F436898

General Info

Members Datasets Scaffolds Average Seq Length
409 253 368 279

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10070185|Ga0065704_100701853
Length 311
Sequence MALTKSNSLLLLSLDQSLTTMTFSINAEIHQFQGKLLKLSHESAVTKTKMDVNVFLPPSALEKSSSKIPVLLYLSGLTCTPNNASEKSFIQYFAGKYGLAVVFPDTSPRGASIAGEDDSWDFGTGAGFYVDATQEPWSTNYNMYTYVHEELQAGLAGEFPQLDFLNISITGHSMGGFGALSGFFRNPGKYKSVSAFAPISNPSTCQWGEKNFGNYLGSNKEDWYAYDPTHLVGKYTHSNQPPILIHQGSQDGFYFKDHQLQPEIFVKAAQDAGYQGGVDLRIVDGDHSYFFISSFVEDHVKHHGKYLGLKL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
6 2511231024 Pseudomonas sp. GM84 Isolate Nodule
7 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
8 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
9 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
10 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
11 2643221559 Lysobacter sp. Root559 Isolate Unclassified
12 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
13 2643221586 Lysobacter sp. Root667 Isolate Unclassified
14 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
15 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
16 2643221612 Lysobacter sp. Root76 Isolate Unclassified
17 2643221727 Lysobacter sp. Root96 Isolate Unclassified
18 2643221729 Bacillus sp. Root11 Isolate Unclassified
19 2643221730 Bacillus sp. Root131 Isolate Unclassified
20 2765235841 Pseudomonas putida AA7 Isolate Unclassified
21 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
22 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
23 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
24 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
25 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
26 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
27 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
28 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
29 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
30 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
31 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
32 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
33 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
34 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
35 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
36 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
37 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
38 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
39 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
40 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
41 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
42 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
43 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
44 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
45 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
46 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
47 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
51 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
53 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
54 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
57 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
146 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
152 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
172 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
173 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
174 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
175 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
178 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
179 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
180 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
181 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
182 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
201 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
202 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
203 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
206 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
207 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
222 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
223 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
224 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
242 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
243 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
244 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
245 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
246 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
247 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
248 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
249 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
250 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
251 8052494512 Pseudomonas putida LD6 Isolate Unclassified
252 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
253 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.73
Metatranscriptomes 0.24
Isolates 10.02

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 12.71
Nodule 1.47
Rhizoplane 2.2
Rhizosphere 71.15
Stem 0
Stem Tuber 0
Unclassified 12.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2017140 2162886007 Bacteria 3249
2 SwRhRL2b_contig_539090 2162886007 Eukaryota 13338
3 JGI24736J21556_1002133 3300001904 Bacteria 3511
4 JGI24735J21928_10002384 3300002067 Bacteria 6529
5 JGI25150J39212_1000838 3300002774 Bacteria 10284
6 rootH1_10115271 3300003323 Bacteria 3398
7 rootH1_10137228 3300003323 Bacteria 6362
8 Ga0055527_1000069 3300003760 Bacteria 86420
9 Ga0055535_1000196 3300003761 Bacteria 64217
10 Ga0055542_1000225 3300003762 Bacteria 67292
11 Ga0055529_1000719 3300003763 Bacteria 21799
12 Ga0055526_1003113 3300003771 Bacteria 10752
13 Ga0055537_1000809 3300003773 Bacteria 15484
14 Ga0055536_1000929 3300003781 Bacteria 18855
15 Ga0055536_1005881 3300003781 Bacteria 5882
16 Ga0055536_1017258 3300003781 Bacteria 2372
17 Ga0055530_10000632 3300003791 Bacteria 30392
18 Ga0055530_10012683 3300003791 Bacteria 2924
19 Ga0055531_10000643 3300003794 Bacteria 30167
20 Ga0055531_10010696 3300003794 Bacteria 4525
21 Ga0055531_10012538 3300003794 Bacteria 3978
22 Ga0058692_1000013 3300003856 Bacteria 316299
23 Ga0058692_1022873 3300003856 Bacteria 1279
24 Ga0065714_10092244 3300005288 Bacteria 1884
25 Ga0065704_10003640 3300005289 Bacteria 4109
26 Ga0065704_10070185 3300005289 Eukaryota 118643
27 Ga0065704_10071509 3300005289 Bacteria 10859
28 Ga0065707_10082493 3300005295 Eukaryota 14559
29 Ga0070658_10000238 3300005327 Bacteria 48804
30 Ga0070658_10007496 3300005327 Bacteria 8804
31 Ga0070658_10008715 3300005327 Bacteria 8145
32 Ga0070658_10013618 3300005327 Bacteria 6525
33 Ga0070658_10364045 3300005327 Bacteria 1239
34 Ga0070683_100073827 3300005329 Bacteria 3184
35 Ga0070683_100186162 3300005329 Bacteria 1971
36 Ga0070690_100000629 3300005330 Bacteria 17895
37 Ga0070680_100138566 3300005336 Bacteria 2039
38 Ga0070680_100187017 3300005336 Bacteria 1745
39 Ga0070660_100003340 3300005339 Bacteria 11025
40 Ga0070660_100017837 3300005339 Bacteria 5177
41 Ga0070692_10008255 3300005345 Bacteria 4638
42 Ga0070692_10022132 3300005345 Bacteria 3102
43 Ga0070692_10053669 3300005345 Bacteria 2102
44 Ga0070692_10259414 3300005345 Bacteria 1044
45 Ga0070668_100078071 3300005347 Bacteria 2589
46 Ga0070668_100088664 3300005347 Bacteria 2436
47 Ga0070659_100013082 3300005366 Bacteria 6171
48 Ga0070713_100022944 3300005436 Bacteria 4832
49 Ga0070663_100023189 3300005455 Bacteria 4157
50 Ga0070681_10017295 3300005458 Bacteria 7206
51 Ga0070679_100168789 3300005530 Bacteria 2161
52 Ga0070679_100302663 3300005530 Bacteria 1549
53 Ga0070684_100301592 3300005535 Bacteria 1470
54 Ga0068853_100330083 3300005539 Bacteria 1415
55 Ga0070696_100025312 3300005546 Bacteria 4034
56 Ga0068855_100015155 3300005563 Bacteria 9283
57 Ga0068855_100055484 3300005563 Bacteria 4653
58 Ga0068855_100057269 3300005563 Bacteria 4569
59 Ga0068855_100084892 3300005563 Bacteria 3664
60 Ga0068857_100067268 3300005577 Bacteria 3189
61 Ga0068857_100075023 3300005577 Bacteria 3015
62 Ga0068854_100027225 3300005578 Bacteria 3938
63 Ga0068854_100141764 3300005578 Bacteria 1845
64 Ga0068854_100212962 3300005578 Bacteria 1525
65 Ga0068854_100443307 3300005578 Bacteria 1083
66 Ga0068856_100053967 3300005614 Bacteria 3963
67 Ga0068856_100353313 3300005614 Bacteria 1488
68 Ga0068856_100584880 3300005614 Bacteria 1138
69 Ga0068852_100006077 3300005616 Bacteria 8700
70 Ga0068852_100240588 3300005616 Bacteria 1729
71 Ga0068859_100037371 3300005617 Bacteria 4873
72 Ga0068864_100000138 3300005618 Bacteria 69979
73 Ga0068864_100093643 3300005618 Bacteria 2654
74 Ga0068861_100096044 3300005719 Bacteria 2348
75 Ga0068861_100321922 3300005719 Bacteria 1347
76 Ga0068863_100023527 3300005841 Bacteria 5881
77 Ga0068863_100028016 3300005841 Bacteria 5378
78 Ga0068858_100013876 3300005842 Bacteria 7601
79 Ga0068862_100000023 3300005844 Bacteria 203389
80 Ga0075432_10040253 3300006058 Bacteria 1631
81 Ga0075369_10005964 3300006186 Bacteria 4585
82 Ga0075369_10008461 3300006186 Bacteria 3959
83 Ga0097620_100037371 3300006931 Bacteria 4873
84 Ga0099823_1000119 3300006944 Bacteria 39691
85 Ga0105251_10003015 3300009011 Bacteria 12560
86 Ga0105251_10013088 3300009011 Bacteria 4658
87 Ga0105244_10008321 3300009036 Bacteria 6487
88 Ga0105244_10013314 3300009036 Bacteria 4814
89 Ga0105244_10036839 3300009036 Bacteria 2560
90 Ga0105244_10043052 3300009036 Bacteria 2331
91 Ga0105250_10089065 3300009092 Bacteria 1254
92 Ga0105240_10001427 3300009093 Bacteria 40903
93 Ga0105240_10023493 3300009093 Bacteria 8150
94 Ga0105240_10037558 3300009093 Bacteria 6224
95 Ga0105245_10102919 3300009098 Bacteria 2645
96 Ga0105247_10150731 3300009101 Bacteria 1532
97 Ga0105248_10045091 3300009177 Bacteria 4944
98 Ga0105238_10004619 3300009551 Bacteria 13631
99 Ga0105239_10200778 3300010375 Bacteria 2234
100 Ga0157373_10249073 3300013100 Bacteria 1256
101 Ga0157371_10017541 3300013102 Bacteria 5316
102 Ga0157371_10018682 3300013102 Bacteria 5122
103 Ga0157371_10306102 3300013102 Bacteria 1151
104 Ga0157370_10333890 3300013104 Bacteria 1397
105 Ga0157370_10351725 3300013104 Bacteria 1358
106 Ga0157370_10397215 3300013104 Bacteria 1269
107 Ga0157369_10000751 3300013105 Bacteria 41778
108 Ga0157369_10581400 3300013105 Bacteria 1157
109 Ga0157369_10667884 3300013105 Bacteria 1071
110 Ga0163162_10079970 3300013306 Bacteria 3335
111 Ga0157372_10000663 3300013307 Bacteria 37808
112 Ga0157372_10629400 3300013307 Bacteria 1250
113 Ga0157380_10055283 3300014326 Bacteria 3152
114 Ga0182006_1010125 3300015261 Bacteria 4200
115 Ga0163161_10043858 3300017792 Bacteria 3221
116 Ga0209672_100007 3300025228 Bacteria 959482
117 Ga0209563_100074 3300025230 Bacteria 224912
118 Ga0209258_100017 3300025242 Bacteria 590785
119 Ga0207425_1026236 3300025245 Bacteria 1197
120 Ga0209148_1000044 3300025254 Bacteria 458417
121 Ga0209565_1000166 3300025263 Bacteria 85898
122 Ga0209455_1000010 3300025272 Bacteria 959482
123 Ga0209673_1004601 3300025273 Bacteria 7314
124 Ga0209673_1010772 3300025273 Bacteria 3826
125 Ga0209675_1000184 3300025291 Bacteria 70175
126 Ga0209676_1000133 3300025292 Bacteria 184430
127 Ga0209676_1000174 3300025292 Bacteria 153292
128 Ga0209676_1000246 3300025292 Bacteria 116315
129 Ga0209676_1004515 3300025292 Bacteria 7717
130 Ga0209676_1038537 3300025292 Bacteria 1367
131 Ga0209025_1011826 3300025294 Bacteria 5686
132 Ga0209564_1003037 3300025295 Bacteria 11946
133 Ga0209564_1009572 3300025295 Bacteria 4588
134 Ga0209050_1000067 3300025298 Bacteria 304206
135 Ga0209050_1011497 3300025298 Bacteria 4186
136 Ga0209050_1018145 3300025298 Bacteria 2751
137 Ga0209050_1031739 3300025298 Bacteria 1639
138 Ga0209257_1000132 3300025304 Bacteria 210870
139 Ga0209257_1000169 3300025304 Bacteria 171227
140 Ga0209257_1001127 3300025304 Bacteria 34354
141 Ga0209257_1004707 3300025304 Bacteria 10238
142 Ga0209257_1014954 3300025304 Bacteria 3278
143 Ga0207697_10036341 3300025315 Bacteria 2017
144 Ga0207696_1000164 3300025711 Bacteria 106057
145 Ga0207696_1005732 3300025711 Bacteria 5107
146 Ga0207696_1024751 3300025711 Bacteria 1879
147 Ga0207655_1001023 3300025728 Bacteria 28252
148 Ga0207655_1001253 3300025728 Bacteria 24224
149 Ga0207655_1008244 3300025728 Bacteria 6640
150 Ga0207655_1053642 3300025728 Bacteria 1609
151 Ga0207713_1002039 3300025735 Bacteria 15121
152 Ga0207713_1045241 3300025735 Bacteria 1800
153 Ga0207710_10091581 3300025900 Bacteria 1423
154 Ga0207647_10009953 3300025904 Bacteria 6734
155 Ga0207647_10062237 3300025904 Bacteria 2274
156 Ga0207705_10000014 3300025909 Bacteria 434286
157 Ga0207705_10000033 3300025909 Bacteria 223997
158 Ga0207705_10000294 3300025909 Bacteria 46555
159 Ga0207705_10002417 3300025909 Bacteria 14410
160 Ga0207705_10007268 3300025909 Bacteria 8147
161 Ga0207705_10036966 3300025909 Bacteria 3495
162 Ga0207705_10215143 3300025909 Bacteria 1458
163 Ga0207705_10257405 3300025909 Bacteria 1332
164 Ga0207705_10257975 3300025909 Bacteria 1331
165 Ga0207695_10003164 3300025913 Bacteria 23468
166 Ga0207695_10003918 3300025913 Bacteria 20595
167 Ga0207657_10000659 3300025919 Bacteria 36733
168 Ga0207657_10007485 3300025919 Bacteria 11190
169 Ga0207657_10069344 3300025919 Bacteria 2992
170 Ga0207649_10000848 3300025920 Bacteria 19645
171 Ga0207649_10354754 3300025920 Bacteria 1086
172 Ga0207694_10124014 3300025924 Bacteria 2065
173 Ga0207650_10007250 3300025925 Bacteria 7552
174 Ga0207690_10013336 3300025932 Bacteria 4937
175 Ga0207709_10027351 3300025935 Bacteria 3285
176 Ga0207711_10238775 3300025941 Bacteria 1666
177 Ga0207689_10532923 3300025942 Bacteria 985
178 Ga0207661_10062125 3300025944 Bacteria 3021
179 Ga0207667_10030674 3300025949 Bacteria 5812
180 Ga0207640_10020248 3300025981 Bacteria 3948
181 Ga0207703_10010462 3300026035 Bacteria 7253
182 Ga0207639_10010296 3300026041 Bacteria 6472
183 Ga0207639_10332681 3300026041 Bacteria 1352
184 Ga0207678_10010180 3300026067 Bacteria 8256
185 Ga0207702_10039713 3300026078 Bacteria 3945
186 Ga0207641_10005531 3300026088 Bacteria 10780
187 Ga0207641_10326022 3300026088 Bacteria 1457
188 Ga0207648_10348076 3300026089 Bacteria 1335
189 Ga0207676_10001900 3300026095 Bacteria 15251
190 Ga0207674_10172089 3300026116 Bacteria 2119
191 Ga0207674_10184158 3300026116 Bacteria 2039
192 Ga0207674_10298964 3300026116 Bacteria 1559
193 Ga0207675_100063446 3300026118 Bacteria 3452
194 Ga0207698_10000697 3300026142 Bacteria 19513
195 Ga0207698_10003840 3300026142 Bacteria 9097
196 Ga0207698_10135961 3300026142 Bacteria 2109
197 Ga0209389_1000205 3300027296 Bacteria 42388
198 Ga0209371_1001098 3300027312 Bacteria 20110
199 Ga0268265_10000035 3300028380 Bacteria 207267
200 Ga0268256_1002086 3300030500 Bacteria 10756
201 Ga0265327_10034673 3300031251 Bacteria 2797
202 Ga0307513_10064140 3300031456 Bacteria 3873
203 Ga0316576_10079514 3300031727 Bacteria 2430
204 Ga0316578_10027881 3300031728 Bacteria 3195
205 Ga0307413_10000079 3300031824 Bacteria 24111
206 Ga0307413_10042299 3300031824 Bacteria 2676
207 Ga0307412_10050723 3300031911 Bacteria 2740
208 Ga0307412_10112057 3300031911 Bacteria 1950
209 Ga0307409_100191804 3300031995 Bacteria 1819
210 Ga0307416_100065818 3300032002 Bacteria 2980
211 Ga0307414_10005038 3300032004 Bacteria 7236
212 Ga0307414_10014923 3300032004 Bacteria 4676
213 Ga0307414_10018410 3300032004 Bacteria 4300
214 Ga0307414_10029070 3300032004 Bacteria 3593
215 Ga0307414_10198117 3300032004 Bacteria 1631
216 Ga0307414_10521763 3300032004 Bacteria 1054
217 Ga0307411_10176809 3300032005 Bacteria 1616
218 Ga0307415_100548904 3300032126 Bacteria 1019
219 Ga0307510_10008816 3300033180 Bacteria 12020
220 Ga0316592_1031506 3300033524 Bacteria 1155
221 Ga0373943_0049392 3300035170 Bacteria 2065
222 Ga0373927_0032130 3300035695 Bacteria 3418
223 Ga0316582_0315680 3300036647 Bacteria 1074
224 Ga0373925_0000804 3300037068 Bacteria 28920
225 Ga0395899_0011973 3300037312 Bacteria 6646
226 Ga0395899_0192101 3300037312 Bacteria 1428
227 Ga0395899_0217588 3300037312 Bacteria 1324
228 Ga0395899_0349267 3300037312 Bacteria 990
229 Ga0395900_0004635 3300037418 Bacteria 14502
230 Ga0395900_0008466 3300037418 Bacteria 10577
231 Ga0395900_0034711 3300037418 Bacteria 5195
232 Ga0395900_0059206 3300037418 Bacteria 3943
233 Ga0395900_0086250 3300037418 Bacteria 3226
234 Ga0395900_0193040 3300037418 Bacteria 2065
235 Ga0395900_0314387 3300037418 Bacteria 1548
236 Ga0395900_0381386 3300037418 Bacteria 1377
237 Ga0395898_0006780 3300037466 Bacteria 12190
238 Ga0395898_0035816 3300037466 Bacteria 4932
239 Ga0395898_0104447 3300037466 Bacteria 2717
240 Ga0395898_0114370 3300037466 Bacteria 2586
241 Ga0395898_0374132 3300037466 Bacteria 1358
242 Ga0395898_0409531 3300037466 Bacteria 1292
243 Ga0395905_0000533 3300037471 Bacteria 52133
244 Ga0395905_0004475 3300037471 Bacteria 14498
245 Ga0395905_0013767 3300037471 Bacteria 7743
246 Ga0395905_0035852 3300037471 Bacteria 4658
247 Ga0395905_0272870 3300037471 Bacteria 1577
248 Ga0395901_0000320 3300038443 Bacteria 59479
249 Ga0395901_0019628 3300038443 Bacteria 6908
250 Ga0395901_0042461 3300038443 Bacteria 4714
251 Ga0395901_0239795 3300038443 Bacteria 1891
252 Ga0439438_002379 3300041405 Bacteria 8020
253 Ga0451797_0426262 3300041453 Bacteria 2576
254 Ga0451806_333236 3300041462 Bacteria 5327
255 Ga0451804_0890657 3300041463 Bacteria 1209
256 Ga0451851_0418188 3300041507 Bacteria 1082
257 Ga0451853_3468116 3300041512 Bacteria 1753
258 Ga0439448_0004366 3300042005 Bacteria 3992
259 Ga0439449_0004334 3300042007 Bacteria 5476
260 Ga0439456_030938 3300042013 Bacteria 1145
261 Ga0439462_0073846 3300042015 Bacteria 927
262 Ga0450902_000033 3300042137 Bacteria 11942
263 Ga0450905_000063 3300042142 Bacteria 9811
264 Ga0451577_0008910 3300042876 Bacteria 9712
265 Ga0466969_0023468 3300044656 Bacteria 3179
266 Ga0466966_0001491 3300044684 Bacteria 15011
267 Ga0466966_0145746 3300044684 Bacteria 1445
268 Ga0466961_0002989 3300044693 Bacteria 10500
269 Ga0466961_0008224 3300044693 Bacteria 6644
270 Ga0466961_0107834 3300044693 Bacteria 1753
271 Ga0466963_0001022 3300044694 Bacteria 14505
272 Ga0466963_0027665 3300044694 Bacteria 3633
273 Ga0466963_0052307 3300044694 Bacteria 2710
274 Ga0466963_0490212 3300044694 Bacteria 868
275 Ga0466964_0028178 3300044706 Bacteria 2211
276 Ga0453684_0265087 3300044712 Bacteria 1966
277 Ga0466971_0000451 3300044719 Bacteria 16041
278 Ga0466971_0017029 3300044719 Bacteria 3213
279 Ga0466971_0040121 3300044719 Bacteria 2102
280 Ga0466970_0009697 3300044765 Bacteria 4871
281 Ga0466970_0078532 3300044765 Bacteria 1781
282 Ga0466957_0004503 3300044842 Bacteria 7777
283 Ga0466957_0096458 3300044842 Bacteria 1858
284 Ga0466957_0190762 3300044842 Bacteria 1342
285 Ga0466959_0004877 3300045049 Bacteria 9080
286 Ga0466958_0001757 3300045836 Bacteria 10500
287 Ga0466958_0042618 3300045836 Bacteria 2733
288 Ga0466967_0002613 3300045976 Bacteria 11331
289 Ga0466967_0255261 3300045976 Bacteria 1676
290 Ga0466967_0554549 3300045976 Bacteria 1131
291 Ga0495627_014489 3300046453 Bacteria 2751
292 Ga0495651_0089175 3300046462 Bacteria 2316
293 Ga0495605_0000323 3300046474 Bacteria 49229
294 Ga0495605_0001417 3300046474 Bacteria 15714
295 Ga0495585_0000145 3300046492 Bacteria 77051
296 Ga0495607_0025164 3300046501 Bacteria 3704
297 Ga0495607_0184121 3300046501 Bacteria 1045
298 Ga0495620_0000003 3300046515 Bacteria 345923
299 Ga0495632_0000003 3300046519 Bacteria 396071
300 Ga0495632_0005427 3300046519 Bacteria 8431
301 Ga0495643_0000917 3300046522 Bacteria 30970
302 Ga0495643_0003034 3300046522 Bacteria 12623
303 Ga0495648_0003944 3300046524 Bacteria 12851
304 Ga0495642_0035390 3300046528 Bacteria 2015
305 Ga0495598_0058532 3300046537 Bacteria 1182
306 Ga0495609_0000210 3300046538 Bacteria 58516
307 Ga0495621_0000192 3300046539 Bacteria 14020
308 Ga0495621_0094966 3300046539 Bacteria 1128
309 Ga0495645_0053340 3300046543 Bacteria 2940
310 Ga0495668_0000002 3300046616 Bacteria 763179
311 Ga0495625_0000263 3300046660 Bacteria 81813
312 Ga0495625_0000655 3300046660 Bacteria 49468
313 Ga0495625_0022386 3300046660 Bacteria 4846
314 Ga0495625_0243109 3300046660 Bacteria 1171
315 Ga0495599_0237647 3300046678 Bacteria 1111
316 Ga0495670_0050601 3300046691 Bacteria 2080
317 Ga0495589_0236112 3300046794 Bacteria 856
318 Ga0495604_0034876 3300047317 Bacteria 3976
319 Ga0495673_0002519 3300047469 Bacteria 12795
320 Ga0496102_0026319 3300048905 Bacteria 5187
321 Ga0496102_0050431 3300048905 Bacteria 3789
322 Ga0496109_0062913 3300048912 Bacteria 3394
323 Ga0496110_0009253 3300048913 Bacteria 7962
324 Ga0496110_0737067 3300048913 Bacteria 888
325 Ga0496114_0039791 3300048917 Bacteria 3891
326 Ga0496117_0006004 3300048920 Bacteria 12502
327 Ga0496117_0007449 3300048920 Bacteria 10690
328 Ga0496117_0019635 3300048920 Bacteria 5542
329 Ga0496118_0003619 3300048921 Bacteria 19184
330 Ga0496118_0005722 3300048921 Bacteria 13986
331 Ga0496119_0000380 3300048922 Bacteria 61208
332 Ga0496120_0002710 3300048923 Bacteria 17352
333 Ga0496121_0053447 3300048924 Bacteria 3384
334 Ga0496121_0315674 3300048924 Bacteria 1054
335 Ga0496121_0460267 3300048924 Bacteria 817
336 Ga0496122_0020829 3300048925 Bacteria 5900
337 Ga0496123_0004350 3300048926 Bacteria 14974
338 Ga0496124_0015039 3300048927 Bacteria 7443
339 Ga0496124_0026028 3300048927 Bacteria 5283
340 Ga0496124_0039946 3300048927 Bacteria 4061
341 Ga0496125_0006982 3300048928 Bacteria 12084
342 Ga0496125_0021739 3300048928 Bacteria 5972
343 Ga0496125_0160180 3300048928 Bacteria 1530
344 Ga0496125_0168097 3300048928 Bacteria 1478
345 Ga0496126_0033545 3300048929 Bacteria 4828
346 Ga0496126_0083343 3300048929 Bacteria 2822
347 Ga0501300_012476 3300049523 Bacteria 1238
348 Ga0501032_0194635 3300049569 Bacteria 1324
349 Ga0501033_0010339 3300049570 Bacteria 7163
350 Ga0501034_0000692 3300049571 Bacteria 51206
351 Ga0501036_0056163 3300049572 Bacteria 3335
352 Ga0501038_0012352 3300049574 Bacteria 7804
353 Ga0501039_0007493 3300049575 Bacteria 8334
354 Ga0501046_0229233 3300049580 Bacteria 1373
355 Ga0501035_0027184 3300049822 Bacteria 5230
356 Ga0501035_0055237 3300049822 Bacteria 3546
357 Ga0501044_0000059 3300049823 Bacteria 134132
358 Ga0501044_0047266 3300049823 Bacteria 4451
359 Ga0501044_0081035 3300049823 Bacteria 3286
360 Ga0500641_0168762 3300053096 Bacteria 942
361 Ga0500593_000265 3300053117 Bacteria 21349
362 Ga0500595_042036 3300053119 Bacteria 1466
363 Ga0500659_0003033 3300053135 Bacteria 9998
364 Ga0500559_0022806 3300053136 Bacteria 2655
365 Ga0500559_0058854 3300053136 Bacteria 1709
366 Ga0500573_0031189 3300053140 Bacteria 3076
367 Ga0500622_0002876 3300053156 Bacteria 12040
368 Ga0466962_0004866 3300061719 Bacteria 6462

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0114370 Ga0395898_0114370_1108_1806 230
2 3300036647 Ga0316582_0315680 Ga0316582_0315680_301_1050 246
3 3300048924 Ga0496121_0460267 Ga0496121_0460267_37_795 247
4 3300009093 Ga0105240_10001427 Ga0105240_1000142725 248
5 3300037466 Ga0395898_0374132 Ga0395898_0374132_539_1291 248
6 3300044693 Ga0466961_0107834 Ga0466961_0107834_977_1732 249
7 3300044694 Ga0466963_0490212 Ga0466963_0490212_90_845 249
8 3300046537 Ga0495598_0058532 Ga0495598_0058532_362_1120 250
9 3300046539 Ga0495621_0094966 Ga0495621_0094966_13_771 250
10 3300046691 Ga0495670_0050601 Ga0495670_0050601_1285_2040 251
11 3300042013 Ga0439456_030938 Ga0439456_030938_135_893 252
12 3300046492 Ga0495585_0000145 Ga0495585_0000145_53457_54215 252
13 3300046660 Ga0495625_0243109 Ga0495625_0243109_14_772 252
14 3300046794 Ga0495589_0236112 Ga0495589_0236112_80_838 252
15 3300048913 Ga0496110_0737067 Ga0496110_0737067_15_782 255
16 3300013102 Ga0157371_10306102 Ga0157371_103061022 256
17 3300005618 Ga0068864_100093643 Ga0068864_1000936432 262
18 3300005841 Ga0068863_100028016 Ga0068863_1000280165 262
19 3300026088 Ga0207641_10326022 Ga0207641_103260222 262
20 3300046528 Ga0495642_0035390 Ga0495642_0035390_630_1493 265
21 3300003323 rootH1_10137228 rootH1_101372282 268
22 3300053156 Ga0500622_0002876 Ga0500622_0002876_6912_7760 269
23 iso_pu_bacteria 2840878972 2840881498 269
24 iso_pu_bacteria 2898795034 2898797159 269
25 iso_pu_bacteria 3000017691 3000019955 269
26 3300010375 Ga0105239_10200778 Ga0105239_102007782 270
27 iso_pu_bacteria 2643221588 2643951573 271
28 iso_pu_bacteria 2643221729 2644702777 271
29 iso_pu_bacteria 2643221730 2644711495 271
30 iso_pu_bacteria 2818991443 2819583944 271
31 iso_pu_bacteria 2501025501 2501076090 272
32 iso_pu_bacteria 2501025504 2501409592 272
33 iso_pu_bacteria 2510917014 2511099122 272
34 iso_pu_bacteria 2510917015 2511108772 272
35 iso_pu_bacteria 2513237082 2513554949 272
36 iso_pu_bacteria 2513237083 2513563064 272
37 iso_pu_bacteria 2547132130 2547499733 272
38 iso_pu_bacteria 2547132130 2547502515 272
39 iso_pu_bacteria 2643221559 2643815954 272
40 iso_pu_bacteria 2643221586 2643939507 272
41 iso_pu_bacteria 2643221612 2644078181 272
42 iso_pu_bacteria 2643221727 2644696484 272
43 iso_pu_bacteria 2816332141 2816518500 272
44 iso_pu_bacteria 2883087390 2883087777 272
45 iso_pu_bacteria 2919134579 2919137268 272
46 iso_pu_bacteria 2919709256 2919710236 272
47 iso_pu_bacteria 8003955200 8003956195 272
48 iso_pu_bacteria 2895498888 2895501915 273
49 iso_pu_bacteria 2895511927 2895517132 273
50 iso_pu_bacteria 2895522137 2895524670 273
51 iso_pu_bacteria 2895525241 2895526215 273
52 3300005327 Ga0070658_10000238 Ga0070658_1000023827 274
53 3300025909 Ga0207705_10000014 Ga0207705_1000001483 274
54 3300025920 Ga0207649_10354754 Ga0207649_103547541 274
55 3300044712 Ga0453684_0265087 Ga0453684_0265087_730_1563 274
56 iso_pu_bacteria 2643221605 2644039553 274
57 3300002774 JGI25150J39212_1000838 JGI25150J39212_10008388 275
58 3300003771 Ga0055526_1003113 Ga0055526_10031135 275
59 3300003773 Ga0055537_1000809 Ga0055537_10008098 275
60 3300003791 Ga0055530_10012683 Ga0055530_100126834 275
61 3300003794 Ga0055531_10012538 Ga0055531_100125384 275
62 3300005327 Ga0070658_10007496 Ga0070658_100074969 275
63 3300005327 Ga0070658_10008715 Ga0070658_100087157 275
64 3300005327 Ga0070658_10013618 Ga0070658_100136187 275
65 3300005330 Ga0070690_100000629 Ga0070690_10000062916 275
66 3300005336 Ga0070680_100187017 Ga0070680_1001870173 275
67 3300005339 Ga0070660_100003340 Ga0070660_10000334014 275
68 3300005345 Ga0070692_10022132 Ga0070692_100221322 275
69 3300005530 Ga0070679_100168789 Ga0070679_1001687892 275
70 3300005546 Ga0070696_100025312 Ga0070696_1000253124 275
71 3300005563 Ga0068855_100055484 Ga0068855_1000554841 275
72 3300005563 Ga0068855_100057269 Ga0068855_1000572693 275
73 3300005577 Ga0068857_100075023 Ga0068857_1000750232 275
74 3300005578 Ga0068854_100027225 Ga0068854_1000272253 275
75 3300005578 Ga0068854_100212962 Ga0068854_1002129622 275
76 3300005614 Ga0068856_100053967 Ga0068856_1000539673 275
77 3300005616 Ga0068852_100006077 Ga0068852_1000060773 275
78 3300005617 Ga0068859_100037371 Ga0068859_1000373717 275
79 3300005618 Ga0068864_100000138 Ga0068864_10000013827 275
80 3300005719 Ga0068861_100096044 Ga0068861_1000960443 275
81 3300005719 Ga0068861_100321922 Ga0068861_1003219222 275
82 3300005841 Ga0068863_100023527 Ga0068863_1000235278 275
83 3300005842 Ga0068858_100013876 Ga0068858_1000138762 275
84 3300005844 Ga0068862_100000023 Ga0068862_10000002348 275
85 3300006931 Ga0097620_100037371 Ga0097620_1000373717 275
86 3300009093 Ga0105240_10023493 Ga0105240_100234933 275
87 3300009101 Ga0105247_10150731 Ga0105247_101507312 275
88 3300009177 Ga0105248_10045091 Ga0105248_100450916 275
89 3300009551 Ga0105238_10004619 Ga0105238_100046193 275
90 3300013102 Ga0157371_10017541 Ga0157371_100175415 275
91 3300013102 Ga0157371_10018682 Ga0157371_100186825 275
92 3300013306 Ga0163162_10079970 Ga0163162_100799703 275
93 3300025263 Ga0209565_1000166 Ga0209565_100016640 275
94 3300025273 Ga0209673_1004601 Ga0209673_10046014 275
95 3300025292 Ga0209676_1004515 Ga0209676_10045156 275
96 3300025295 Ga0209564_1003037 Ga0209564_10030373 275
97 3300025295 Ga0209564_1009572 Ga0209564_10095723 275
98 3300025298 Ga0209050_1011497 Ga0209050_10114972 275
99 3300025298 Ga0209050_1031739 Ga0209050_10317392 275
100 3300025304 Ga0209257_1004707 Ga0209257_100470710 275
101 3300025315 Ga0207697_10036341 Ga0207697_100363412 275
102 3300025900 Ga0207710_10091581 Ga0207710_100915812 275
103 3300025904 Ga0207647_10009953 Ga0207647_100099534 275
104 3300025909 Ga0207705_10000294 Ga0207705_100002945 275
105 3300025909 Ga0207705_10002417 Ga0207705_100024179 275
106 3300025909 Ga0207705_10007268 Ga0207705_100072683 275
107 3300025919 Ga0207657_10000659 Ga0207657_1000065937 275
108 3300025919 Ga0207657_10007485 Ga0207657_100074859 275
109 3300025924 Ga0207694_10124014 Ga0207694_101240142 275
110 3300025941 Ga0207711_10238775 Ga0207711_102387751 275
111 3300025949 Ga0207667_10030674 Ga0207667_100306744 275
112 3300025981 Ga0207640_10020248 Ga0207640_100202483 275
113 3300026035 Ga0207703_10010462 Ga0207703_100104622 275
114 3300026078 Ga0207702_10039713 Ga0207702_100397133 275
115 3300026088 Ga0207641_10005531 Ga0207641_1000553111 275
116 3300026089 Ga0207648_10348076 Ga0207648_103480762 275
117 3300026095 Ga0207676_10001900 Ga0207676_1000190011 275
118 3300026116 Ga0207674_10298964 Ga0207674_102989642 275
119 3300026118 Ga0207675_100063446 Ga0207675_1000634463 275
120 3300026142 Ga0207698_10003840 Ga0207698_100038407 275
121 3300028380 Ga0268265_10000035 Ga0268265_1000003545 275
122 3300031251 Ga0265327_10034673 Ga0265327_100346731 275
123 3300033180 Ga0307510_10008816 Ga0307510_1000881614 275
124 3300037312 Ga0395899_0011973 Ga0395899_0011973_4432_5265 275
125 3300037418 Ga0395900_0008466 Ga0395900_0008466_8356_9189 275
126 3300037466 Ga0395898_0035816 Ga0395898_0035816_2739_3572 275
127 3300037471 Ga0395905_0272870 Ga0395905_0272870_112_945 275
128 3300038443 Ga0395901_0000320 Ga0395901_0000320_8474_9307 275
129 3300046660 Ga0495625_0022386 Ga0495625_0022386_2273_3109 275
130 3300048912 Ga0496109_0062913 Ga0496109_0062913_2428_3279 275
131 3300053096 Ga0500641_0168762 Ga0500641_0168762_47_883 275
132 iso_pu_bacteria 2643221560 2643820971 275
133 iso_pu_bacteria 2852653556 2852656498 275
134 iso_pu_bacteria 2852680915 2852684793 275
135 3300001904 JGI24736J21556_1002133 JGI24736J21556_10021335 276
136 3300003323 rootH1_10115271 rootH1_101152715 276
137 3300003794 Ga0055531_10010696 Ga0055531_100106964 276
138 3300003856 Ga0058692_1000013 Ga0058692_1000013240 276
139 3300005329 Ga0070683_100073827 Ga0070683_1000738272 276
140 3300005347 Ga0070668_100088664 Ga0070668_1000886643 276
141 3300005366 Ga0070659_100013082 Ga0070659_1000130825 276
142 3300005563 Ga0068855_100015155 Ga0068855_1000151555 276
143 3300005578 Ga0068854_100141764 Ga0068854_1001417642 276
144 3300005614 Ga0068856_100353313 Ga0068856_1003533132 276
145 3300005616 Ga0068852_100240588 Ga0068852_1002405882 276
146 3300006186 Ga0075369_10005964 Ga0075369_100059643 276
147 3300006186 Ga0075369_10008461 Ga0075369_100084614 276
148 3300009093 Ga0105240_10037558 Ga0105240_100375582 276
149 3300013104 Ga0157370_10351725 Ga0157370_103517252 276
150 3300013105 Ga0157369_10000751 Ga0157369_1000075122 276
151 3300013105 Ga0157369_10581400 Ga0157369_105814002 276
152 3300013105 Ga0157369_10667884 Ga0157369_106678842 276
153 3300017792 Ga0163161_10043858 Ga0163161_100438583 276
154 3300025904 Ga0207647_10062237 Ga0207647_100622372 276
155 3300025909 Ga0207705_10000033 Ga0207705_1000003357 276
156 3300025909 Ga0207705_10257405 Ga0207705_102574051 276
157 3300025913 Ga0207695_10003918 Ga0207695_100039189 276
158 3300025920 Ga0207649_10000848 Ga0207649_100008486 276
159 3300025932 Ga0207690_10013336 Ga0207690_100133362 276
160 3300025942 Ga0207689_10532923 Ga0207689_105329231 276
161 3300026041 Ga0207639_10010296 Ga0207639_100102964 276
162 3300026116 Ga0207674_10184158 Ga0207674_101841583 276
163 3300026142 Ga0207698_10000697 Ga0207698_1000069715 276
164 3300031824 Ga0307413_10000079 Ga0307413_100000793 276
165 3300032004 Ga0307414_10029070 Ga0307414_100290704 276
166 3300032004 Ga0307414_10521763 Ga0307414_105217631 276
167 3300033524 Ga0316592_1031506 Ga0316592_10315061 276
168 3300035170 Ga0373943_0049392 Ga0373943_0049392_23_859 276
169 3300035695 Ga0373927_0032130 Ga0373927_0032130_901_1737 276
170 3300037068 Ga0373925_0000804 Ga0373925_0000804_27585_28421 276
171 3300037418 Ga0395900_0004635 Ga0395900_0004635_3067_3936 276
172 3300037418 Ga0395900_0086250 Ga0395900_0086250_932_1777 276
173 3300037418 Ga0395900_0314387 Ga0395900_0314387_509_1345 276
174 3300037466 Ga0395898_0006780 Ga0395898_0006780_5503_6372 276
175 3300037466 Ga0395898_0409531 Ga0395898_0409531_221_1057 276
176 3300038443 Ga0395901_0019628 Ga0395901_0019628_1431_2300 276
177 3300038443 Ga0395901_0042461 Ga0395901_0042461_1431_2276 276
178 3300041462 Ga0451806_333236 Ga0451806_333236_31_867 276
179 3300041463 Ga0451804_0890657 Ga0451804_0890657_87_923 276
180 3300041507 Ga0451851_0418188 Ga0451851_0418188_37_867 276
181 3300041512 Ga0451853_3468116 Ga0451853_3468116_746_1576 276
182 3300044684 Ga0466966_0001491 Ga0466966_0001491_8065_8895 276
183 3300044684 Ga0466966_0145746 Ga0466966_0145746_72_908 276
184 3300044693 Ga0466961_0002989 Ga0466961_0002989_6628_7464 276
185 3300044693 Ga0466961_0008224 Ga0466961_0008224_3148_3978 276
186 3300044694 Ga0466963_0027665 Ga0466963_0027665_1759_2595 276
187 3300044694 Ga0466963_0052307 Ga0466963_0052307_1061_1897 276
188 3300044719 Ga0466971_0000451 Ga0466971_0000451_6387_7223 276
189 3300044719 Ga0466971_0017029 Ga0466971_0017029_396_1226 276
190 3300044719 Ga0466971_0040121 Ga0466971_0040121_269_1105 276
191 3300044765 Ga0466970_0009697 Ga0466970_0009697_1359_2195 276
192 3300044842 Ga0466957_0096458 Ga0466957_0096458_609_1445 276
193 3300045049 Ga0466959_0004877 Ga0466959_0004877_6789_7619 276
194 3300045836 Ga0466958_0001757 Ga0466958_0001757_3037_3873 276
195 3300045836 Ga0466958_0042618 Ga0466958_0042618_1226_2062 276
196 3300046462 Ga0495651_0089175 Ga0495651_0089175_887_1717 276
197 3300046678 Ga0495599_0237647 Ga0495599_0237647_109_939 276
198 3300047317 Ga0495604_0034876 Ga0495604_0034876_2339_3169 276
199 3300048905 Ga0496102_0026319 Ga0496102_0026319_1972_2820 276
200 3300048924 Ga0496121_0315674 Ga0496121_0315674_48_884 276
201 3300048928 Ga0496125_0160180 Ga0496125_0160180_512_1351 276
202 3300061719 Ga0466962_0004866 Ga0466962_0004866_652_1488 276
203 3300003760 Ga0055527_1000069 Ga0055527_100006913 277
204 3300003761 Ga0055535_1000196 Ga0055535_100019646 277
205 3300003762 Ga0055542_1000225 Ga0055542_100022513 277
206 3300003763 Ga0055529_1000719 Ga0055529_100071914 277
207 3300005327 Ga0070658_10364045 Ga0070658_103640452 277
208 3300005329 Ga0070683_100186162 Ga0070683_1001861622 277
209 3300005339 Ga0070660_100017837 Ga0070660_1000178373 277
210 3300005345 Ga0070692_10008255 Ga0070692_100082554 277
211 3300005345 Ga0070692_10053669 Ga0070692_100536692 277
212 3300005345 Ga0070692_10259414 Ga0070692_102594141 277
213 3300005455 Ga0070663_100023189 Ga0070663_1000231894 277
214 3300005530 Ga0070679_100302663 Ga0070679_1003026632 277
215 3300005535 Ga0070684_100301592 Ga0070684_1003015922 277
216 3300005539 Ga0068853_100330083 Ga0068853_1003300831 277
217 3300005563 Ga0068855_100084892 Ga0068855_1000848921 277
218 3300005577 Ga0068857_100067268 Ga0068857_1000672684 277
219 3300005578 Ga0068854_100443307 Ga0068854_1004433072 277
220 3300013104 Ga0157370_10333890 Ga0157370_103338902 277
221 3300014326 Ga0157380_10055283 Ga0157380_100552833 277
222 3300025228 Ga0209672_100007 Ga0209672_100007685 277
223 3300025230 Ga0209563_100074 Ga0209563_10007438 277
224 3300025242 Ga0209258_100017 Ga0209258_100017135 277
225 3300025254 Ga0209148_1000044 Ga0209148_1000044135 277
226 3300025272 Ga0209455_1000010 Ga0209455_1000010685 277
227 3300025273 Ga0209673_1010772 Ga0209673_10107724 277
228 3300025909 Ga0207705_10036966 Ga0207705_100369665 277
229 3300025909 Ga0207705_10215143 Ga0207705_102151432 277
230 3300025909 Ga0207705_10257975 Ga0207705_102579752 277
231 3300025913 Ga0207695_10003164 Ga0207695_100031647 277
232 3300025919 Ga0207657_10069344 Ga0207657_100693442 277
233 3300025944 Ga0207661_10062125 Ga0207661_100621253 277
234 3300026041 Ga0207639_10332681 Ga0207639_103326812 277
235 3300026067 Ga0207678_10010180 Ga0207678_100101808 277
236 3300026116 Ga0207674_10172089 Ga0207674_101720893 277
237 3300026142 Ga0207698_10135961 Ga0207698_101359612 277
238 3300031824 Ga0307413_10042299 Ga0307413_100422992 277
239 3300031995 Ga0307409_100191804 Ga0307409_1001918043 277
240 3300032002 Ga0307416_100065818 Ga0307416_1000658184 277
241 3300032004 Ga0307414_10014923 Ga0307414_100149233 277
242 3300032126 Ga0307415_100548904 Ga0307415_1005489042 277
243 3300037312 Ga0395899_0217588 Ga0395899_0217588_141_980 277
244 3300037312 Ga0395899_0349267 Ga0395899_0349267_15_857 277
245 3300037418 Ga0395900_0034711 Ga0395900_0034711_2308_3147 277
246 3300037418 Ga0395900_0059206 Ga0395900_0059206_2929_3768 277
247 3300037418 Ga0395900_0381386 Ga0395900_0381386_344_1183 277
248 3300037466 Ga0395898_0104447 Ga0395898_0104447_102_941 277
249 3300037471 Ga0395905_0000533 Ga0395905_0000533_714_1553 277
250 3300037471 Ga0395905_0035852 Ga0395905_0035852_653_1492 277
251 3300038443 Ga0395901_0239795 Ga0395901_0239795_253_1092 277
252 3300042005 Ga0439448_0004366 Ga0439448_0004366_570_1439 277
253 3300042007 Ga0439449_0004334 Ga0439449_0004334_818_1651 277
254 3300042015 Ga0439462_0073846 Ga0439462_0073846_23_856 277
255 3300044694 Ga0466963_0001022 Ga0466963_0001022_11500_12339 277
256 3300044706 Ga0466964_0028178 Ga0466964_0028178_222_1055 277
257 3300044842 Ga0466957_0004503 Ga0466957_0004503_4774_5613 277
258 3300044842 Ga0466957_0190762 Ga0466957_0190762_164_997 277
259 3300045976 Ga0466967_0002613 Ga0466967_0002613_35_874 277
260 3300045976 Ga0466967_0255261 Ga0466967_0255261_93_962 277
261 3300046519 Ga0495632_0000003 Ga0495632_0000003_334777_335610 277
262 3300046660 Ga0495625_0000263 Ga0495625_0000263_61148_61996 277
263 3300048905 Ga0496102_0050431 Ga0496102_0050431_2298_3149 277
264 3300053117 Ga0500593_000265 Ga0500593_000265_14859_15710 277
265 3300053119 Ga0500595_042036 Ga0500595_042036_231_1073 277
266 3300053136 Ga0500559_0022806 Ga0500559_0022806_761_1603 277
267 3300053136 Ga0500559_0058854 Ga0500559_0058854_201_1043 277
268 3300053140 Ga0500573_0031189 Ga0500573_0031189_2206_3051 277
269 iso_pu_bacteria 8029995093 8029999593 277
270 3300002067 JGI24735J21928_10002384 JGI24735J21928_100023844 278
271 3300013104 Ga0157370_10397215 Ga0157370_103972152 278
272 3300013307 Ga0157372_10629400 Ga0157372_106294001 278
273 3300031456 Ga0307513_10064140 Ga0307513_100641402 278
274 3300032004 Ga0307414_10005038 Ga0307414_1000503811 278
275 3300037471 Ga0395905_0004475 Ga0395905_0004475_4231_5067 278
276 3300041453 Ga0451797_0426262 Ga0451797_0426262_1210_2049 278
277 3300044656 Ga0466969_0023468 Ga0466969_0023468_728_1582 278
278 3300044765 Ga0466970_0078532 Ga0466970_0078532_123_965 278
279 3300049822 Ga0501035_0055237 Ga0501035_0055237_2574_3446 278
280 3300049823 Ga0501044_0000059 Ga0501044_0000059_73551_74423 278
281 iso_pu_bacteria 2984504281 2984507926 278
282 3300003781 Ga0055536_1000929 Ga0055536_10009296 279
283 3300003781 Ga0055536_1005881 Ga0055536_10058815 279
284 3300003781 Ga0055536_1017258 Ga0055536_10172582 279
285 3300003791 Ga0055530_10000632 Ga0055530_1000063228 279
286 3300003794 Ga0055531_10000643 Ga0055531_100006433 279
287 3300005336 Ga0070680_100138566 Ga0070680_1001385663 279
288 3300005436 Ga0070713_100022944 Ga0070713_1000229444 279
289 3300005458 Ga0070681_10017295 Ga0070681_100172955 279
290 3300005614 Ga0068856_100584880 Ga0068856_1005848802 279
291 3300009098 Ga0105245_10102919 Ga0105245_101029193 279
292 3300025245 Ga0207425_1026236 Ga0207425_10262361 279
293 3300025291 Ga0209675_1000184 Ga0209675_100018440 279
294 3300025292 Ga0209676_1000133 Ga0209676_100013310 279
295 3300025292 Ga0209676_1000174 Ga0209676_1000174130 279
296 3300025292 Ga0209676_1000246 Ga0209676_10002464 279
297 3300025292 Ga0209676_1038537 Ga0209676_10385371 279
298 3300025294 Ga0209025_1011826 Ga0209025_10118263 279
299 3300025298 Ga0209050_1000067 Ga0209050_10000674 279
300 3300025298 Ga0209050_1018145 Ga0209050_10181453 279
301 3300025304 Ga0209257_1000132 Ga0209257_1000132177 279
302 3300025304 Ga0209257_1000169 Ga0209257_100016914 279
303 3300025304 Ga0209257_1001127 Ga0209257_100112719 279
304 3300025304 Ga0209257_1014954 Ga0209257_10149543 279
305 3300025925 Ga0207650_10007250 Ga0207650_100072508 279
306 3300031911 Ga0307412_10050723 Ga0307412_100507232 279
307 3300031911 Ga0307412_10112057 Ga0307412_101120573 279
308 3300032004 Ga0307414_10018410 Ga0307414_100184102 279
309 3300032004 Ga0307414_10198117 Ga0307414_101981172 279
310 3300032005 Ga0307411_10176809 Ga0307411_101768093 279
311 3300037312 Ga0395899_0192101 Ga0395899_0192101_123_974 279
312 3300037418 Ga0395900_0193040 Ga0395900_0193040_412_1266 279
313 3300037471 Ga0395905_0013767 Ga0395905_0013767_2565_3440 279
314 3300042876 Ga0451577_0008910 Ga0451577_0008910_7424_8290 279
315 3300045976 Ga0466967_0554549 Ga0466967_0554549_160_1005 279
316 3300046453 Ga0495627_014489 Ga0495627_014489_504_1361 279
317 3300046539 Ga0495621_0000192 Ga0495621_0000192_2202_3047 279
318 3300046616 Ga0495668_0000002 Ga0495668_0000002_485767_486630 279
319 3300046660 Ga0495625_0000655 Ga0495625_0000655_27084_27932 279
320 3300048927 Ga0496124_0039946 Ga0496124_0039946_797_1684 279
321 3300049523 Ga0501300_012476 Ga0501300_012476_278_1126 279
322 3300049569 Ga0501032_0194635 Ga0501032_0194635_307_1155 279
323 3300049570 Ga0501033_0010339 Ga0501033_0010339_5885_6733 279
324 3300049572 Ga0501036_0056163 Ga0501036_0056163_166_1014 279
325 3300049574 Ga0501038_0012352 Ga0501038_0012352_5550_6398 279
326 3300049575 Ga0501039_0007493 Ga0501039_0007493_2186_3034 279
327 3300049580 Ga0501046_0229233 Ga0501046_0229233_206_1054 279
328 3300049822 Ga0501035_0027184 Ga0501035_0027184_3993_4841 279
329 3300049823 Ga0501044_0047266 Ga0501044_0047266_3361_4209 279
330 3300049823 Ga0501044_0081035 Ga0501044_0081035_1618_2466 279
331 3300005347 Ga0070668_100078071 Ga0070668_1000780713 280
332 iso_pu_bacteria 2511231024 2511377522 280
333 iso_pu_bacteria 2554235231 2555245863 280
334 iso_pu_bacteria 2765235841 2765582344 280
335 iso_pu_bacteria 2919155634 2919158780 280
336 iso_pu_bacteria 8052494512 8052495797 280
337 iso_pu_bacteria 8054929484 8054929606 280
338 iso_pu_bacteria 8056115690 8056120141 280
339 2162886007 SwRhRL2b_contig_539090 SwRhRL2b_0675.00005020 281
340 3300005288 Ga0065714_10092244 Ga0065714_100922442 281
341 3300005289 Ga0065704_10070185 Ga0065704_100701853 281
342 3300005295 Ga0065707_10082493 Ga0065707_1008249312 281
343 3300013100 Ga0157373_10249073 Ga0157373_102490732 281
344 3300015261 Ga0182006_1010125 Ga0182006_10101251 281
345 3300031727 Ga0316576_10079514 Ga0316576_100795143 281
346 3300031728 Ga0316578_10027881 Ga0316578_100278813 281
347 3300046474 Ga0495605_0000323 Ga0495605_0000323_40975_41826 281
348 3300046474 Ga0495605_0001417 Ga0495605_0001417_637_1482 281
349 3300046501 Ga0495607_0025164 Ga0495607_0025164_402_1247 281
350 3300046501 Ga0495607_0184121 Ga0495607_0184121_38_889 281
351 3300046538 Ga0495609_0000210 Ga0495609_0000210_7492_8337 281
352 3300046543 Ga0495645_0053340 Ga0495645_0053340_1976_2821 281
353 3300047469 Ga0495673_0002519 Ga0495673_0002519_4762_5643 281
354 3300009011 Ga0105251_10003015 Ga0105251_100030156 282
355 2162886007 SwRhRL2b_contig_2017140 SwRhRL2b_0670.00005560 284
356 3300003856 Ga0058692_1022873 Ga0058692_10228731 284
357 3300005289 Ga0065704_10003640 Ga0065704_100036403 284
358 3300005289 Ga0065704_10071509 Ga0065704_100715099 284
359 3300006058 Ga0075432_10040253 Ga0075432_100402532 284
360 3300006944 Ga0099823_1000119 Ga0099823_100011927 284
361 3300009011 Ga0105251_10013088 Ga0105251_100130881 284
362 3300009036 Ga0105244_10008321 Ga0105244_100083216 284
363 3300009036 Ga0105244_10013314 Ga0105244_100133141 284
364 3300009036 Ga0105244_10036839 Ga0105244_100368391 284
365 3300009036 Ga0105244_10043052 Ga0105244_100430523 284
366 3300009092 Ga0105250_10089065 Ga0105250_100890651 284
367 3300013307 Ga0157372_10000663 Ga0157372_100006638 284
368 3300025711 Ga0207696_1000164 Ga0207696_100016414 284
369 3300025711 Ga0207696_1005732 Ga0207696_10057324 284
370 3300025711 Ga0207696_1024751 Ga0207696_10247513 284
371 3300025728 Ga0207655_1001023 Ga0207655_10010238 284
372 3300025728 Ga0207655_1001253 Ga0207655_10012536 284
373 3300025728 Ga0207655_1008244 Ga0207655_10082443 284
374 3300025728 Ga0207655_1053642 Ga0207655_10536421 284
375 3300025735 Ga0207713_1002039 Ga0207713_10020399 284
376 3300025735 Ga0207713_1045241 Ga0207713_10452412 284
377 3300025935 Ga0207709_10027351 Ga0207709_100273512 284
378 3300027296 Ga0209389_1000205 Ga0209389_100020519 284
379 3300027312 Ga0209371_1001098 Ga0209371_100109814 284
380 3300030500 Ga0268256_1002086 Ga0268256_10020868 284
381 3300041405 Ga0439438_002379 Ga0439438_002379_472_1326 284
382 3300042137 Ga0450902_000033 Ga0450902_000033_5134_5988 284
383 3300042142 Ga0450905_000063 Ga0450905_000063_6692_7546 284
384 3300046515 Ga0495620_0000003 Ga0495620_0000003_183966_184820 284
385 3300046519 Ga0495632_0005427 Ga0495632_0005427_621_1475 284
386 3300046522 Ga0495643_0000917 Ga0495643_0000917_19461_20315 284
387 3300046522 Ga0495643_0003034 Ga0495643_0003034_8184_9038 284
388 3300046524 Ga0495648_0003944 Ga0495648_0003944_5088_5942 284
389 3300048913 Ga0496110_0009253 Ga0496110_0009253_164_1018 284
390 3300048917 Ga0496114_0039791 Ga0496114_0039791_2483_3337 284
391 3300048920 Ga0496117_0006004 Ga0496117_0006004_5610_6464 284
392 3300048920 Ga0496117_0007449 Ga0496117_0007449_5966_6820 284
393 3300048920 Ga0496117_0019635 Ga0496117_0019635_587_1441 284
394 3300048921 Ga0496118_0003619 Ga0496118_0003619_62_916 284
395 3300048921 Ga0496118_0005722 Ga0496118_0005722_6892_7746 284
396 3300048922 Ga0496119_0000380 Ga0496119_0000380_6907_7761 284
397 3300048923 Ga0496120_0002710 Ga0496120_0002710_6371_7225 284
398 3300048924 Ga0496121_0053447 Ga0496121_0053447_98_952 284
399 3300048925 Ga0496122_0020829 Ga0496122_0020829_4392_5246 284
400 3300048926 Ga0496123_0004350 Ga0496123_0004350_8489_9343 284
401 3300048927 Ga0496124_0015039 Ga0496124_0015039_6251_7105 284
402 3300048927 Ga0496124_0026028 Ga0496124_0026028_3664_4518 284
403 3300048928 Ga0496125_0006982 Ga0496125_0006982_5078_5932 284
404 3300048928 Ga0496125_0021739 Ga0496125_0021739_38_892 284
405 3300048928 Ga0496125_0168097 Ga0496125_0168097_561_1415 284
406 3300048929 Ga0496126_0033545 Ga0496126_0033545_938_1792 284
407 3300048929 Ga0496126_0083343 Ga0496126_0083343_1550_2404 284
408 3300049571 Ga0501034_0000692 Ga0501034_0000692_19593_20447 284
409 3300053135 Ga0500659_0003033 Ga0500659_0003033_5399_6253 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

43

302

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jzl-assembly1.cif.gz_A s-formylglutathione hydrolase homolog from a psychrophilic bacterium of shewanella frigidimarina 0.9858 4 282
3s8y-assembly1.cif.gz_A bromide soaked structure of an esterase from the oil-degrading bacterium oleispira antarctica 0.9846 2 281
6jzl-assembly1.cif.gz_A s-formylglutathione hydrolase homolog from a psychrophilic bacterium of shewanella frigidimarina 0.9788 4 282
3ls2-assembly2.cif.gz_D crystal structure of an s-formylglutathione hydrolase from pseudoalteromonas haloplanktis tac125 0.9786 3 281
3s8y-assembly1.cif.gz_A bromide soaked structure of an esterase from the oil-degrading bacterium oleispira antarctica 0.9775 2 281
ID Description Score Start End Superfamily
3fcxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.965 3 281 3.40.50.1820
3fcxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9582 3 281 3.40.50.1820
4folD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9429 4 284 3.40.50.1820
af_A0A0G2JYG2_4_177_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9409 4 179 3.40.50.1820
4folD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9364 4 284 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7Y5A8A0-F1-model_v4 S-formylglutathione hydrolase YeiG (EC 3.1.2.12) 1.003 173 284 GO:0005829
GO:0018738
GO:0046294
GO:0052689
AF-A0A7Y5A8A0-F1-model_v4 S-formylglutathione hydrolase YeiG (EC 3.1.2.12) 0.9939 173 284 GO:0005829
GO:0018738
GO:0046294
GO:0052689
AF-A0A6D0ICF1-F1-model_v4 S-formylglutathione hydrolase YeiG (EC 3.1.2.12) 0.9937 108 281 GO:0005829
GO:0018738
GO:0046294
GO:0052689
AF-A0A060C8V6-F1-model_v4 S-formylglutathione hydrolase (EC 3.1.2.12) 0.9907 121 260 GO:0005829
GO:0018738
GO:0046294
GO:0052689
AF-A0A1Y5ECH4-F1-model_v4 S-formylglutathione hydrolase YeiG (EC 3.1.2.12) 0.9904 142 281 GO:0005829
GO:0018738
GO:0046294
GO:0052689

Feature Viewer

pLDDT pTM Quality
93.41 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map