F436893

General Info

Members Datasets Scaffolds Average Seq Length
409 266 818 215

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10198975|rootH1_101989752
Length 238
Sequence MTTALSDLARAEIDRGLLGQRTCTTRILLADDHAVFREGLREVLDEMPGVRIEGEASDAGSTLALVRRTRADLVLLDLSMPGRSGMELIRAIREEAPQLRVLVLTMHEERHYALRAFLAGAHGYLTKHAAAPELSYAMRKVAAGGTYVGPWMADYVARNLAAAPEVAPHQQLSDREFDIFMRLARGDTAGEIGRALSLSAKTVSNYKVRICHTMAFPNDAALVRYAVRHQLIDDHDIA

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
106 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
107 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
108 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
109 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
110 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
111 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
112 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
117 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
190 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
193 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
194 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
195 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
257 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
258 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
259 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
262 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
263 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
264 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
265 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
266 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 0
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.27
Nodule 0.49
Rhizoplane 2.44
Rhizosphere 72.13
Stem 0
Stem Tuber 0
Unclassified 1.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10198975 3300003323 Bacteria 1365
2 JGI24752J21851_1004308 3300001976 Bacteria 1866
3 JGI24751J29686_10008112 3300002459 Bacteria 2146
4 JGI25155J39150_1000036 3300002704 Bacteria 97790
5 JGI25156J39149_1000047 3300002705 Bacteria 97697
6 JGI25154J39366_1000068 3300002738 Bacteria 97697
7 JGI25157J39369_1000066 3300002741 Bacteria 97697
8 JGI25150J39212_1007145 3300002774 Bacteria 2261
9 JGI25150J39212_1009406 3300002774 Bacteria 1863
10 JGI25159J45721_1000180 3300002987 Bacteria 29383
11 JGI25159J45721_1002272 3300002987 Bacteria 7406
12 JGI25151J46595_10001766 3300003187 Bacteria 13996
13 JGI25151J46595_10008163 3300003187 Bacteria 5063
14 JGI25151J46595_10013976 3300003187 Bacteria 3594
15 JGI25160J50197_1000145 3300003354 Bacteria 63479
16 JGI25160J50197_1000331 3300003354 Bacteria 32173
17 JGI25161J50226_1000064 3300003374 Bacteria 99448
18 Ga0055526_1003813 3300003771 Bacteria 9369
19 Ga0055526_1008976 3300003771 Bacteria 4890
20 Ga0055537_1000043 3300003773 Bacteria 90816
21 Ga0055537_1000046 3300003773 Bacteria 88251
22 Ga0055537_1001296 3300003773 Bacteria 10325
23 Ga0055524_1000012 3300003775 Bacteria 260384
24 Ga0055524_1001013 3300003775 Bacteria 17406
25 Ga0055536_1000914 3300003781 Bacteria 19083
26 Ga0055534_1000421 3300003784 Bacteria 25421
27 Ga0055534_1002613 3300003784 Bacteria 6138
28 Ga0055534_1014702 3300003784 Bacteria 1457
29 Ga0055528_1002287 3300003790 Bacteria 10381
30 Ga0055530_10000015 3300003791 Bacteria 148790
31 Ga0055540_1000039 3300003792 Bacteria 161844
32 Ga0055540_1005678 3300003792 Bacteria 5166
33 Ga0055531_10004016 3300003794 Bacteria 9125
34 Ga0055531_10006290 3300003794 Bacteria 6768
35 Ga0055543_1000284 3300004625 Bacteria 36825
36 Ga0065165_1016332 3300005262 Bacteria 2785
37 Ga0065165_1020983 3300005262 Bacteria 2280
38 Ga0065165_1039257 3300005262 Bacteria 1419
39 Ga0065165_1051415 3300005262 Bacteria 1168
40 Ga0065712_10071201 3300005290 Bacteria 5419
41 Ga0065712_10107144 3300005290 Bacteria 1902
42 Ga0070658_10063421 3300005327 Bacteria 3012
43 Ga0070658_10511304 3300005327 Bacteria 1038
44 Ga0070683_100056190 3300005329 Bacteria 3655
45 Ga0070683_100100812 3300005329 Bacteria 2718
46 Ga0070690_100003351 3300005330 Bacteria 8743
47 Ga0070670_100004034 3300005331 Bacteria 12257
48 Ga0070670_100009833 3300005331 Bacteria 8171
49 Ga0070677_10003475 3300005333 Bacteria 5083
50 Ga0068869_100001882 3300005334 Bacteria 12605
51 Ga0070666_10012596 3300005335 Bacteria 5340
52 Ga0070680_100070433 3300005336 Bacteria 2872
53 Ga0068868_100006888 3300005338 Bacteria 8072
54 Ga0070660_100039050 3300005339 Bacteria 3607
55 Ga0070689_100008520 3300005340 Bacteria 7225
56 Ga0070689_100018826 3300005340 Bacteria 5096
57 Ga0070661_100013165 3300005344 Bacteria 5805
58 Ga0070661_100026081 3300005344 Bacteria 4200
59 Ga0070661_100054829 3300005344 Bacteria 2920
60 Ga0070661_100687068 3300005344 Bacteria 833
61 Ga0070668_100015343 3300005347 Bacteria 5725
62 Ga0070669_100009757 3300005353 Bacteria 6837
63 Ga0070675_100083907 3300005354 Bacteria 2660
64 Ga0070675_100284303 3300005354 Bacteria 1454
65 Ga0070675_100291469 3300005354 Bacteria 1436
66 Ga0070671_100013889 3300005355 Bacteria 6496
67 Ga0070671_100061498 3300005355 Bacteria 3128
68 Ga0070671_100461642 3300005355 Bacteria 1090
69 Ga0070674_100080408 3300005356 Bacteria 2327
70 Ga0070674_100086219 3300005356 Bacteria 2255
71 Ga0070674_100242058 3300005356 Bacteria 1413
72 Ga0070673_100307149 3300005364 Bacteria 1398
73 Ga0070688_100006046 3300005365 Bacteria 6425
74 Ga0070688_100031088 3300005365 Bacteria 3209
75 Ga0070659_100021327 3300005366 Bacteria 4932
76 Ga0070659_100041792 3300005366 Bacteria 3585
77 Ga0070659_100610355 3300005366 Bacteria 938
78 Ga0070667_100141631 3300005367 Bacteria 2106
79 Ga0070709_10000399 3300005434 Bacteria 26560
80 Ga0070713_100000129 3300005436 Bacteria 49577
81 Ga0070711_100125708 3300005439 Bacteria 1903
82 Ga0070705_100191501 3300005440 Bacteria 1394
83 Ga0070663_100004758 3300005455 Bacteria 8011
84 Ga0070663_100032748 3300005455 Bacteria 3585
85 Ga0070678_100014849 3300005456 Bacteria 4928
86 Ga0070662_100007839 3300005457 Bacteria 6935
87 Ga0068867_100016499 3300005459 Bacteria 5244
88 Ga0070685_10001552 3300005466 Bacteria 12106
89 Ga0070685_10009168 3300005466 Bacteria 5108
90 Ga0070707_100107367 3300005468 Bacteria 2708
91 Ga0070684_100026859 3300005535 Bacteria 4853
92 Ga0068853_100053476 3300005539 Bacteria 3477
93 Ga0070672_100024035 3300005543 Bacteria 4496
94 Ga0070672_100232999 3300005543 Bacteria 1547
95 Ga0070696_100183375 3300005546 Bacteria 1554
96 Ga0070665_100034551 3300005548 Bacteria 5084
97 Ga0068855_100019638 3300005563 Bacteria 8117
98 Ga0068855_100256592 3300005563 Bacteria 1949
99 Ga0068855_100642671 3300005563 Bacteria 1140
100 Ga0070664_100169305 3300005564 Bacteria 1937
101 Ga0070664_100190320 3300005564 Bacteria 1828
102 Ga0068857_100040747 3300005577 Bacteria 4118
103 Ga0068857_100142432 3300005577 Bacteria 2167
104 Ga0068857_100184285 3300005577 Bacteria 1900
105 Ga0068857_100510393 3300005577 Bacteria 1129
106 Ga0068854_100027679 3300005578 Bacteria 3910
107 Ga0068852_100005946 3300005616 Bacteria 8780
108 Ga0068852_100012838 3300005616 Bacteria 6384
109 Ga0068859_100006924 3300005617 Bacteria 11511
110 Ga0068859_100018470 3300005617 Bacteria 7009
111 Ga0068864_100000086 3300005618 Bacteria 99697
112 Ga0068864_100024269 3300005618 Bacteria 5100
113 Ga0068864_100479015 3300005618 Bacteria 1194
114 Ga0068861_100008696 3300005719 Bacteria 6985
115 Ga0068851_10001375 3300005834 Bacteria 10618
116 Ga0068851_10001462 3300005834 Bacteria 10351
117 Ga0068870_10001621 3300005840 Bacteria 9174
118 Ga0068863_100360858 3300005841 Bacteria 1416
119 Ga0068858_100009676 3300005842 Bacteria 9183
120 Ga0068858_100572607 3300005842 Bacteria 1094
121 Ga0068860_100008702 3300005843 Bacteria 10112
122 Ga0068862_100007099 3300005844 Bacteria 9305
123 Ga0075364_10065949 3300006051 Bacteria 2377
124 Ga0075364_10158527 3300006051 Bacteria 1527
125 Ga0070712_100151002 3300006175 Bacteria 1784
126 Ga0075362_10044492 3300006177 Bacteria 1969
127 Ga0075366_10290167 3300006195 Unclassified 1000
128 Ga0097621_100004975 3300006237 Bacteria 9316
129 Ga0097621_100033662 3300006237 Bacteria 4083
130 Ga0097621_100234641 3300006237 Bacteria 1602
131 Ga0068871_100004053 3300006358 Bacteria 10128
132 Ga0068871_100177494 3300006358 Bacteria 1829
133 Ga0068871_100636928 3300006358 Bacteria 972
134 Ga0075428_100019720 3300006844 Bacteria 7462
135 Ga0075434_100428322 3300006871 Bacteria 1344
136 Ga0075434_100851496 3300006871 Bacteria 927
137 Ga0068865_100010411 3300006881 Bacteria 5788
138 Ga0097620_100006923 3300006931 Bacteria 11511
139 Ga0097620_100018470 3300006931 Bacteria 7009
140 Ga0079104_1012919 3300006946 Bacteria 2599
141 Ga0105240_10576415 3300009093 Bacteria 1242
142 Ga0111539_10514632 3300009094 Bacteria 1394
143 Ga0105247_10268637 3300009101 Bacteria 1172
144 Ga0105248_10133553 3300009177 Bacteria 2800
145 Ga0105248_10500330 3300009177 Bacteria 1370
146 Ga0105237_10223513 3300009545 Bacteria 1883
147 Ga0105249_10016969 3300009553 Bacteria 6460
148 Ga0157370_10004009 3300013104 Bacteria 17102
149 Ga0157369_10008416 3300013105 Bacteria 11830
150 Ga0157369_10289282 3300013105 Bacteria 1706
151 Ga0157374_10006220 3300013296 Bacteria 10123
152 Ga0157378_10005489 3300013297 Bacteria 11115
153 Ga0163162_10008794 3300013306 Bacteria 9820
154 Ga0157372_10301427 3300013307 Bacteria 1864
155 Ga0157375_10186955 3300013308 Bacteria 2225
156 Ga0163163_10003519 3300014325 Bacteria 13292
157 Ga0157380_10006260 3300014326 Bacteria 8358
158 Ga0157380_10032123 3300014326 Bacteria 4036
159 Ga0157377_10003909 3300014745 Bacteria 6791
160 Ga0157379_10008160 3300014968 Bacteria 9093
161 Ga0157376_10009513 3300014969 Bacteria 7063
162 Ga0157376_10161707 3300014969 Bacteria 2031
163 Ga0163161_10002291 3300017792 Bacteria 13719
164 Ga0209435_100001 3300025206 Bacteria 1424171
165 Ga0209436_114188 3300025208 Bacteria 1277
166 Ga0207425_1004333 3300025245 Bacteria 4291
167 Ga0207425_1009431 3300025245 Bacteria 2426
168 Ga0209646_1000001 3300025246 Bacteria 3092932
169 Ga0209026_1000003 3300025250 Bacteria 1060571
170 Ga0209759_1000001 3300025256 Bacteria 2799452
171 Ga0209129_1010931 3300025258 Bacteria 2215
172 Ga0209565_1000004 3300025263 Bacteria 983150
173 Ga0209565_1000201 3300025263 Bacteria 71408
174 Ga0209565_1001101 3300025263 Bacteria 13306
175 Ga0207666_1018422 3300025271 Bacteria 1014
176 Ga0209673_1000221 3300025273 Bacteria 112739
177 Ga0209130_1000094 3300025284 Bacteria 145569
178 Ga0209130_1000855 3300025284 Bacteria 25210
179 Ga0207673_1006251 3300025290 Bacteria 1470
180 Ga0209675_1000061 3300025291 Bacteria 181096
181 Ga0209675_1000623 3300025291 Bacteria 25328
182 Ga0209675_1002004 3300025291 Bacteria 10932
183 Ga0209675_1002958 3300025291 Bacteria 8382
184 Ga0209676_1000029 3300025292 Bacteria 520536
185 Ga0209676_1001690 3300025292 Bacteria 19126
186 Ga0209676_1020006 3300025292 Bacteria 2287
187 Ga0209025_1002533 3300025294 Bacteria 19109
188 Ga0209025_1003079 3300025294 Bacteria 16356
189 Ga0209025_1006708 3300025294 Bacteria 8837
190 Ga0209025_1007278 3300025294 Bacteria 8307
191 Ga0209025_1038832 3300025294 Bacteria 2087
192 Ga0209025_1045823 3300025294 Bacteria 1807
193 Ga0209564_1000578 3300025295 Bacteria 58027
194 Ga0209564_1000681 3300025295 Bacteria 50123
195 Ga0209564_1001132 3300025295 Bacteria 31294
196 Ga0209564_1009263 3300025295 Bacteria 4714
197 Ga0209758_1016251 3300025297 Bacteria 3792
198 Ga0209758_1022986 3300025297 Bacteria 2836
199 Ga0209758_1036695 3300025297 Bacteria 1908
200 Ga0209050_1000003 3300025298 Bacteria 1609245
201 Ga0209050_1006588 3300025298 Bacteria 6819
202 Ga0209256_1000001 3300025299 Bacteria 2166974
203 Ga0209256_1002198 3300025299 Bacteria 16715
204 Ga0207426_1000025 3300025302 Bacteria 532921
205 Ga0207426_1002215 3300025302 Bacteria 13038
206 Ga0209051_1000003 3300025303 Bacteria 1609245
207 Ga0209051_1000587 3300025303 Bacteria 43099
208 Ga0209051_1017051 3300025303 Bacteria 3258
209 Ga0209257_1000018 3300025304 Bacteria 836016
210 Ga0209257_1000137 3300025304 Bacteria 204210
211 Ga0209257_1061838 3300025304 Bacteria 1014
212 Ga0207697_10000698 3300025315 Bacteria 19103
213 Ga0207656_10003735 3300025321 Bacteria 5271
214 Ga0207656_10006346 3300025321 Bacteria 4242
215 Ga0207682_10001751 3300025893 Bacteria 9959
216 Ga0207688_10004148 3300025901 Bacteria 7899
217 Ga0207680_10039558 3300025903 Bacteria 2737
218 Ga0207680_10240888 3300025903 Bacteria 1246
219 Ga0207699_10000272 3300025906 Bacteria 28425
220 Ga0207645_10006100 3300025907 Bacteria 8666
221 Ga0207643_10000513 3300025908 Bacteria 24812
222 Ga0207643_10026359 3300025908 Bacteria 3217
223 Ga0207705_10168824 3300025909 Bacteria 1647
224 Ga0207705_10655783 3300025909 Bacteria 816
225 Ga0207693_10159855 3300025915 Bacteria 1772
226 Ga0207660_10067470 3300025917 Bacteria 2591
227 Ga0207657_10357392 3300025919 Bacteria 1151
228 Ga0207649_10022304 3300025920 Bacteria 3657
229 Ga0207649_10038985 3300025920 Bacteria 2879
230 Ga0207681_10080409 3300025923 Bacteria 2299
231 Ga0207681_10188122 3300025923 Bacteria 1577
232 Ga0207650_10017220 3300025925 Bacteria 5057
233 Ga0207650_10178541 3300025925 Bacteria 1691
234 Ga0207659_10034602 3300025926 Bacteria 3485
235 Ga0207659_10310184 3300025926 Bacteria 1299
236 Ga0207700_10000044 3300025928 Bacteria 89454
237 Ga0207644_10029882 3300025931 Bacteria 3783
238 Ga0207644_10103583 3300025931 Bacteria 2141
239 Ga0207706_10002582 3300025933 Bacteria 17646
240 Ga0207670_10060421 3300025936 Bacteria 2582
241 Ga0207670_10148922 3300025936 Bacteria 1734
242 Ga0207669_10036293 3300025937 Bacteria 2815
243 Ga0207669_10285657 3300025937 Bacteria 1247
244 Ga0207704_10012986 3300025938 Bacteria 4152
245 Ga0207691_10015693 3300025940 Bacteria 7200
246 Ga0207691_10049250 3300025940 Bacteria 3860
247 Ga0207711_10047221 3300025941 Bacteria 3680
248 Ga0207689_10001702 3300025942 Bacteria 20851
249 Ga0207689_10078081 3300025942 Bacteria 2721
250 Ga0207679_10013904 3300025945 Bacteria 5277
251 Ga0207679_10021536 3300025945 Bacteria 4373
252 Ga0207679_10095823 3300025945 Bacteria 2307
253 Ga0207667_10148679 3300025949 Bacteria 2411
254 Ga0207651_10201450 3300025960 Bacteria 1595
255 Ga0207651_10215464 3300025960 Bacteria 1549
256 Ga0207651_11123561 3300025960 Bacteria 705
257 Ga0207712_10069545 3300025961 Bacteria 2526
258 Ga0207668_10598103 3300025972 Bacteria 960
259 Ga0207658_10022788 3300025986 Bacteria 4362
260 Ga0207677_10041826 3300026023 Bacteria 3033
261 Ga0207703_10033330 3300026035 Bacteria 4082
262 Ga0207703_11054168 3300026035 Bacteria 780
263 Ga0207639_10108783 3300026041 Bacteria 2254
264 Ga0207639_10160588 3300026041 Bacteria 1893
265 Ga0207678_10024037 3300026067 Bacteria 5325
266 Ga0207678_10025295 3300026067 Bacteria 5183
267 Ga0207702_10486606 3300026078 Bacteria 1201
268 Ga0207641_10037859 3300026088 Bacteria 4030
269 Ga0207648_10007960 3300026089 Bacteria 10336
270 Ga0207676_10000086 3300026095 Bacteria 85891
271 Ga0207676_10286348 3300026095 Bacteria 1498
272 Ga0207674_10003670 3300026116 Bacteria 18732
273 Ga0207674_10021512 3300026116 Bacteria 6944
274 Ga0207674_10121336 3300026116 Bacteria 2581
275 Ga0207674_10123567 3300026116 Bacteria 2554
276 Ga0207674_10332037 3300026116 Bacteria 1470
277 Ga0207675_100005844 3300026118 Bacteria 11758
278 Ga0207675_101152636 3300026118 Bacteria 795
279 Ga0207683_10001701 3300026121 Bacteria 19679
280 Ga0207698_10024819 3300026142 Bacteria 4213
281 Ga0207698_10029010 3300026142 Bacteria 3956
282 Ga0209281_1011212 3300027111 Bacteria 2014
283 Ga0268266_10153841 3300028379 Bacteria 2076
284 Ga0268264_10185756 3300028381 Bacteria 1891
285 Ga0307408_100000924 3300031548 Bacteria 22892
286 Ga0307408_100461343 3300031548 Bacteria 1104
287 Ga0307406_10009503 3300031901 Bacteria 5457
288 Ga0307409_100113124 3300031995 Bacteria 2281
289 Ga0307416_100085558 3300032002 Bacteria 2684
290 Ga0307416_100182687 3300032002 Bacteria 1967
291 Ga0373953_0187394 3300035117 Bacteria 893
292 Ga0373943_0019026 3300035170 Bacteria 3158
293 Ga0373943_0049833 3300035170 Bacteria 2056
294 Ga0373955_0007419 3300035172 Bacteria 5043
295 Ga0373924_0100121 3300035410 Bacteria 1246
296 Ga0373937_0007942 3300036401 Bacteria 9200
297 Ga0373925_0842082 3300037068 Unclassified 756
298 Ga0395899_0000005 3300037312 Bacteria 772966
299 Ga0395899_0007201 3300037312 Bacteria 8612
300 Ga0395899_0061056 3300037312 Bacteria 2776
301 Ga0395900_0000003 3300037418 Bacteria 587648
302 Ga0395900_0000813 3300037418 Bacteria 41294
303 Ga0395900_0147474 3300037418 Bacteria 2406
304 Ga0395900_0210989 3300037418 Bacteria 1961
305 Ga0395900_0734975 3300037418 Bacteria 918
306 Ga0395898_0000003 3300037466 Bacteria 772986
307 Ga0395898_0007248 3300037466 Bacteria 11769
308 Ga0395898_0159399 3300037466 Bacteria 2158
309 Ga0395905_0098233 3300037471 Bacteria 2749
310 Ga0395901_0090666 3300038443 Bacteria 3199
311 Ga0395901_0112949 3300038443 Bacteria 2853
312 Ga0395901_0980488 3300038443 Bacteria 822
313 Ga0436363_0248664 3300039450 Bacteria 2108
314 Ga0439439_0008658 3300041406 Bacteria 2407
315 Ga0451793_0939725 3300041452 Bacteria 947
316 Ga0451853_3240560 3300041512 Bacteria 2489
317 Ga0439431_0174941 3300041997 Bacteria 618
318 Ga0439433_0049465 3300041999 Bacteria 989
319 Ga0439456_049985 3300042013 Bacteria 913
320 Ga0450898_090598 3300042134 Bacteria 630
321 Ga0466966_0000029 3300044684 Bacteria 104527
322 Ga0466966_0155982 3300044684 Unclassified 1391
323 Ga0466961_0001550 3300044693 Bacteria 14217
324 Ga0466961_0268706 3300044693 Unclassified 1045
325 Ga0466963_0069947 3300044694 Bacteria 2360
326 Ga0466959_0022599 3300045049 Bacteria 4650
327 Ga0466958_0001037 3300045836 Bacteria 12696
328 Ga0466958_0023039 3300045836 Bacteria 3651
329 Ga0466958_0077410 3300045836 Bacteria 2042
330 Ga0495592_0009573 3300046454 Bacteria 7291
331 Ga0495651_0087191 3300046462 Bacteria 2347
332 Ga0495651_0168314 3300046462 Bacteria 1563
333 Ga0495653_0074129 3300046463 Bacteria 2537
334 Ga0495580_0000096 3300046472 Bacteria 58226
335 Ga0495582_0018293 3300046473 Unclassified 3833
336 Ga0495605_0045052 3300046474 Bacteria 2176
337 Ga0495608_0044400 3300046511 Bacteria 2966
338 Ga0495628_0012545 3300046516 Bacteria 7141
339 Ga0495628_0086019 3300046516 Bacteria 2438
340 Ga0495630_0007886 3300046517 Bacteria 7634
341 Ga0495630_0225848 3300046517 Bacteria 1430
342 Ga0495648_0129890 3300046524 Bacteria 1341
343 Ga0495666_0002035 3300046526 Bacteria 9997
344 Ga0495652_0066549 3300046529 Bacteria 3023
345 Ga0495645_0013417 3300046543 Bacteria 5791
346 Ga0495667_0022910 3300046559 Bacteria 4208
347 Ga0495634_0080542 3300046642 Bacteria 2131
348 Ga0495635_0092797 3300046663 Bacteria 2065
349 Ga0495588_0127924 3300046674 Bacteria 1340
350 Ga0495657_0054289 3300046675 Bacteria 2678
351 Ga0495599_0008910 3300046678 Bacteria 6107
352 Ga0495623_0224154 3300046679 Bacteria 1069
353 Ga0495646_0010234 3300046680 Bacteria 5966
354 Ga0495646_0258682 3300046680 Bacteria 930
355 Ga0495647_0050077 3300046681 Bacteria 1620
356 Ga0495647_0054103 3300046681 Bacteria 1567
357 Ga0495658_0005188 3300046683 Bacteria 6406
358 Ga0495624_0000173 3300046690 Bacteria 47741
359 Ga0495649_0040769 3300046694 Bacteria 2541
360 Ga0495600_0029331 3300046809 Bacteria 3562
361 Ga0495604_0084150 3300047317 Bacteria 2376
362 Ga0495604_0159403 3300047317 Bacteria 1595
363 Ga0495674_0378786 3300047319 Bacteria 1145
364 Ga0495680_0074303 3300047322 Bacteria 2582
365 Ga0495680_0379288 3300047322 Bacteria 980
366 Ga0495675_0006257 3300047444 Bacteria 7284
367 Ga0495684_0042807 3300047471 Bacteria 3468
368 Ga0495684_0054393 3300047471 Bacteria 3053
369 Ga0495602_0063017 3300048088 Bacteria 3215
370 Ga0496101_0036970 3300048904 Bacteria 3461
371 Ga0496102_0239211 3300048905 Bacteria 1712
372 Ga0496104_0017227 3300048907 Bacteria 6574
373 Ga0496105_0223768 3300048908 Bacteria 1531
374 Ga0496106_0125738 3300048909 Bacteria 2007
375 Ga0496108_0003048 3300048911 Bacteria 13468
376 Ga0496109_0152263 3300048912 Bacteria 2165
377 Ga0496110_0029215 3300048913 Bacteria 4742
378 Ga0496111_0019297 3300048914 Bacteria 4734
379 Ga0496116_0003876 3300048919 Bacteria 14580
380 Ga0496126_0000272 3300048929 Bacteria 110072
381 Ga0501034_0533749 3300049571 Bacteria 1084
382 Ga0501067_0221351 3300049583 Bacteria 1054
383 Ga0501070_0041479 3300049586 Bacteria 3834
384 Ga0501070_0099521 3300049586 Bacteria 2405
385 Ga0501073_0192912 3300049589 Unclassified 1410
386 Ga0501083_0111364 3300049744 Unclassified 1799
387 nmdc:mga03n38_221903_c1 3300050490 Bacteria 987
388 nmdc:mga0k408_285320_c1 3300050493 Unclassified 985
389 nmdc:mga0k408_289144_c1 3300050493 Bacteria 978
390 nmdc:mga0k408_462548_c1 3300050493 Bacteria 753
391 nmdc:mga07m45_221958_c1 3300050496 Bacteria 1099
392 nmdc:mga08y16_794372_c1 3300050511 Bacteria 940
393 nmdc:mga0n895_885739_c1 3300050512 Bacteria 879
394 Ga0495595_0052098 3300053084 Bacteria 1898
395 Ga0495595_0253306 3300053084 Bacteria 882
396 Ga0495619_0050061 3300053085 Bacteria 2757
397 Ga0495619_0308738 3300053085 Bacteria 1096
398 Ga0500644_0004454 3300053088 Bacteria 3505
399 Ga0500593_000324 3300053117 Bacteria 19240
400 Ga0500645_000155 3300053730 Bacteria 53212
401 Ga0500661_001017 3300055283 Bacteria 5274
402 Ga0501082_0078427 3300060353 Bacteria 2849
403 Ga0466962_0044581 3300061719 Bacteria 2122
404 Ga0466962_0137816 3300061719 Bacteria 1181
405 2511246975 2511231002 Bacteria 5042903
406 2526213409 2526164512 Bacteria 4025691
407 2600815459 2600255067 Bacteria 6795583
408 2881105501 2881101125 Bacteria 4590519
409 2939634036 2939631187 Bacteria 6118131
410 rootH1_10198975
411 JGI24752J21851_1004308
412 JGI24751J29686_10008112
413 JGI25155J39150_1000036
414 JGI25156J39149_1000047
415 JGI25154J39366_1000068
416 JGI25157J39369_1000066
417 JGI25150J39212_1007145
418 JGI25150J39212_1009406
419 JGI25159J45721_1000180
420 JGI25159J45721_1002272
421 JGI25151J46595_10001766
422 JGI25151J46595_10008163
423 JGI25151J46595_10013976
424 JGI25160J50197_1000145
425 JGI25160J50197_1000331
426 JGI25161J50226_1000064
427 Ga0055526_1003813
428 Ga0055526_1008976
429 Ga0055537_1000043
430 Ga0055537_1000046
431 Ga0055537_1001296
432 Ga0055524_1000012
433 Ga0055524_1001013
434 Ga0055536_1000914
435 Ga0055534_1000421
436 Ga0055534_1002613
437 Ga0055534_1014702
438 Ga0055528_1002287
439 Ga0055530_10000015
440 Ga0055540_1000039
441 Ga0055540_1005678
442 Ga0055531_10004016
443 Ga0055531_10006290
444 Ga0055543_1000284
445 Ga0065165_1016332
446 Ga0065165_1020983
447 Ga0065165_1039257
448 Ga0065165_1051415
449 Ga0065712_10071201
450 Ga0065712_10107144
451 Ga0070658_10063421
452 Ga0070658_10511304
453 Ga0070683_100056190
454 Ga0070683_100100812
455 Ga0070690_100003351
456 Ga0070670_100004034
457 Ga0070670_100009833
458 Ga0070677_10003475
459 Ga0068869_100001882
460 Ga0070666_10012596
461 Ga0070680_100070433
462 Ga0068868_100006888
463 Ga0070660_100039050
464 Ga0070689_100008520
465 Ga0070689_100018826
466 Ga0070661_100013165
467 Ga0070661_100026081
468 Ga0070661_100054829
469 Ga0070661_100687068
470 Ga0070668_100015343
471 Ga0070669_100009757
472 Ga0070675_100083907
473 Ga0070675_100284303
474 Ga0070675_100291469
475 Ga0070671_100013889
476 Ga0070671_100061498
477 Ga0070671_100461642
478 Ga0070674_100080408
479 Ga0070674_100086219
480 Ga0070674_100242058
481 Ga0070673_100307149
482 Ga0070688_100006046
483 Ga0070688_100031088
484 Ga0070659_100021327
485 Ga0070659_100041792
486 Ga0070659_100610355
487 Ga0070667_100141631
488 Ga0070709_10000399
489 Ga0070713_100000129
490 Ga0070711_100125708
491 Ga0070705_100191501
492 Ga0070663_100004758
493 Ga0070663_100032748
494 Ga0070678_100014849
495 Ga0070662_100007839
496 Ga0068867_100016499
497 Ga0070685_10001552
498 Ga0070685_10009168
499 Ga0070707_100107367
500 Ga0070684_100026859
501 Ga0068853_100053476
502 Ga0070672_100024035
503 Ga0070672_100232999
504 Ga0070696_100183375
505 Ga0070665_100034551
506 Ga0068855_100019638
507 Ga0068855_100256592
508 Ga0068855_100642671
509 Ga0070664_100169305
510 Ga0070664_100190320
511 Ga0068857_100040747
512 Ga0068857_100142432
513 Ga0068857_100184285
514 Ga0068857_100510393
515 Ga0068854_100027679
516 Ga0068852_100005946
517 Ga0068852_100012838
518 Ga0068859_100006924
519 Ga0068859_100018470
520 Ga0068864_100000086
521 Ga0068864_100024269
522 Ga0068864_100479015
523 Ga0068861_100008696
524 Ga0068851_10001375
525 Ga0068851_10001462
526 Ga0068870_10001621
527 Ga0068863_100360858
528 Ga0068858_100009676
529 Ga0068858_100572607
530 Ga0068860_100008702
531 Ga0068862_100007099
532 Ga0075364_10065949
533 Ga0075364_10158527
534 Ga0070712_100151002
535 Ga0075362_10044492
536 Ga0075366_10290167
537 Ga0097621_100004975
538 Ga0097621_100033662
539 Ga0097621_100234641
540 Ga0068871_100004053
541 Ga0068871_100177494
542 Ga0068871_100636928
543 Ga0075428_100019720
544 Ga0075434_100428322
545 Ga0075434_100851496
546 Ga0068865_100010411
547 Ga0097620_100006923
548 Ga0097620_100018470
549 Ga0079104_1012919
550 Ga0105240_10576415
551 Ga0111539_10514632
552 Ga0105247_10268637
553 Ga0105248_10133553
554 Ga0105248_10500330
555 Ga0105237_10223513
556 Ga0105249_10016969
557 Ga0157370_10004009
558 Ga0157369_10008416
559 Ga0157369_10289282
560 Ga0157374_10006220
561 Ga0157378_10005489
562 Ga0163162_10008794
563 Ga0157372_10301427
564 Ga0157375_10186955
565 Ga0163163_10003519
566 Ga0157380_10006260
567 Ga0157380_10032123
568 Ga0157377_10003909
569 Ga0157379_10008160
570 Ga0157376_10009513
571 Ga0157376_10161707
572 Ga0163161_10002291
573 Ga0209435_100001
574 Ga0209436_114188
575 Ga0207425_1004333
576 Ga0207425_1009431
577 Ga0209646_1000001
578 Ga0209026_1000003
579 Ga0209759_1000001
580 Ga0209129_1010931
581 Ga0209565_1000004
582 Ga0209565_1000201
583 Ga0209565_1001101
584 Ga0207666_1018422
585 Ga0209673_1000221
586 Ga0209130_1000094
587 Ga0209130_1000855
588 Ga0207673_1006251
589 Ga0209675_1000061
590 Ga0209675_1000623
591 Ga0209675_1002004
592 Ga0209675_1002958
593 Ga0209676_1000029
594 Ga0209676_1001690
595 Ga0209676_1020006
596 Ga0209025_1002533
597 Ga0209025_1003079
598 Ga0209025_1006708
599 Ga0209025_1007278
600 Ga0209025_1038832
601 Ga0209025_1045823
602 Ga0209564_1000578
603 Ga0209564_1000681
604 Ga0209564_1001132
605 Ga0209564_1009263
606 Ga0209758_1016251
607 Ga0209758_1022986
608 Ga0209758_1036695
609 Ga0209050_1000003
610 Ga0209050_1006588
611 Ga0209256_1000001
612 Ga0209256_1002198
613 Ga0207426_1000025
614 Ga0207426_1002215
615 Ga0209051_1000003
616 Ga0209051_1000587
617 Ga0209051_1017051
618 Ga0209257_1000018
619 Ga0209257_1000137
620 Ga0209257_1061838
621 Ga0207697_10000698
622 Ga0207656_10003735
623 Ga0207656_10006346
624 Ga0207682_10001751
625 Ga0207688_10004148
626 Ga0207680_10039558
627 Ga0207680_10240888
628 Ga0207699_10000272
629 Ga0207645_10006100
630 Ga0207643_10000513
631 Ga0207643_10026359
632 Ga0207705_10168824
633 Ga0207705_10655783
634 Ga0207693_10159855
635 Ga0207660_10067470
636 Ga0207657_10357392
637 Ga0207649_10022304
638 Ga0207649_10038985
639 Ga0207681_10080409
640 Ga0207681_10188122
641 Ga0207650_10017220
642 Ga0207650_10178541
643 Ga0207659_10034602
644 Ga0207659_10310184
645 Ga0207700_10000044
646 Ga0207644_10029882
647 Ga0207644_10103583
648 Ga0207706_10002582
649 Ga0207670_10060421
650 Ga0207670_10148922
651 Ga0207669_10036293
652 Ga0207669_10285657
653 Ga0207704_10012986
654 Ga0207691_10015693
655 Ga0207691_10049250
656 Ga0207711_10047221
657 Ga0207689_10001702
658 Ga0207689_10078081
659 Ga0207679_10013904
660 Ga0207679_10021536
661 Ga0207679_10095823
662 Ga0207667_10148679
663 Ga0207651_10201450
664 Ga0207651_10215464
665 Ga0207651_11123561
666 Ga0207712_10069545
667 Ga0207668_10598103
668 Ga0207658_10022788
669 Ga0207677_10041826
670 Ga0207703_10033330
671 Ga0207703_11054168
672 Ga0207639_10108783
673 Ga0207639_10160588
674 Ga0207678_10024037
675 Ga0207678_10025295
676 Ga0207702_10486606
677 Ga0207641_10037859
678 Ga0207648_10007960
679 Ga0207676_10000086
680 Ga0207676_10286348
681 Ga0207674_10003670
682 Ga0207674_10021512
683 Ga0207674_10121336
684 Ga0207674_10123567
685 Ga0207674_10332037
686 Ga0207675_100005844
687 Ga0207675_101152636
688 Ga0207683_10001701
689 Ga0207698_10024819
690 Ga0207698_10029010
691 Ga0209281_1011212
692 Ga0268266_10153841
693 Ga0268264_10185756
694 Ga0307408_100000924
695 Ga0307408_100461343
696 Ga0307406_10009503
697 Ga0307409_100113124
698 Ga0307416_100085558
699 Ga0307416_100182687
700 Ga0373953_0187394
701 Ga0373943_0019026
702 Ga0373943_0049833
703 Ga0373955_0007419
704 Ga0373924_0100121
705 Ga0373937_0007942
706 Ga0373925_0842082
707 Ga0395899_0000005
708 Ga0395899_0007201
709 Ga0395899_0061056
710 Ga0395900_0000003
711 Ga0395900_0000813
712 Ga0395900_0147474
713 Ga0395900_0210989
714 Ga0395900_0734975
715 Ga0395898_0000003
716 Ga0395898_0007248
717 Ga0395898_0159399
718 Ga0395905_0098233
719 Ga0395901_0090666
720 Ga0395901_0112949
721 Ga0395901_0980488
722 Ga0436363_0248664
723 Ga0439439_0008658
724 Ga0451793_0939725
725 Ga0451853_3240560
726 Ga0439431_0174941
727 Ga0439433_0049465
728 Ga0439456_049985
729 Ga0450898_090598
730 Ga0466966_0000029
731 Ga0466966_0155982
732 Ga0466961_0001550
733 Ga0466961_0268706
734 Ga0466963_0069947
735 Ga0466959_0022599
736 Ga0466958_0001037
737 Ga0466958_0023039
738 Ga0466958_0077410
739 Ga0495592_0009573
740 Ga0495651_0087191
741 Ga0495651_0168314
742 Ga0495653_0074129
743 Ga0495580_0000096
744 Ga0495582_0018293
745 Ga0495605_0045052
746 Ga0495608_0044400
747 Ga0495628_0012545
748 Ga0495628_0086019
749 Ga0495630_0007886
750 Ga0495630_0225848
751 Ga0495648_0129890
752 Ga0495666_0002035
753 Ga0495652_0066549
754 Ga0495645_0013417
755 Ga0495667_0022910
756 Ga0495634_0080542
757 Ga0495635_0092797
758 Ga0495588_0127924
759 Ga0495657_0054289
760 Ga0495599_0008910
761 Ga0495623_0224154
762 Ga0495646_0010234
763 Ga0495646_0258682
764 Ga0495647_0050077
765 Ga0495647_0054103
766 Ga0495658_0005188
767 Ga0495624_0000173
768 Ga0495649_0040769
769 Ga0495600_0029331
770 Ga0495604_0084150
771 Ga0495604_0159403
772 Ga0495674_0378786
773 Ga0495680_0074303
774 Ga0495680_0379288
775 Ga0495675_0006257
776 Ga0495684_0042807
777 Ga0495684_0054393
778 Ga0495602_0063017
779 Ga0496101_0036970
780 Ga0496102_0239211
781 Ga0496104_0017227
782 Ga0496105_0223768
783 Ga0496106_0125738
784 Ga0496108_0003048
785 Ga0496109_0152263
786 Ga0496110_0029215
787 Ga0496111_0019297
788 Ga0496116_0003876
789 Ga0496126_0000272
790 Ga0501034_0533749
791 Ga0501067_0221351
792 Ga0501070_0041479
793 Ga0501070_0099521
794 Ga0501073_0192912
795 Ga0501083_0111364
796 nmdc:mga03n38_221903_c1
797 nmdc:mga0k408_285320_c1
798 nmdc:mga0k408_289144_c1
799 nmdc:mga0k408_462548_c1
800 nmdc:mga07m45_221958_c1
801 nmdc:mga08y16_794372_c1
802 nmdc:mga0n895_885739_c1
803 Ga0495595_0052098
804 Ga0495595_0253306
805 Ga0495619_0050061
806 Ga0495619_0308738
807 Ga0500644_0004454
808 Ga0500593_000324
809 Ga0500645_000155
810 Ga0500661_001017
811 Ga0501082_0078427
812 Ga0466962_0044581
813 Ga0466962_0137816
814 2511246975
815 2526213409
816 2600815459
817 2881105501
818 2939634036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

170

226

0.97

PF00072

Response_reg

Response regulator receiver domain

27

139

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9738 145 208
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9724 145 209
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9706 145 209
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9678 146 209
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9645 145 209
ID Description Score Start End Superfamily
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9784 148 205 1.10.10.10
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9745 148 205 1.10.10.10
4if4B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9663 145 210 1.10.10.10
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.965 144 210 1.10.10.10
4if4D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9617 144 210 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3A4RAF8-F1-model_v4 DNA-binding response regulator 0.9668 1 210 GO:0000160
GO:0003677
GO:0006355
AF-A0A258NGY1-F1-model_v4 DNA-binding response regulator 0.9636 1 210 GO:0000160
GO:0003677
GO:0006355
AF-A0A3A4RAF8-F1-model_v4 DNA-binding response regulator 0.9623 1 210 GO:0000160
GO:0003677
GO:0006355
AF-A0A4Y7B914-F1-model_v4 deleted 0.962 1 208
AF-A0A543L9M2-F1-model_v4 LuxR family two component transcriptional regulator 0.9605 1 210 GO:0000160
GO:0003677
GO:0006355

Map