F436882

General Info

Members Datasets Scaffolds Average Seq Length
409 167 818 346

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10034697|JGI24737J22298_100346972
Length 396
Sequence MRRGTSSETGHWRFQLNGCSESGKFSRIADLPTRCDSNPVSEGSSVARLKRIFRIAIMGFAALSSIMAAPAAAEKAPQRIVAVGDLHGDYDAWQAIARNAGIIDASGHWTGGKTVLVQMGDVADRWADSLKIIRSLQQLQKEAPRKGGKVIVILGNHEAMNLLGDDRYTTPGEYSAFVDGQSAARRDRVYLANRVQLEAAARAQQPKITPEQVRAEWMAQHPLGWVEHRLAWGPSGEIGKWASANPAIVKIDGTLFAHGGLSAEYAKQPLEVVNKRVATAMAAADDNPTSVLNDPLGPLWYRGLVMKDSDADAERATAKPPAPLLTGDQELNAVLAAYGGERLIIAHTPSLKGIEITANGRLARIDTGISRYYGGPLTWLEILGDRMTPHTLARSP

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
138 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
139 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
167 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.24
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 6.6
Rhizosphere 92.18
Stem 0
Stem Tuber 0
Unclassified 7.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10034697 3300001990 Bacteria 1564
2 JGI24737J22298_10000786 3300001990 Bacteria 11230
3 JGI24735J21928_10026519 3300002067 Bacteria 1741
4 rootH1_10317325 3300003323 Unclassified 1585
5 Ga0070658_10020760 3300005327 Bacteria 5263
6 Ga0070658_10030616 3300005327 Bacteria 4323
7 Ga0070658_10037422 3300005327 Bacteria 3912
8 Ga0070683_100002352 3300005329 Bacteria 15007
9 Ga0070683_100004568 3300005329 Bacteria 11422
10 Ga0070683_100120603 3300005329 Bacteria 2477
11 Ga0070690_100001800 3300005330 Bacteria 11342
12 Ga0070670_100049252 3300005331 Bacteria 3623
13 Ga0070670_100099717 3300005331 Bacteria 2499
14 Ga0070666_10001045 3300005335 Bacteria 16951
15 Ga0070666_10074385 3300005335 Bacteria 2315
16 Ga0070680_100002086 3300005336 Bacteria 14765
17 Ga0070680_100039200 3300005336 Bacteria 3834
18 Ga0070680_100233327 3300005336 Bacteria 1554
19 Ga0070682_100038128 3300005337 Bacteria 2946
20 Ga0070682_100096508 3300005337 Unclassified 1944
21 Ga0068868_100006385 3300005338 Bacteria 8341
22 Ga0068868_100067055 3300005338 Bacteria 2855
23 Ga0070660_100002163 3300005339 Bacteria 13537
24 Ga0070660_100003986 3300005339 Bacteria 10200
25 Ga0070660_100006075 3300005339 Bacteria 8348
26 Ga0070660_100018268 3300005339 Bacteria 5122
27 Ga0070660_100044516 3300005339 Bacteria 3396
28 Ga0070691_10000969 3300005341 Bacteria 11717
29 Ga0070661_100012941 3300005344 Bacteria 5846
30 Ga0070661_100277017 3300005344 Unclassified 1300
31 Ga0070668_100124137 3300005347 Bacteria 2067
32 Ga0070669_100092554 3300005353 Bacteria 2269
33 Ga0070669_100270527 3300005353 Unclassified 1358
34 Ga0070671_100005149 3300005355 Bacteria 10406
35 Ga0070671_100030133 3300005355 Bacteria 4477
36 Ga0070671_100137342 3300005355 Bacteria 2061
37 Ga0070674_100010535 3300005356 Bacteria 5595
38 Ga0070673_100034031 3300005364 Bacteria 3852
39 Ga0070659_100004083 3300005366 Bacteria 10401
40 Ga0070659_100008483 3300005366 Bacteria 7510
41 Ga0070659_100011667 3300005366 Bacteria 6503
42 Ga0070659_100022239 3300005366 Bacteria 4838
43 Ga0070667_100000857 3300005367 Bacteria 28344
44 Ga0070667_100003694 3300005367 Bacteria 13020
45 Ga0070667_100019293 3300005367 Bacteria 5657
46 Ga0070667_100139750 3300005367 Bacteria 2120
47 Ga0070714_100030270 3300005435 Bacteria 4504
48 Ga0070713_100151618 3300005436 Bacteria 2062
49 Ga0070663_100009396 3300005455 Bacteria 6052
50 Ga0070663_100011731 3300005455 Bacteria 5514
51 Ga0070663_100036318 3300005455 Bacteria 3423
52 Ga0070663_100126127 3300005455 Unclassified 1939
53 Ga0070663_100237402 3300005455 Unclassified 1438
54 Ga0070678_100002718 3300005456 Bacteria 9765
55 Ga0070662_100002626 3300005457 Bacteria 11084
56 Ga0070662_100015597 3300005457 Bacteria 5093
57 Ga0070662_100017621 3300005457 Bacteria 4819
58 Ga0070662_100041565 3300005457 Bacteria 3280
59 Ga0070662_100236665 3300005457 Bacteria 1463
60 Ga0070681_10012983 3300005458 Bacteria 8271
61 Ga0068867_100033136 3300005459 Bacteria 3739
62 Ga0068867_100170329 3300005459 Unclassified 1724
63 Ga0070679_100013744 3300005530 Bacteria 7755
64 Ga0070679_100044301 3300005530 Bacteria 4433
65 Ga0070679_100094004 3300005530 Bacteria 2985
66 Ga0070679_100116619 3300005530 Unclassified 2655
67 Ga0070679_100122582 3300005530 Bacteria 2583
68 Ga0070684_100001405 3300005535 Bacteria 17302
69 Ga0068853_100001282 3300005539 Bacteria 18015
70 Ga0068853_100005745 3300005539 Bacteria 9766
71 Ga0068853_100034106 3300005539 Bacteria 4319
72 Ga0068853_100056268 3300005539 Bacteria 3391
73 Ga0068853_100230403 3300005539 Bacteria 1694
74 Ga0070672_100004776 3300005543 Bacteria 8892
75 Ga0070672_100093505 3300005543 Bacteria 2429
76 Ga0070672_100196084 3300005543 Bacteria 1687
77 Ga0070686_100033334 3300005544 Bacteria 3164
78 Ga0068855_100010658 3300005563 Bacteria 11088
79 Ga0068855_100016953 3300005563 Bacteria 8760
80 Ga0070664_100004692 3300005564 Bacteria 10962
81 Ga0070664_100024717 3300005564 Bacteria 4972
82 Ga0070664_100028823 3300005564 Bacteria 4623
83 Ga0070664_100123252 3300005564 Bacteria 2271
84 Ga0070664_100220215 3300005564 Bacteria 1698
85 Ga0070664_100238694 3300005564 Bacteria 1631
86 Ga0070664_100319908 3300005564 Bacteria 1405
87 Ga0068857_100007537 3300005577 Bacteria 9365
88 Ga0068857_100014742 3300005577 Bacteria 6819
89 Ga0068854_100005540 3300005578 Bacteria 7977
90 Ga0068854_100014399 3300005578 Bacteria 5214
91 Ga0068854_100021893 3300005578 Bacteria 4344
92 Ga0068854_100023283 3300005578 Bacteria 4229
93 Ga0068854_100062371 3300005578 Bacteria 2702
94 Ga0068854_100104805 3300005578 Bacteria 2125
95 Ga0068856_100032234 3300005614 Bacteria 5130
96 Ga0068856_100057879 3300005614 Bacteria 3827
97 Ga0068856_100409091 3300005614 Unclassified 1376
98 Ga0068859_100006190 3300005617 Bacteria 12161
99 Ga0068864_100003827 3300005618 Bacteria 12403
100 Ga0068864_100032976 3300005618 Bacteria 4401
101 Ga0068864_100060139 3300005618 Bacteria 3289
102 Ga0068861_100105968 3300005719 Bacteria 2245
103 Ga0068851_10021551 3300005834 Bacteria 3129
104 Ga0068863_100015484 3300005841 Bacteria 7330
105 Ga0068863_100026544 3300005841 Bacteria 5524
106 Ga0068863_100111724 3300005841 Bacteria 2602
107 Ga0068858_100005035 3300005842 Bacteria 12951
108 Ga0068858_100020801 3300005842 Bacteria 6133
109 Ga0068860_100024573 3300005843 Bacteria 5819
110 Ga0068860_100127582 3300005843 Bacteria 2439
111 Ga0081539_10004451 3300005985 Bacteria 15469
112 Ga0070717_10021348 3300006028 Bacteria 5102
113 Ga0070717_10295102 3300006028 Unclassified 1440
114 Ga0070712_100096101 3300006175 Bacteria 2181
115 Ga0097621_100034871 3300006237 Bacteria 4016
116 Ga0068871_100016174 3300006358 Bacteria 5609
117 Ga0068865_100005217 3300006881 Bacteria 7857
118 Ga0068865_100065318 3300006881 Bacteria 2563
119 Ga0097620_100006190 3300006931 Bacteria 12161
120 Ga0105240_10011074 3300009093 Bacteria 12609
121 Ga0105240_10016018 3300009093 Bacteria 10163
122 Ga0105240_10090105 3300009093 Bacteria 3750
123 Ga0105247_10073757 3300009101 Bacteria 2139
124 Ga0105242_10182698 3300009176 Bacteria 1851
125 Ga0105248_10001194 3300009177 Bacteria 29026
126 Ga0105248_10031022 3300009177 Bacteria 5972
127 Ga0105248_10072006 3300009177 Bacteria 3884
128 Ga0105237_10583937 3300009545 Bacteria 1124
129 Ga0105238_10005470 3300009551 Bacteria 12559
130 Ga0105238_10012233 3300009551 Bacteria 8654
131 Ga0105238_10425720 3300009551 Bacteria 1323
132 Ga0105249_10199227 3300009553 Bacteria 1959
133 Ga0105239_10180217 3300010375 Bacteria 2364
134 Ga0105239_10236919 3300010375 Bacteria 2048
135 Ga0157373_10004808 3300013100 Bacteria 10162
136 Ga0157371_10052773 3300013102 Bacteria 2887
137 Ga0157371_10061482 3300013102 Bacteria 2663
138 Ga0157370_10006925 3300013104 Bacteria 12393
139 Ga0157370_10010165 3300013104 Bacteria 9935
140 Ga0157370_10012674 3300013104 Bacteria 8729
141 Ga0157370_10088778 3300013104 Bacteria 2904
142 Ga0157370_10312708 3300013104 Unclassified 1449
143 Ga0157369_10204850 3300013105 Bacteria 2069
144 Ga0157369_10297259 3300013105 Bacteria 1680
145 Ga0157374_10055435 3300013296 Bacteria 3700
146 Ga0157378_10280604 3300013297 Bacteria 1606
147 Ga0163162_10031636 3300013306 Bacteria 5249
148 Ga0163162_10075864 3300013306 Bacteria 3423
149 Ga0163162_10086824 3300013306 Bacteria 3206
150 Ga0157372_10007229 3300013307 Bacteria 11822
151 Ga0157372_10105718 3300013307 Bacteria 3220
152 Ga0157372_10162824 3300013307 Bacteria 2579
153 Ga0157375_10406184 3300013308 Bacteria 1528
154 Ga0163163_10008334 3300014325 Bacteria 9204
155 Ga0157376_10005869 3300014969 Bacteria 8614
156 Ga0163161_10077928 3300017792 Bacteria 2435
157 Ga0206353_11875877 3300020082 Bacteria 3497
158 Ga0213876_10079735 3300021384 Bacteria 1730
159 Ga0207656_10041083 3300025321 Bacteria 1964
160 Ga0207710_10026854 3300025900 Bacteria 2489
161 Ga0207688_10005110 3300025901 Bacteria 7131
162 Ga0207680_10001428 3300025903 Bacteria 11323
163 Ga0207647_10001961 3300025904 Bacteria 15715
164 Ga0207647_10003055 3300025904 Bacteria 12586
165 Ga0207647_10004534 3300025904 Bacteria 10298
166 Ga0207647_10011112 3300025904 Bacteria 6325
167 Ga0207647_10036453 3300025904 Bacteria 3124
168 Ga0207705_10000330 3300025909 Bacteria 43029
169 Ga0207705_10003428 3300025909 Bacteria 12064
170 Ga0207705_10019517 3300025909 Bacteria 4847
171 Ga0207705_10046166 3300025909 Bacteria 3130
172 Ga0207695_10006328 3300025913 Bacteria 15402
173 Ga0207695_10182651 3300025913 Unclassified 2018
174 Ga0207671_10030099 3300025914 Bacteria 4049
175 Ga0207693_10105845 3300025915 Bacteria 2206
176 Ga0207660_10007369 3300025917 Bacteria 7119
177 Ga0207657_10003186 3300025919 Bacteria 17549
178 Ga0207657_10006777 3300025919 Bacteria 11829
179 Ga0207657_10008319 3300025919 Bacteria 10557
180 Ga0207657_10012994 3300025919 Bacteria 8184
181 Ga0207657_10018309 3300025919 Bacteria 6692
182 Ga0207657_10023854 3300025919 Bacteria 5684
183 Ga0207657_10029825 3300025919 Bacteria 4959
184 Ga0207657_10064647 3300025919 Bacteria 3122
185 Ga0207649_10010804 3300025920 Bacteria 5020
186 Ga0207652_10001926 3300025921 Bacteria 17959
187 Ga0207652_10034871 3300025921 Bacteria 4243
188 Ga0207681_10033164 3300025923 Bacteria 3384
189 Ga0207694_10026416 3300025924 Bacteria 4416
190 Ga0207650_10011028 3300025925 Bacteria 6213
191 Ga0207650_10151817 3300025925 Bacteria 1828
192 Ga0207659_10127337 3300025926 Bacteria 1960
193 Ga0207700_10174474 3300025928 Bacteria 1796
194 Ga0207664_10225986 3300025929 Bacteria 1625
195 Ga0207644_10000377 3300025931 Bacteria 29090
196 Ga0207644_10000761 3300025931 Bacteria 20421
197 Ga0207644_10078340 3300025931 Bacteria 2436
198 Ga0207690_10010173 3300025932 Bacteria 5586
199 Ga0207690_10101707 3300025932 Bacteria 2053
200 Ga0207690_10108548 3300025932 Bacteria 1995
201 Ga0207706_10003780 3300025933 Bacteria 14440
202 Ga0207706_10003970 3300025933 Bacteria 14014
203 Ga0207706_10016093 3300025933 Bacteria 6759
204 Ga0207706_10019226 3300025933 Bacteria 6143
205 Ga0207706_10114225 3300025933 Bacteria 2375
206 Ga0207706_10313537 3300025933 Unclassified 1366
207 Ga0207686_10035468 3300025934 Bacteria 2994
208 Ga0207670_10114294 3300025936 Bacteria 1951
209 Ga0207669_10013051 3300025937 Bacteria 4111
210 Ga0207704_10044362 3300025938 Bacteria 2633
211 Ga0207691_10004111 3300025940 Bacteria 14135
212 Ga0207691_10050617 3300025940 Bacteria 3802
213 Ga0207711_10001092 3300025941 Bacteria 25881
214 Ga0207711_10001441 3300025941 Bacteria 22241
215 Ga0207711_10002613 3300025941 Bacteria 15972
216 Ga0207711_10004549 3300025941 Bacteria 11799
217 Ga0207711_10057322 3300025941 Bacteria 3349
218 Ga0207711_10069673 3300025941 Bacteria 3049
219 Ga0207661_10004779 3300025944 Bacteria 9482
220 Ga0207661_10008223 3300025944 Bacteria 7449
221 Ga0207661_10077211 3300025944 Bacteria 2738
222 Ga0207679_10029222 3300025945 Bacteria 3836
223 Ga0207679_10041402 3300025945 Bacteria 3303
224 Ga0207667_10005047 3300025949 Bacteria 16122
225 Ga0207667_10008143 3300025949 Bacteria 12481
226 Ga0207668_10059900 3300025972 Bacteria 2670
227 Ga0207640_10003082 3300025981 Bacteria 8975
228 Ga0207640_10026440 3300025981 Bacteria 3524
229 Ga0207640_10036804 3300025981 Bacteria 3075
230 Ga0207658_10003190 3300025986 Bacteria 11682
231 Ga0207658_10032239 3300025986 Bacteria 3727
232 Ga0207658_10144364 3300025986 Bacteria 1930
233 Ga0207677_10000580 3300026023 Bacteria 22816
234 Ga0207677_10062154 3300026023 Unclassified 2589
235 Ga0207703_10007958 3300026035 Bacteria 8378
236 Ga0207703_10138859 3300026035 Bacteria 2107
237 Ga0207639_10001714 3300026041 Bacteria 14778
238 Ga0207639_10007599 3300026041 Bacteria 7395
239 Ga0207639_10159881 3300026041 Bacteria 1897
240 Ga0207678_10003598 3300026067 Bacteria 13927
241 Ga0207678_10008777 3300026067 Bacteria 8892
242 Ga0207678_10015202 3300026067 Bacteria 6770
243 Ga0207678_10031695 3300026067 Bacteria 4609
244 Ga0207678_10039667 3300026067 Bacteria 4086
245 Ga0207678_10206896 3300026067 Unclassified 1678
246 Ga0207702_10004873 3300026078 Bacteria 11818
247 Ga0207702_10041863 3300026078 Bacteria 3841
248 Ga0207641_10003872 3300026088 Bacteria 13100
249 Ga0207641_10141340 3300026088 Bacteria 2172
250 Ga0207648_10002753 3300026089 Bacteria 18692
251 Ga0207648_10050054 3300026089 Bacteria 3654
252 Ga0207648_10222334 3300026089 Unclassified 1678
253 Ga0207676_10032848 3300026095 Bacteria 3915
254 Ga0207676_10035876 3300026095 Bacteria 3768
255 Ga0207676_10200128 3300026095 Bacteria 1764
256 Ga0207674_10002425 3300026116 Bacteria 23551
257 Ga0207674_10003312 3300026116 Bacteria 19806
258 Ga0207674_10004266 3300026116 Bacteria 17242
259 Ga0207674_10010410 3300026116 Bacteria 10537
260 Ga0207674_10019634 3300026116 Bacteria 7318
261 Ga0207674_10235530 3300026116 Unclassified 1778
262 Ga0207675_100114193 3300026118 Bacteria 2550
263 Ga0207683_10001237 3300026121 Bacteria 23185
264 Ga0207683_10023385 3300026121 Bacteria 5315
265 Ga0207698_10001792 3300026142 Bacteria 12531
266 Ga0207698_10036836 3300026142 Bacteria 3596
267 Ga0207698_10142858 3300026142 Bacteria 2065
268 Ga0268266_10087618 3300028379 Bacteria 2724
269 Ga0268265_10041383 3300028380 Bacteria 3410
270 Ga0268264_10050550 3300028381 Bacteria 3462
271 Ga0268264_10160328 3300028381 Bacteria 2026
272 Ga0307410_10033675 3300031852 Bacteria 3310
273 Ga0307406_10092645 3300031901 Unclassified 2038
274 Ga0307414_10004931 3300032004 Bacteria 7297
275 Ga0307414_10028950 3300032004 Bacteria 3599
276 Ga0307414_10106566 3300032004 Bacteria 2122
277 Ga0373943_0005043 3300035170 Bacteria 5955
278 Ga0373931_0030117 3300035691 Bacteria 2792
279 Ga0373935_0012304 3300035692 Bacteria 5148
280 Ga0395899_0000372 3300037312 Bacteria 53863
281 Ga0395899_0019120 3300037312 Bacteria 5206
282 Ga0395899_0019996 3300037312 Bacteria 5080
283 Ga0395899_0069867 3300037312 Bacteria 2571
284 Ga0395899_0072449 3300037312 Unclassified 2520
285 Ga0395899_0107966 3300037312 Bacteria 2003
286 Ga0395899_0197498 3300037312 Bacteria 1404
287 Ga0395899_0230932 3300037312 Unclassified 1277
288 Ga0395900_0000240 3300037418 Bacteria 86222
289 Ga0395900_0000703 3300037418 Bacteria 44559
290 Ga0395900_0007130 3300037418 Bacteria 11581
291 Ga0395900_0010611 3300037418 Bacteria 9419
292 Ga0395900_0021461 3300037418 Bacteria 6602
293 Ga0395900_0028356 3300037418 Bacteria 5733
294 Ga0395900_0031790 3300037418 Bacteria 5425
295 Ga0395900_0040021 3300037418 Bacteria 4830
296 Ga0395900_0072982 3300037418 Bacteria 3528
297 Ga0395900_0088409 3300037418 Bacteria 3185
298 Ga0395900_0111334 3300037418 Bacteria 2812
299 Ga0395900_0163334 3300037418 Bacteria 2270
300 Ga0395900_0168543 3300037418 Bacteria 2230
301 Ga0395900_0191304 3300037418 Bacteria 2075
302 Ga0395900_0235853 3300037418 Unclassified 1837
303 Ga0395900_0237828 3300037418 Bacteria 1828
304 Ga0395900_0369447 3300037418 Bacteria 1404
305 Ga0395900_0464928 3300037418 Unclassified 1219
306 Ga0395898_0000619 3300037466 Bacteria 65174
307 Ga0395898_0009985 3300037466 Bacteria 9944
308 Ga0395898_0011163 3300037466 Bacteria 9354
309 Ga0395898_0012535 3300037466 Bacteria 8767
310 Ga0395898_0050377 3300037466 Bacteria 4075
311 Ga0395898_0052745 3300037466 Bacteria 3973
312 Ga0395898_0078192 3300037466 Bacteria 3192
313 Ga0395898_0144886 3300037466 Bacteria 2274
314 Ga0395898_0180590 3300037466 Bacteria 2017
315 Ga0395898_0210475 3300037466 Bacteria 1855
316 Ga0395898_0405593 3300037466 Unclassified 1299
317 Ga0395898_0466065 3300037466 Bacteria 1202
318 Ga0395905_0000219 3300037471 Bacteria 87705
319 Ga0395905_0000259 3300037471 Bacteria 79396
320 Ga0395905_0000627 3300037471 Bacteria 47256
321 Ga0395905_0005077 3300037471 Bacteria 13546
322 Ga0395905_0006189 3300037471 Bacteria 12079
323 Ga0395905_0006686 3300037471 Bacteria 11554
324 Ga0395905_0012285 3300037471 Bacteria 8246
325 Ga0395905_0020139 3300037471 Bacteria 6319
326 Ga0395905_0022628 3300037471 Bacteria 5942
327 Ga0395905_0027513 3300037471 Bacteria 5362
328 Ga0395905_0028387 3300037471 Bacteria 5275
329 Ga0395905_0031458 3300037471 Bacteria 4996
330 Ga0395905_0045606 3300037471 Bacteria 4111
331 Ga0395905_0046634 3300037471 Bacteria 4064
332 Ga0395905_0062877 3300037471 Bacteria 3472
333 Ga0395905_0065105 3300037471 Bacteria 3412
334 Ga0395905_0071618 3300037471 Bacteria 3249
335 Ga0395905_0120592 3300037471 Bacteria 2465
336 Ga0395905_0121693 3300037471 Bacteria 2453
337 Ga0395905_0125140 3300037471 Bacteria 2417
338 Ga0395905_0130001 3300037471 Unclassified 2368
339 Ga0395905_0130837 3300037471 Bacteria 2360
340 Ga0395905_0448177 3300037471 Unclassified 1188
341 Ga0395905_0462848 3300037471 Bacteria 1166
342 Ga0395901_0003802 3300038443 Bacteria 15211
343 Ga0395901_0004704 3300038443 Bacteria 13776
344 Ga0395901_0011402 3300038443 Bacteria 9006
345 Ga0395901_0030548 3300038443 Bacteria 5551
346 Ga0395901_0045668 3300038443 Bacteria 4547
347 Ga0395901_0048387 3300038443 Bacteria 4415
348 Ga0395901_0054721 3300038443 Bacteria 4148
349 Ga0395901_0087912 3300038443 Bacteria 3249
350 Ga0395901_0214891 3300038443 Bacteria 2011
351 Ga0395901_0242046 3300038443 Unclassified 1881
352 Ga0395901_0334773 3300038443 Unclassified 1564
353 Ga0395901_0443809 3300038443 Bacteria 1328
354 Ga0436365_0496393 3300039437 Bacteria 13805
355 Ga0436363_1275287 3300039450 Bacteria 1716
356 Ga0439453_0003949 3300041408 Bacteria 2175
357 Ga0439458_0000490 3300042157 Bacteria 10137
358 Ga0439458_0001102 3300042157 Bacteria 6873
359 Ga0439464_0035524 3300042439 Unclassified 1408
360 Ga0466969_0022777 3300044656 Bacteria 3231
361 Ga0466966_0046978 3300044684 Bacteria 2754
362 Ga0466966_0052215 3300044684 Bacteria 2598
363 Ga0466961_0023783 3300044693 Bacteria 3943
364 Ga0466961_0053284 3300044693 Bacteria 2582
365 Ga0466963_0010065 3300044694 Bacteria 5718
366 Ga0466963_0027367 3300044694 Bacteria 3650
367 Ga0466971_0002805 3300044719 Bacteria 7374
368 Ga0466971_0036376 3300044719 Bacteria 2208
369 Ga0466957_0036193 3300044842 Bacteria 2966
370 Ga0466960_0090784 3300044901 Bacteria 1557
371 Ga0466959_0011804 3300045049 Bacteria 6289
372 Ga0466959_0046445 3300045049 Unclassified 3195
373 Ga0466958_0007905 3300045836 Bacteria 5879
374 Ga0466958_0080230 3300045836 Bacteria 2007
375 Ga0466967_0013147 3300045976 Bacteria 6379
376 Ga0495663_0075309 3300046525 Bacteria 1080
377 Ga0495621_0001864 3300046539 Bacteria 5540
378 Ga0495656_0147413 3300046615 Bacteria 1134
379 Ga0495669_0009586 3300046684 Bacteria 4085
380 Ga0496100_0054592 3300048903 Bacteria 2606
381 Ga0496101_0003551 3300048904 Bacteria 9725
382 Ga0496104_0271210 3300048907 Bacteria 1609
383 Ga0496105_0026179 3300048908 Bacteria 4755
384 Ga0496106_0014088 3300048909 Bacteria 5909
385 Ga0496106_0015741 3300048909 Bacteria 5595
386 Ga0496107_0005474 3300048910 Bacteria 8686
387 Ga0496107_0008805 3300048910 Bacteria 6991
388 Ga0496109_0009310 3300048912 Bacteria 8367
389 Ga0496109_0010040 3300048912 Bacteria 8080
390 Ga0496109_0027133 3300048912 Bacteria 5111
391 Ga0496109_0047511 3300048912 Bacteria 3903
392 Ga0496110_0009910 3300048913 Bacteria 7725
393 Ga0496110_0018977 3300048913 Bacteria 5779
394 Ga0496110_0028004 3300048913 Bacteria 4835
395 Ga0496111_0002827 3300048914 Bacteria 10584
396 Ga0496111_0037215 3300048914 Bacteria 3483
397 Ga0496111_0060630 3300048914 Bacteria 2742
398 Ga0496111_0078815 3300048914 Bacteria 2402
399 Ga0496112_0031793 3300048915 Bacteria 5120
400 Ga0496112_0055034 3300048915 Bacteria 3910
401 Ga0496112_0135765 3300048915 Bacteria 2430
402 Ga0496112_0165803 3300048915 Bacteria 2175
403 Ga0496113_0016255 3300048916 Bacteria 5136
404 Ga0496113_0019504 3300048916 Bacteria 4745
405 Ga0496113_0035272 3300048916 Bacteria 3657
406 Ga0496113_0037666 3300048916 Bacteria 3551
407 nmdc:mga0k408_45280_c1 3300050493 Bacteria 2538
408 Ga0466962_0035431 3300061719 Bacteria 2389
409 2896431014 2896429255 Bacteria 2557483
410 JGI24737J22298_10034697
411 JGI24737J22298_10000786
412 JGI24735J21928_10026519
413 rootH1_10317325
414 Ga0070658_10020760
415 Ga0070658_10030616
416 Ga0070658_10037422
417 Ga0070683_100002352
418 Ga0070683_100004568
419 Ga0070683_100120603
420 Ga0070690_100001800
421 Ga0070670_100049252
422 Ga0070670_100099717
423 Ga0070666_10001045
424 Ga0070666_10074385
425 Ga0070680_100002086
426 Ga0070680_100039200
427 Ga0070680_100233327
428 Ga0070682_100038128
429 Ga0070682_100096508
430 Ga0068868_100006385
431 Ga0068868_100067055
432 Ga0070660_100002163
433 Ga0070660_100003986
434 Ga0070660_100006075
435 Ga0070660_100018268
436 Ga0070660_100044516
437 Ga0070691_10000969
438 Ga0070661_100012941
439 Ga0070661_100277017
440 Ga0070668_100124137
441 Ga0070669_100092554
442 Ga0070669_100270527
443 Ga0070671_100005149
444 Ga0070671_100030133
445 Ga0070671_100137342
446 Ga0070674_100010535
447 Ga0070673_100034031
448 Ga0070659_100004083
449 Ga0070659_100008483
450 Ga0070659_100011667
451 Ga0070659_100022239
452 Ga0070667_100000857
453 Ga0070667_100003694
454 Ga0070667_100019293
455 Ga0070667_100139750
456 Ga0070714_100030270
457 Ga0070713_100151618
458 Ga0070663_100009396
459 Ga0070663_100011731
460 Ga0070663_100036318
461 Ga0070663_100126127
462 Ga0070663_100237402
463 Ga0070678_100002718
464 Ga0070662_100002626
465 Ga0070662_100015597
466 Ga0070662_100017621
467 Ga0070662_100041565
468 Ga0070662_100236665
469 Ga0070681_10012983
470 Ga0068867_100033136
471 Ga0068867_100170329
472 Ga0070679_100013744
473 Ga0070679_100044301
474 Ga0070679_100094004
475 Ga0070679_100116619
476 Ga0070679_100122582
477 Ga0070684_100001405
478 Ga0068853_100001282
479 Ga0068853_100005745
480 Ga0068853_100034106
481 Ga0068853_100056268
482 Ga0068853_100230403
483 Ga0070672_100004776
484 Ga0070672_100093505
485 Ga0070672_100196084
486 Ga0070686_100033334
487 Ga0068855_100010658
488 Ga0068855_100016953
489 Ga0070664_100004692
490 Ga0070664_100024717
491 Ga0070664_100028823
492 Ga0070664_100123252
493 Ga0070664_100220215
494 Ga0070664_100238694
495 Ga0070664_100319908
496 Ga0068857_100007537
497 Ga0068857_100014742
498 Ga0068854_100005540
499 Ga0068854_100014399
500 Ga0068854_100021893
501 Ga0068854_100023283
502 Ga0068854_100062371
503 Ga0068854_100104805
504 Ga0068856_100032234
505 Ga0068856_100057879
506 Ga0068856_100409091
507 Ga0068859_100006190
508 Ga0068864_100003827
509 Ga0068864_100032976
510 Ga0068864_100060139
511 Ga0068861_100105968
512 Ga0068851_10021551
513 Ga0068863_100015484
514 Ga0068863_100026544
515 Ga0068863_100111724
516 Ga0068858_100005035
517 Ga0068858_100020801
518 Ga0068860_100024573
519 Ga0068860_100127582
520 Ga0081539_10004451
521 Ga0070717_10021348
522 Ga0070717_10295102
523 Ga0070712_100096101
524 Ga0097621_100034871
525 Ga0068871_100016174
526 Ga0068865_100005217
527 Ga0068865_100065318
528 Ga0097620_100006190
529 Ga0105240_10011074
530 Ga0105240_10016018
531 Ga0105240_10090105
532 Ga0105247_10073757
533 Ga0105242_10182698
534 Ga0105248_10001194
535 Ga0105248_10031022
536 Ga0105248_10072006
537 Ga0105237_10583937
538 Ga0105238_10005470
539 Ga0105238_10012233
540 Ga0105238_10425720
541 Ga0105249_10199227
542 Ga0105239_10180217
543 Ga0105239_10236919
544 Ga0157373_10004808
545 Ga0157371_10052773
546 Ga0157371_10061482
547 Ga0157370_10006925
548 Ga0157370_10010165
549 Ga0157370_10012674
550 Ga0157370_10088778
551 Ga0157370_10312708
552 Ga0157369_10204850
553 Ga0157369_10297259
554 Ga0157374_10055435
555 Ga0157378_10280604
556 Ga0163162_10031636
557 Ga0163162_10075864
558 Ga0163162_10086824
559 Ga0157372_10007229
560 Ga0157372_10105718
561 Ga0157372_10162824
562 Ga0157375_10406184
563 Ga0163163_10008334
564 Ga0157376_10005869
565 Ga0163161_10077928
566 Ga0206353_11875877
567 Ga0213876_10079735
568 Ga0207656_10041083
569 Ga0207710_10026854
570 Ga0207688_10005110
571 Ga0207680_10001428
572 Ga0207647_10001961
573 Ga0207647_10003055
574 Ga0207647_10004534
575 Ga0207647_10011112
576 Ga0207647_10036453
577 Ga0207705_10000330
578 Ga0207705_10003428
579 Ga0207705_10019517
580 Ga0207705_10046166
581 Ga0207695_10006328
582 Ga0207695_10182651
583 Ga0207671_10030099
584 Ga0207693_10105845
585 Ga0207660_10007369
586 Ga0207657_10003186
587 Ga0207657_10006777
588 Ga0207657_10008319
589 Ga0207657_10012994
590 Ga0207657_10018309
591 Ga0207657_10023854
592 Ga0207657_10029825
593 Ga0207657_10064647
594 Ga0207649_10010804
595 Ga0207652_10001926
596 Ga0207652_10034871
597 Ga0207681_10033164
598 Ga0207694_10026416
599 Ga0207650_10011028
600 Ga0207650_10151817
601 Ga0207659_10127337
602 Ga0207700_10174474
603 Ga0207664_10225986
604 Ga0207644_10000377
605 Ga0207644_10000761
606 Ga0207644_10078340
607 Ga0207690_10010173
608 Ga0207690_10101707
609 Ga0207690_10108548
610 Ga0207706_10003780
611 Ga0207706_10003970
612 Ga0207706_10016093
613 Ga0207706_10019226
614 Ga0207706_10114225
615 Ga0207706_10313537
616 Ga0207686_10035468
617 Ga0207670_10114294
618 Ga0207669_10013051
619 Ga0207704_10044362
620 Ga0207691_10004111
621 Ga0207691_10050617
622 Ga0207711_10001092
623 Ga0207711_10001441
624 Ga0207711_10002613
625 Ga0207711_10004549
626 Ga0207711_10057322
627 Ga0207711_10069673
628 Ga0207661_10004779
629 Ga0207661_10008223
630 Ga0207661_10077211
631 Ga0207679_10029222
632 Ga0207679_10041402
633 Ga0207667_10005047
634 Ga0207667_10008143
635 Ga0207668_10059900
636 Ga0207640_10003082
637 Ga0207640_10026440
638 Ga0207640_10036804
639 Ga0207658_10003190
640 Ga0207658_10032239
641 Ga0207658_10144364
642 Ga0207677_10000580
643 Ga0207677_10062154
644 Ga0207703_10007958
645 Ga0207703_10138859
646 Ga0207639_10001714
647 Ga0207639_10007599
648 Ga0207639_10159881
649 Ga0207678_10003598
650 Ga0207678_10008777
651 Ga0207678_10015202
652 Ga0207678_10031695
653 Ga0207678_10039667
654 Ga0207678_10206896
655 Ga0207702_10004873
656 Ga0207702_10041863
657 Ga0207641_10003872
658 Ga0207641_10141340
659 Ga0207648_10002753
660 Ga0207648_10050054
661 Ga0207648_10222334
662 Ga0207676_10032848
663 Ga0207676_10035876
664 Ga0207676_10200128
665 Ga0207674_10002425
666 Ga0207674_10003312
667 Ga0207674_10004266
668 Ga0207674_10010410
669 Ga0207674_10019634
670 Ga0207674_10235530
671 Ga0207675_100114193
672 Ga0207683_10001237
673 Ga0207683_10023385
674 Ga0207698_10001792
675 Ga0207698_10036836
676 Ga0207698_10142858
677 Ga0268266_10087618
678 Ga0268265_10041383
679 Ga0268264_10050550
680 Ga0268264_10160328
681 Ga0307410_10033675
682 Ga0307406_10092645
683 Ga0307414_10004931
684 Ga0307414_10028950
685 Ga0307414_10106566
686 Ga0373943_0005043
687 Ga0373931_0030117
688 Ga0373935_0012304
689 Ga0395899_0000372
690 Ga0395899_0019120
691 Ga0395899_0019996
692 Ga0395899_0069867
693 Ga0395899_0072449
694 Ga0395899_0107966
695 Ga0395899_0197498
696 Ga0395899_0230932
697 Ga0395900_0000240
698 Ga0395900_0000703
699 Ga0395900_0007130
700 Ga0395900_0010611
701 Ga0395900_0021461
702 Ga0395900_0028356
703 Ga0395900_0031790
704 Ga0395900_0040021
705 Ga0395900_0072982
706 Ga0395900_0088409
707 Ga0395900_0111334
708 Ga0395900_0163334
709 Ga0395900_0168543
710 Ga0395900_0191304
711 Ga0395900_0235853
712 Ga0395900_0237828
713 Ga0395900_0369447
714 Ga0395900_0464928
715 Ga0395898_0000619
716 Ga0395898_0009985
717 Ga0395898_0011163
718 Ga0395898_0012535
719 Ga0395898_0050377
720 Ga0395898_0052745
721 Ga0395898_0078192
722 Ga0395898_0144886
723 Ga0395898_0180590
724 Ga0395898_0210475
725 Ga0395898_0405593
726 Ga0395898_0466065
727 Ga0395905_0000219
728 Ga0395905_0000259
729 Ga0395905_0000627
730 Ga0395905_0005077
731 Ga0395905_0006189
732 Ga0395905_0006686
733 Ga0395905_0012285
734 Ga0395905_0020139
735 Ga0395905_0022628
736 Ga0395905_0027513
737 Ga0395905_0028387
738 Ga0395905_0031458
739 Ga0395905_0045606
740 Ga0395905_0046634
741 Ga0395905_0062877
742 Ga0395905_0065105
743 Ga0395905_0071618
744 Ga0395905_0120592
745 Ga0395905_0121693
746 Ga0395905_0125140
747 Ga0395905_0130001
748 Ga0395905_0130837
749 Ga0395905_0448177
750 Ga0395905_0462848
751 Ga0395901_0003802
752 Ga0395901_0004704
753 Ga0395901_0011402
754 Ga0395901_0030548
755 Ga0395901_0045668
756 Ga0395901_0048387
757 Ga0395901_0054721
758 Ga0395901_0087912
759 Ga0395901_0214891
760 Ga0395901_0242046
761 Ga0395901_0334773
762 Ga0395901_0443809
763 Ga0436365_0496393
764 Ga0436363_1275287
765 Ga0439453_0003949
766 Ga0439458_0000490
767 Ga0439458_0001102
768 Ga0439464_0035524
769 Ga0466969_0022777
770 Ga0466966_0046978
771 Ga0466966_0052215
772 Ga0466961_0023783
773 Ga0466961_0053284
774 Ga0466963_0010065
775 Ga0466963_0027367
776 Ga0466971_0002805
777 Ga0466971_0036376
778 Ga0466957_0036193
779 Ga0466960_0090784
780 Ga0466959_0011804
781 Ga0466959_0046445
782 Ga0466958_0007905
783 Ga0466958_0080230
784 Ga0466967_0013147
785 Ga0495663_0075309
786 Ga0495621_0001864
787 Ga0495656_0147413
788 Ga0495669_0009586
789 Ga0496100_0054592
790 Ga0496101_0003551
791 Ga0496104_0271210
792 Ga0496105_0026179
793 Ga0496106_0014088
794 Ga0496106_0015741
795 Ga0496107_0005474
796 Ga0496107_0008805
797 Ga0496109_0009310
798 Ga0496109_0010040
799 Ga0496109_0027133
800 Ga0496109_0047511
801 Ga0496110_0009910
802 Ga0496110_0018977
803 Ga0496110_0028004
804 Ga0496111_0002827
805 Ga0496111_0037215
806 Ga0496111_0060630
807 Ga0496111_0078815
808 Ga0496112_0031793
809 Ga0496112_0055034
810 Ga0496112_0135765
811 Ga0496112_0165803
812 Ga0496113_0016255
813 Ga0496113_0019504
814 Ga0496113_0035272
815 Ga0496113_0037666
816 nmdc:mga0k408_45280_c1
817 Ga0466962_0035431
818 2896431014

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

78

351

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z72-assembly1.cif.gz_A new structure of cold-active protein tyrosine phosphatase at 1.1 angstrom 0.7987 38 319
2zbm-assembly1.cif.gz_A crystal structure of i115m mutant cold-active protein tyrosine phosphatase 0.7986 38 319
1v73-assembly1.cif.gz_A crystal structure of cold-active protein-tyrosine phosphatase of a psychrophile shewanella sp. 0.7824 38 319
6g0i-assembly1.cif.gz_A active fe-pp1 0.7346 37 321
4v0x-assembly1.cif.gz_A the crystal structure of mouse pp1g in complex with truncated human ppp1r15b (631-684) 0.7312 37 323
ID Description Score Start End Superfamily
af_A0A2R8RS59_2_212_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8998 41 119 3.60.21.10
af_A4I498_61_352_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8189 38 320 3.60.21.10
af_Q8I5Y5_20_301_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7999 30 319 3.60.21.10
2zbmA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7986 38 319 3.60.21.10
af_Q944L7_35_346_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7946 31 309 3.60.21.10
ID Description Score Start End GO Terms
AF-R1D0J7-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9854 43 126 GO:0016787
AF-R1D0J7-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9413 43 126 GO:0016787
AF-A0A7V9AVF4-F1-model_v4 Metallophosphoesterase 0.9322 30 138 GO:0016787
AF-A0A4Q6AMC4-F1-model_v4 Metallophosphoesterase 0.9142 33 125 GO:0016787
AF-F4NYP9-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9068 38 309 GO:0016787

Map