412067
798 2939659492
799 2939662673
800 2945970708
801 2946034859
802 2946043048
803 2946081920
804 2964328417
805 2966926444
806 2974294906
807 2974325293
808 2977230261
809 2977239063
810 2977265460
811 2984543152
812 2995728333
813 8004183427
814 8004213174
815 8016255238
816 8045832139

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10263

SprT-like

SprT-like family

2

99

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jix-assembly1.cif.gz_B crystal structure of the metallopeptidase zymogen of methanocaldococcus jannaschii jannalysin 0.8116 7 96
4qhj-assembly1.cif.gz_B crystal structure of methanocaldococcus jannaschii selecase mutant i100f+h107f 0.7895 1 90
4qhh-assembly1.cif.gz_A crystal structure of methanocaldococcus jannaschii tetrameric selecase 0.7744 2 71
4qhi-assembly2.cif.gz_C crystal structure of methanocaldococcus jannaschii selecase mutant r36w 0.7629 4 90
4jix-assembly1.cif.gz_A crystal structure of the metallopeptidase zymogen of methanocaldococcus jannaschii jannalysin 0.7546 1 96
ID Description Score Start End Superfamily
4jixB00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8116 7 96 3.30.2010.10
af_Q9H040_45_153_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7923 12 98 3.30.2010.10
4qhiC00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7629 4 90 3.30.2010.10
af_Q2FWJ6_6_112_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7619 8 100 3.30.2010.10
4jiuA00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.731 5 96 3.30.2010.10
ID Description Score Start End GO Terms
AF-U2T4A1-F1-model_v4 SprT-like domain-containing protein 1.008 1 87 GO:0033554
AF-U2T4A1-F1-model_v4 SprT-like domain-containing protein 0.9851 1 87 GO:0033554
AF-A0A2W0DS13-F1-model_v4 M48 family peptidase 0.9838 1 67 GO:0033554
AF-A0A1G8CW72-F1-model_v4 SprT-like family protein 0.9726 5 91 GO:0033554
AF-A0A850DZ94-F1-model_v4 SprT domain-containing protein 0.9699 1 152 GO:0033554

Map