F437100

General Info

Members Datasets Scaffolds Average Seq Length
409 182 818 251

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0004366|Ga0501040_0004366_2461_3309
Length 282
Sequence MLRQRSAGCQQAAPERRRLDGRPVTWQNSPSMASGLIVSIHSFRGGTGKSNTTANLAALLAAEGRRVGAIDTDIQSPGLHVLFGLDESRMTHSLNDYLWGKCAIEETAHDVTPRPEGAGRVLLIPSSLKAGEIARVLREGYDVSMLNDGFRRLIDALRLDVLMIDTHPGLNEETLLSIAVSQVLVVLLRPDHQDYQGTGVAVEVARKLDVPRLLLLVNKVPPLFDAADVRSRVETAYRAEVAAVLPHSDEMMALGSEGLFVLRYPDHPVTAALKQVAAKLVA

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
74 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
88 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
103 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
107 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
116 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
117 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
120 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
121 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
122 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
123 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
124 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
125 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
126 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
127 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
128 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
129 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
130 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
131 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
168 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
182 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 1.22
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 3.18
Rhizosphere 94.87
Stem 0
Stem Tuber 0
Unclassified 19.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0004366 3300049576 Bacteria 9191
2 rootL2_10024603 3300003322 Bacteria 4116
3 rootH1_10052350 3300003323 Bacteria 6467
4 JGI25407J50210_10001245 3300003373 Bacteria 5689
5 JGI25407J50210_10045589 3300003373 Bacteria 1117
6 Ga0058862_12772021 3300004803 Unclassified 1296
7 Ga0065712_10161402 3300005290 Bacteria 1295
8 Ga0065707_10118900 3300005295 Bacteria 2174
9 Ga0070687_100379748 3300005343 Unclassified 920
10 Ga0070668_100237314 3300005347 Bacteria 1509
11 Ga0070675_100117599 3300005354 Unclassified 2256
12 Ga0070675_100762700 3300005354 Bacteria 883
13 Ga0070671_100294986 3300005355 Bacteria 1380
14 Ga0070688_100324021 3300005365 Bacteria 1120
15 Ga0070713_100393738 3300005436 Bacteria 1293
16 Ga0070713_100600418 3300005436 Bacteria 1046
17 Ga0070705_100032327 3300005440 Bacteria 2906
18 Ga0070694_100641584 3300005444 Bacteria 859
19 Ga0070708_100017898 3300005445 Bacteria 5922
20 Ga0070708_100053596 3300005445 Bacteria 3579
21 Ga0070708_100109945 3300005445 Bacteria 2532
22 Ga0070708_100204794 3300005445 Bacteria 1848
23 Ga0070708_100317533 3300005445 Unclassified 1467
24 Ga0070708_100395328 3300005445 Bacteria 1303
25 Ga0070663_100238318 3300005455 Unclassified 1435
26 Ga0070706_100012872 3300005467 Bacteria 7743
27 Ga0070706_100016713 3300005467 Bacteria 6777
28 Ga0070706_100021246 3300005467 Bacteria 5979
29 Ga0070706_100041921 3300005467 Bacteria 4227
30 Ga0070706_100068581 3300005467 Bacteria 3279
31 Ga0070706_100095436 3300005467 Bacteria 2760
32 Ga0070706_100256809 3300005467 Bacteria 1631
33 Ga0070706_100754034 3300005467 Bacteria 902
34 Ga0070707_100025599 3300005468 Bacteria 5599
35 Ga0070707_100155575 3300005468 Bacteria 2227
36 Ga0070707_100157658 3300005468 Bacteria 2211
37 Ga0070707_100393246 3300005468 Bacteria 1346
38 Ga0070707_100487209 3300005468 Bacteria 1194
39 Ga0070698_100003911 3300005471 Bacteria 16380
40 Ga0070698_100006593 3300005471 Bacteria 12588
41 Ga0070698_100019423 3300005471 Bacteria 7134
42 Ga0070698_100080876 3300005471 Bacteria 3244
43 Ga0070698_100133947 3300005471 Bacteria 2432
44 Ga0070698_100221096 3300005471 Bacteria 1827
45 Ga0070698_100325712 3300005471 Bacteria 1467
46 Ga0070698_100483425 3300005471 Bacteria 1175
47 Ga0070698_100548731 3300005471 Unclassified 1095
48 Ga0070699_100010266 3300005518 Bacteria 8099
49 Ga0070699_100026187 3300005518 Bacteria 5031
50 Ga0070699_100074095 3300005518 Bacteria 2962
51 Ga0070699_100258679 3300005518 Bacteria 1556
52 Ga0070699_100310600 3300005518 Bacteria 1415
53 Ga0070697_100005436 3300005536 Bacteria 9820
54 Ga0070697_100014853 3300005536 Bacteria 6111
55 Ga0070697_100096492 3300005536 Bacteria 2452
56 Ga0070697_100275039 3300005536 Unclassified 1444
57 Ga0070697_100348994 3300005536 Bacteria 1278
58 Ga0070672_100724182 3300005543 Unclassified 872
59 Ga0070686_100255758 3300005544 Unclassified 1281
60 Ga0070696_100066538 3300005546 Bacteria 2527
61 Ga0070696_100169568 3300005546 Unclassified 1613
62 Ga0070704_100369491 3300005549 Bacteria 1216
63 Ga0068857_100106717 3300005577 Unclassified 2515
64 Ga0068859_100215531 3300005617 Bacteria 2007
65 Ga0068864_100467150 3300005618 Bacteria 1209
66 Ga0068861_100181990 3300005719 Unclassified 1750
67 Ga0068858_100230222 3300005842 Bacteria 1757
68 Ga0068860_100757107 3300005843 Bacteria 983
69 Ga0081455_10157863 3300005937 Unclassified 1741
70 Ga0081455_10253925 3300005937 Bacteria 1284
71 Ga0081538_10006117 3300005981 Bacteria 10689
72 Ga0081538_10007176 3300005981 Bacteria 9675
73 Ga0081538_10008332 3300005981 Bacteria 8824
74 Ga0081538_10009682 3300005981 Bacteria 8001
75 Ga0081538_10129872 3300005981 Bacteria 1187
76 Ga0081539_10011020 3300005985 Bacteria 7232
77 Ga0070716_100225149 3300006173 Unclassified 1262
78 Ga0070712_100134590 3300006175 Bacteria 1877
79 Ga0070712_100566848 3300006175 Unclassified 958
80 Ga0075367_10086004 3300006178 Bacteria 1908
81 Ga0075428_100001696 3300006844 Bacteria 23508
82 Ga0075428_100012618 3300006844 Bacteria 9395
83 Ga0075428_100017493 3300006844 Bacteria 7920
84 Ga0075428_100102386 3300006844 Bacteria 3122
85 Ga0075431_100002350 3300006847 Bacteria 18166
86 Ga0075431_100022967 3300006847 Bacteria 6375
87 Ga0075431_100138680 3300006847 Bacteria 2507
88 Ga0075433_10003629 3300006852 Bacteria 11924
89 Ga0075433_10135526 3300006852 Bacteria 2189
90 Ga0075434_100214360 3300006871 Bacteria 1945
91 Ga0075429_100005939 3300006880 Bacteria 10537
92 Ga0075429_100725873 3300006880 Bacteria 870
93 Ga0068865_100298372 3300006881 Unclassified 1289
94 Ga0075436_100092668 3300006914 Unclassified 2101
95 Ga0075436_100157049 3300006914 Bacteria 1602
96 Ga0075436_100217465 3300006914 Bacteria 1355
97 Ga0097620_100215522 3300006931 Bacteria 2007
98 Ga0075435_100155985 3300007076 Unclassified 1921
99 Ga0075435_100227090 3300007076 Bacteria 1586
100 Ga0075435_100356176 3300007076 Bacteria 1255
101 Ga0075435_100387008 3300007076 Bacteria 1202
102 Ga0111539_10103911 3300009094 Bacteria 3334
103 Ga0111539_10385093 3300009094 Bacteria 1633
104 Ga0114129_10003387 3300009147 Bacteria 22400
105 Ga0114129_10008672 3300009147 Bacteria 14490
106 Ga0114129_10011403 3300009147 Bacteria 12661
107 Ga0114129_10045810 3300009147 Bacteria 6147
108 Ga0114129_10069160 3300009147 Bacteria 4922
109 Ga0114129_10069884 3300009147 Bacteria 4896
110 Ga0114129_10097628 3300009147 Bacteria 4067
111 Ga0114129_10117655 3300009147 Bacteria 3661
112 Ga0114129_10130496 3300009147 Bacteria 3452
113 Ga0114129_10574842 3300009147 Bacteria 1463
114 Ga0114129_10620605 3300009147 Bacteria 1398
115 Ga0114129_10635000 3300009147 Bacteria 1380
116 Ga0114129_10947909 3300009147 Unclassified 1087
117 Ga0105237_10010359 3300009545 Bacteria 9928
118 Ga0105249_10068168 3300009553 Bacteria 3280
119 Ga0105246_10057544 3300011119 Unclassified 2690
120 Ga0105246_10726555 3300011119 Bacteria 873
121 Ga0157374_10829963 3300013296 Bacteria 941
122 Ga0163162_10005236 3300013306 Bacteria 12505
123 Ga0157375_10134022 3300013308 Bacteria 2599
124 Ga0157375_10181716 3300013308 Bacteria 2255
125 Ga0157375_10864955 3300013308 Bacteria 1050
126 Ga0163163_10119534 3300014325 Bacteria 2668
127 Ga0157379_10079851 3300014968 Bacteria 2930
128 Ga0157379_10251501 3300014968 Bacteria 1604
129 Ga0157379_10311565 3300014968 Bacteria 1436
130 Ga0206356_10255224 3300020070 Bacteria 2224
131 Ga0206352_10613749 3300020078 Unclassified 913
132 Ga0207684_10004847 3300025910 Bacteria 12589
133 Ga0207684_10017318 3300025910 Bacteria 6181
134 Ga0207684_10024378 3300025910 Bacteria 5159
135 Ga0207684_10049728 3300025910 Bacteria 3556
136 Ga0207684_10060614 3300025910 Bacteria 3214
137 Ga0207684_10066549 3300025910 Bacteria 3060
138 Ga0207684_10116108 3300025910 Bacteria 2293
139 Ga0207684_10153728 3300025910 Unclassified 1980
140 Ga0207684_10300585 3300025910 Bacteria 1384
141 Ga0207684_10322121 3300025910 Unclassified 1332
142 Ga0207684_10421910 3300025910 Bacteria 1146
143 Ga0207693_10117919 3300025915 Bacteria 2084
144 Ga0207646_10018382 3300025922 Bacteria 6521
145 Ga0207646_10033633 3300025922 Bacteria 4635
146 Ga0207646_10118853 3300025922 Bacteria 2374
147 Ga0207670_10350127 3300025936 Bacteria 1169
148 Ga0207704_10369742 3300025938 Unclassified 1122
149 Ga0207665_10100896 3300025939 Unclassified 2015
150 Ga0207712_10012794 3300025961 Bacteria 5366
151 Ga0207703_10110411 3300026035 Bacteria 2346
152 Ga0207708_10364549 3300026075 Unclassified 1188
153 Ga0207675_100130651 3300026118 Unclassified 2381
154 Ga0207675_100133859 3300026118 Bacteria 2351
155 Ga0207675_100373537 3300026118 Bacteria 1401
156 Ga0207428_10102644 3300027907 Bacteria 2208
157 Ga0268265_10023488 3300028380 Bacteria 4347
158 Ga0268264_10620085 3300028381 Bacteria 1068
159 Ga0265337_1005588 3300028556 Bacteria 4970
160 Ga0265326_10036190 3300028558 Bacteria 1404
161 Ga0265319_1002920 3300028563 Bacteria 9116
162 Ga0265334_10007698 3300028573 Bacteria 4614
163 Ga0265318_10003236 3300028577 Bacteria 8302
164 Ga0265338_10035504 3300028800 Bacteria 4790
165 Ga0265324_10000862 3300029957 Bacteria 19517
166 Ga0265332_10048698 3300031238 Bacteria 1822
167 Ga0265320_10007845 3300031240 Bacteria 6591
168 Ga0265320_10205828 3300031240 Bacteria 878
169 Ga0265325_10005559 3300031241 Bacteria 7778
170 Ga0265329_10077574 3300031242 Bacteria 1052
171 Ga0265340_10014113 3300031247 Bacteria 4182
172 Ga0265331_10017664 3300031250 Bacteria 3714
173 Ga0265313_10014515 3300031595 Bacteria 4649
174 Ga0316575_10045005 3300031665 Bacteria 1752
175 Ga0316579_10003682 3300031691 Bacteria 6030
176 Ga0316579_10078146 3300031691 Unclassified 1573
177 Ga0316579_10135998 3300031691 Unclassified 1184
178 Ga0316579_10148113 3300031691 Bacteria 1132
179 Ga0265314_10006671 3300031711 Bacteria 10144
180 Ga0316576_10031945 3300031727 Bacteria 3740
181 Ga0316576_10074948 3300031727 Bacteria 2503
182 Ga0316576_10078493 3300031727 Bacteria 2446
183 Ga0316576_10163760 3300031727 Bacteria 1678
184 Ga0316576_10281536 3300031727 Bacteria 1245
185 Ga0316578_10076721 3300031728 Unclassified 1984
186 Ga0316578_10204380 3300031728 Bacteria 1189
187 Ga0316578_10309485 3300031728 Bacteria 944
188 Ga0307405_10383560 3300031731 Bacteria 1095
189 Ga0316577_10007480 3300031733 Bacteria 5829
190 Ga0316577_10010150 3300031733 Bacteria 5077
191 Ga0316577_10024814 3300031733 Unclassified 3334
192 Ga0316577_10028947 3300031733 Unclassified 3092
193 Ga0316577_10054663 3300031733 Unclassified 2228
194 Ga0316577_10178605 3300031733 Unclassified 1199
195 Ga0316577_10182641 3300031733 Unclassified 1185
196 Ga0307413_10188473 3300031824 Unclassified 1478
197 Ga0307410_10036236 3300031852 Bacteria 3210
198 Ga0307407_10040666 3300031903 Bacteria 2594
199 Ga0307412_10191260 3300031911 Bacteria 1547
200 Ga0307409_100761851 3300031995 Bacteria 972
201 Ga0307416_100190665 3300032002 Bacteria 1933
202 Ga0307411_10182672 3300032005 Bacteria 1593
203 Ga0307415_100232039 3300032126 Bacteria 1487
204 Ga0316585_10008775 3300032137 Bacteria 2935
205 Ga0316586_1024533 3300033527 Bacteria 1012
206 Ga0316574_0000466 3300035398 Bacteria 16350
207 Ga0316574_0011951 3300035398 Unclassified 4952
208 Ga0316574_0064176 3300035398 Bacteria 2310
209 Ga0316574_0090708 3300035398 Bacteria 1948
210 Ga0373931_0086615 3300035691 Unclassified 1738
211 Ga0316582_0008099 3300036647 Bacteria 5627
212 Ga0316582_0010131 3300036647 Bacteria 5149
213 Ga0316582_0085320 3300036647 Bacteria 2069
214 Ga0316582_0087421 3300036647 Unclassified 2046
215 Ga0316582_0145481 3300036647 Bacteria 1600
216 Ga0316582_0189108 3300036647 Unclassified 1402
217 Ga0316582_0297336 3300036647 Unclassified 1109
218 Ga0316584_0028506 3300036712 Unclassified 4119
219 Ga0316584_0038646 3300036712 Bacteria 3551
220 Ga0316584_0044885 3300036712 Unclassified 3297
221 Ga0316584_0060763 3300036712 Bacteria 2830
222 Ga0316584_0082628 3300036712 Unclassified 2406
223 Ga0316584_0096730 3300036712 Bacteria 2210
224 Ga0316584_0239007 3300036712 Bacteria 1330
225 Ga0316584_0272663 3300036712 Unclassified 1231
226 Ga0316584_0286999 3300036712 Bacteria 1194
227 Ga0395899_0007026 3300037312 Bacteria 8710
228 Ga0395899_0010630 3300037312 Bacteria 7053
229 Ga0395899_0058280 3300037312 Bacteria 2849
230 Ga0395900_0002330 3300037418 Bacteria 21015
231 Ga0395900_0011390 3300037418 Bacteria 9101
232 Ga0395900_0026603 3300037418 Bacteria 5923
233 Ga0395900_0117452 3300037418 Bacteria 2729
234 Ga0395898_0005121 3300037466 Bacteria 14200
235 Ga0395898_0015908 3300037466 Bacteria 7709
236 Ga0395898_0062491 3300037466 Bacteria 3616
237 Ga0395898_0362327 3300037466 Bacteria 1382
238 Ga0395898_0414093 3300037466 Unclassified 1285
239 Ga0395898_0459228 3300037466 Bacteria 1213
240 Ga0395905_0005901 3300037471 Bacteria 12423
241 Ga0395905_0007391 3300037471 Bacteria 10923
242 Ga0395905_0069582 3300037471 Unclassified 3297
243 Ga0316581_0017313 3300037588 Bacteria 2079
244 Ga0316581_0024724 3300037588 Unclassified 1783
245 Ga0316581_0036659 3300037588 Bacteria 1488
246 Ga0436364_0319394 3300037853 Bacteria 2207
247 Ga0395901_0008287 3300038443 Bacteria 10502
248 Ga0395901_0011603 3300038443 Bacteria 8927
249 Ga0395901_0014028 3300038443 Bacteria 8154
250 Ga0395901_0029860 3300038443 Bacteria 5614
251 Ga0395901_0074579 3300038443 Bacteria 3539
252 Ga0395901_0194483 3300038443 Bacteria 2127
253 Ga0395901_0267464 3300038443 Bacteria 1779
254 Ga0395901_0619429 3300038443 Unclassified 1089
255 Ga0242422_04265 3300038699 Unclassified 904
256 Ga0400489_10700 3300039093 Bacteria 10380
257 Ga0400489_30680 3300039093 Unclassified 2974
258 Ga0400487_63449 3300039110 Bacteria 1240
259 Ga0436360_0261807 3300039438 Bacteria 2043
260 Ga0436360_0311355 3300039438 Unclassified 1161
261 Ga0439443_000811 3300042003 Bacteria 3111
262 Ga0439448_0001975 3300042005 Bacteria 5482
263 Ga0439450_000917 3300042008 Bacteria 4090
264 Ga0439454_010080 3300042011 Bacteria 1239
265 Ga0439455_0005191 3300042012 Bacteria 2629
266 Ga0439456_001980 3300042013 Bacteria 4126
267 Ga0439463_001353 3300042016 Bacteria 6531
268 Ga0450900_005477 3300042136 Bacteria 1501
269 Ga0450902_001605 3300042137 Bacteria 3110
270 Ga0439458_0002103 3300042157 Bacteria 4941
271 Ga0439435_0024920 3300042436 Bacteria 1582
272 Ga0439444_0001567 3300042437 Bacteria 3007
273 Ga0439460_0024295 3300042461 Bacteria 1677
274 Ga0451577_0006425 3300042876 Bacteria 11726
275 Ga0451577_0046204 3300042876 Bacteria 3896
276 Ga0451577_0078459 3300042876 Unclassified 2944
277 Ga0451577_0096816 3300042876 Bacteria 2635
278 Ga0451577_0163584 3300042876 Bacteria 2005
279 Ga0451577_0241129 3300042876 Bacteria 1636
280 Ga0451577_0340937 3300042876 Bacteria 1359
281 Ga0439440_0005710 3300042993 Bacteria 2476
282 Ga0466972_0003336 3300044658 Bacteria 7962
283 Ga0453683_0005842 3300044673 Bacteria 8518
284 Ga0453683_0018399 3300044673 Viruses 4486
285 Ga0453683_0023542 3300044673 Bacteria 3924
286 Ga0453683_0025795 3300044673 Bacteria 3731
287 Ga0466965_0000476 3300044683 Bacteria 14178
288 Ga0466963_0177174 3300044694 Unclassified 1488
289 Ga0453684_0000003 3300044712 Bacteria 1481694
290 Ga0453684_0000074 3300044712 Bacteria 438364
291 Ga0453684_0000106 3300044712 Bacteria 364365
292 Ga0453684_0000599 3300044712 Bacteria 133150
293 Ga0453684_0000933 3300044712 Bacteria 96683
294 Ga0453684_0000958 3300044712 Bacteria 94987
295 Ga0453684_0001419 3300044712 Bacteria 68999
296 Ga0453684_0002081 3300044712 Bacteria 50801
297 Ga0453684_0003342 3300044712 Bacteria 36400
298 Ga0453684_0004013 3300044712 Bacteria 32067
299 Ga0453684_0004448 3300044712 Bacteria 29576
300 Ga0453684_0006288 3300044712 Bacteria 22720
301 Ga0453684_0010070 3300044712 Bacteria 16248
302 Ga0453684_0013691 3300044712 Bacteria 13141
303 Ga0453684_0015503 3300044712 Bacteria 12042
304 Ga0453684_0015883 3300044712 Bacteria 11838
305 Ga0453684_0019648 3300044712 Bacteria 10266
306 Ga0453684_0022466 3300044712 Bacteria 9353
307 Ga0453684_0074299 3300044712 Unclassified 4281
308 Ga0453684_0161845 3300044712 Bacteria 2646
309 Ga0453684_0170096 3300044712 Bacteria 2569
310 Ga0453684_0201276 3300044712 Bacteria 2321
311 Ga0453684_0206671 3300044712 Bacteria 2285
312 Ga0453684_0293389 3300044712 Viruses 1851
313 Ga0453684_0314426 3300044712 Bacteria 1776
314 Ga0453684_0347126 3300044712 Unclassified 1674
315 Ga0453684_0351231 3300044712 Unclassified 1663
316 Ga0453684_0378265 3300044712 Bacteria 1591
317 Ga0453684_0457061 3300044712 Bacteria 1420
318 Ga0453684_0496012 3300044712 Bacteria 1353
319 Ga0453684_0519820 3300044712 Bacteria 1315
320 Ga0453684_0559638 3300044712 Bacteria 1258
321 Ga0453684_0647490 3300044712 Unclassified 1153
322 Ga0453684_0662930 3300044712 Bacteria 1137
323 Ga0453684_0684118 3300044712 Unclassified 1116
324 Ga0453684_0723249 3300044712 Unclassified 1080
325 Ga0453684_0769179 3300044712 Unclassified 1041
326 Ga0453684_0779411 3300044712 Unclassified 1033
327 Ga0453684_0795561 3300044712 Bacteria 1020
328 Ga0466968_0001583 3300044735 Bacteria 8201
329 Ga0466968_0060632 3300044735 Bacteria 1631
330 Ga0466968_0230577 3300044735 Bacteria 875
331 Ga0466957_0019542 3300044842 Bacteria 3984
332 Ga0466957_0072393 3300044842 Unclassified 2134
333 Ga0466960_0000421 3300044901 Bacteria 14555
334 Ga0451576_0033104 3300045051 Bacteria 5495
335 Ga0451576_0033705 3300045051 Bacteria 5442
336 Ga0451576_0054863 3300045051 Bacteria 4171
337 Ga0451576_0108132 3300045051 Unclassified 2894
338 Ga0451576_0741824 3300045051 Bacteria 1031
339 Ga0466958_0021545 3300045836 Bacteria 3768
340 Ga0466958_0097947 3300045836 Bacteria 1820
341 Ga0466967_0038149 3300045976 Unclassified 4118
342 Ga0466967_0762091 3300045976 Bacteria 960
343 Ga0495653_0091546 3300046463 Bacteria 2223
344 Ga0495618_0576148 3300046514 Bacteria 672
345 Ga0495640_0086473 3300046533 Unclassified 2076
346 Ga0495684_0077556 3300047471 Bacteria 2522
347 Ga0496102_0152675 3300048905 Bacteria 2171
348 Ga0496104_0016403 3300048907 Bacteria 6728
349 Ga0496106_0077443 3300048909 Bacteria 2550
350 Ga0496107_0079735 3300048910 Bacteria 2387
351 Ga0496108_0106817 3300048911 Bacteria 2390
352 Ga0496110_0232973 3300048913 Bacteria 1675
353 Ga0496111_0026238 3300048914 Bacteria 4113
354 Ga0496112_0223994 3300048915 Bacteria 1836
355 Ga0496112_0234304 3300048915 Bacteria 1790
356 Ga0496112_0654526 3300048915 Bacteria 980
357 Ga0496113_0052557 3300048916 Unclassified 3044
358 Ga0496113_0321898 3300048916 Bacteria 1239
359 Ga0496114_0313141 3300048917 Bacteria 1386
360 Ga0501308_008109 3300049128 Bacteria 1117
361 Ga0501034_0220818 3300049571 Bacteria 1848
362 Ga0501040_0180865 3300049576 Bacteria 1495
363 Ga0501042_0082622 3300049578 Bacteria 2303
364 Ga0501046_0416447 3300049580 Unclassified 969
365 Ga0501071_0341177 3300049587 Unclassified 1139
366 Ga0501075_0061287 3300049591 Bacteria 2835
367 Ga0501076_0308596 3300049592 Unclassified 1297
368 Ga0501077_0160386 3300049593 Bacteria 1428
369 Ga0501199_012933 3300049650 Bacteria 916
370 Ga0501233_069255 3300049668 Bacteria 891
371 Ga0501079_0473278 3300049741 Bacteria 984
372 nmdc:mga05p37_10800_c1 3300050507 Bacteria 10840
373 nmdc:mga05p37_1360812_c1 3300050507 Unclassified 718
374 nmdc:mga05p37_136090_c1 3300050507 Bacteria 3013
375 nmdc:mga05p37_14417_c1 3300050507 Bacteria 9488
376 nmdc:mga05p37_30473_c1 3300050507 Bacteria 6582
377 nmdc:mga05p37_337027_c1 3300050507 Bacteria 1779
378 nmdc:mga05p37_34068_c1 3300050507 Bacteria 6238
379 nmdc:mga05p37_348084_c1 3300050507 Bacteria 1745
380 nmdc:mga05p37_395043_c1 3300050507 Bacteria 1616
381 nmdc:mga05p37_428724_c1 3300050507 Unclassified 1537
382 nmdc:mga05p37_466497_c1 3300050507 Unclassified 1458
383 nmdc:mga05p37_483005_c1 3300050507 Bacteria 1426
384 nmdc:mga05p37_606137_c1 3300050507 Bacteria 1235
385 nmdc:mga05p37_77323_c1 3300050507 Bacteria 4097
386 nmdc:mga09592_13101_c1 3300050508 Bacteria 6767
387 nmdc:mga09592_20811_c1 3300050508 Bacteria 5399
388 nmdc:mga09592_635977_c1 3300050508 Bacteria 912
389 nmdc:mga06r32_123701_c1 3300050510 Bacteria 2553
390 nmdc:mga06r32_147804_c1 3300050510 Unclassified 2327
391 nmdc:mga06r32_3513_c1 3300050510 Bacteria 14000
392 nmdc:mga06r32_9474_c1 3300050510 Bacteria 8790
393 nmdc:mga0n895_206319_c1 3300050512 Bacteria 1996
394 nmdc:mga0n895_407471_c1 3300050512 Bacteria 1375
395 nmdc:mga0rr50_211484_c1 3300050513 Unclassified 1598
396 nmdc:mga0rr50_21613_c1 3300050513 Unclassified 4396
397 nmdc:mga08x19_113493_c1 3300050514 Bacteria 1809
398 nmdc:mga08x19_200305_c1 3300050514 Bacteria 1368
399 nmdc:mga0a205_132680_c1 3300050515 Bacteria 2391
400 nmdc:mga0a205_200879_c1 3300050515 Bacteria 1884
401 nmdc:mga0a205_5065_c1 3300050515 Bacteria 11856
402 Ga0495612_0098589 3300053078 Bacteria 1243
403 Ga0495619_0028878 3300053085 Unclassified 3579
404 Ga0495619_0532842 3300053085 Bacteria 806
405 Ga0501084_0251333 3300054114 Bacteria 1492
406 Ga0501084_0258823 3300054114 Unclassified 1469
407 Ga0590074_002575 3300059423 Bacteria 2981
408 Ga0530510_0123373 3300061734 Unclassified 1903
409 2673167978 2671180531 Bacteria 9045424
410 Ga0501040_0004366
411 rootL2_10024603
412 rootH1_10052350
413 JGI25407J50210_10001245
414 JGI25407J50210_10045589
415 Ga0058862_12772021
416 Ga0065712_10161402
417 Ga0065707_10118900
418 Ga0070687_100379748
419 Ga0070668_100237314
420 Ga0070675_100117599
421 Ga0070675_100762700
422 Ga0070671_100294986
423 Ga0070688_100324021
424 Ga0070713_100393738
425 Ga0070713_100600418
426 Ga0070705_100032327
427 Ga0070694_100641584
428 Ga0070708_100017898
429 Ga0070708_100053596
430 Ga0070708_100109945
431 Ga0070708_100204794
432 Ga0070708_100317533
433 Ga0070708_100395328
434 Ga0070663_100238318
435 Ga0070706_100012872
436 Ga0070706_100016713
437 Ga0070706_100021246
438 Ga0070706_100041921
439 Ga0070706_100068581
440 Ga0070706_100095436
441 Ga0070706_100256809
442 Ga0070706_100754034
443 Ga0070707_100025599
444 Ga0070707_100155575
445 Ga0070707_100157658
446 Ga0070707_100393246
447 Ga0070707_100487209
448 Ga0070698_100003911
449 Ga0070698_100006593
450 Ga0070698_100019423
451 Ga0070698_100080876
452 Ga0070698_100133947
453 Ga0070698_100221096
454 Ga0070698_100325712
455 Ga0070698_100483425
456 Ga0070698_100548731
457 Ga0070699_100010266
458 Ga0070699_100026187
459 Ga0070699_100074095
460 Ga0070699_100258679
461 Ga0070699_100310600
462 Ga0070697_100005436
463 Ga0070697_100014853
464 Ga0070697_100096492
465 Ga0070697_100275039
466 Ga0070697_100348994
467 Ga0070672_100724182
468 Ga0070686_100255758
469 Ga0070696_100066538
470 Ga0070696_100169568
471 Ga0070704_100369491
472 Ga0068857_100106717
473 Ga0068859_100215531
474 Ga0068864_100467150
475 Ga0068861_100181990
476 Ga0068858_100230222
477 Ga0068860_100757107
478 Ga0081455_10157863
479 Ga0081455_10253925
480 Ga0081538_10006117
481 Ga0081538_10007176
482 Ga0081538_10008332
483 Ga0081538_10009682
484 Ga0081538_10129872
485 Ga0081539_10011020
486 Ga0070716_100225149
487 Ga0070712_100134590
488 Ga0070712_100566848
489 Ga0075367_10086004
490 Ga0075428_100001696
491 Ga0075428_100012618
492 Ga0075428_100017493
493 Ga0075428_100102386
494 Ga0075431_100002350
495 Ga0075431_100022967
496 Ga0075431_100138680
497 Ga0075433_10003629
498 Ga0075433_10135526
499 Ga0075434_100214360
500 Ga0075429_100005939
501 Ga0075429_100725873
502 Ga0068865_100298372
503 Ga0075436_100092668
504 Ga0075436_100157049
505 Ga0075436_100217465
506 Ga0097620_100215522
507 Ga0075435_100155985
508 Ga0075435_100227090
509 Ga0075435_100356176
510 Ga0075435_100387008
511 Ga0111539_10103911
512 Ga0111539_10385093
513 Ga0114129_10003387
514 Ga0114129_10008672
515 Ga0114129_10011403
516 Ga0114129_10045810
517 Ga0114129_10069160
518 Ga0114129_10069884
519 Ga0114129_10097628
520 Ga0114129_10117655
521 Ga0114129_10130496
522 Ga0114129_10574842
523 Ga0114129_10620605
524 Ga0114129_10635000
525 Ga0114129_10947909
526 Ga0105237_10010359
527 Ga0105249_10068168
528 Ga0105246_10057544
529 Ga0105246_10726555
530 Ga0157374_10829963
531 Ga0163162_10005236
532 Ga0157375_10134022
533 Ga0157375_10181716
534 Ga0157375_10864955
535 Ga0163163_10119534
536 Ga0157379_10079851
537 Ga0157379_10251501
538 Ga0157379_10311565
539 Ga0206356_10255224
540 Ga0206352_10613749
541 Ga0207684_10004847
542 Ga0207684_10017318
543 Ga0207684_10024378
544 Ga0207684_10049728
545 Ga0207684_10060614
546 Ga0207684_10066549
547 Ga0207684_10116108
548 Ga0207684_10153728
549 Ga0207684_10300585
550 Ga0207684_10322121
551 Ga0207684_10421910
552 Ga0207693_10117919
553 Ga0207646_10018382
554 Ga0207646_10033633
555 Ga0207646_10118853
556 Ga0207670_10350127
557 Ga0207704_10369742
558 Ga0207665_10100896
559 Ga0207712_10012794
560 Ga0207703_10110411
561 Ga0207708_10364549
562 Ga0207675_100130651
563 Ga0207675_100133859
564 Ga0207675_100373537
565 Ga0207428_10102644
566 Ga0268265_10023488
567 Ga0268264_10620085
568 Ga0265337_1005588
569 Ga0265326_10036190
570 Ga0265319_1002920
571 Ga0265334_10007698
572 Ga0265318_10003236
573 Ga0265338_10035504
574 Ga0265324_10000862
575 Ga0265332_10048698
576 Ga0265320_10007845
577 Ga0265320_10205828
578 Ga0265325_10005559
579 Ga0265329_10077574
580 Ga0265340_10014113
581 Ga0265331_10017664
582 Ga0265313_10014515
583 Ga0316575_10045005
584 Ga0316579_10003682
585 Ga0316579_10078146
586 Ga0316579_10135998
587 Ga0316579_10148113
588 Ga0265314_10006671
589 Ga0316576_10031945
590 Ga0316576_10074948
591 Ga0316576_10078493
592 Ga0316576_10163760
593 Ga0316576_10281536
594 Ga0316578_10076721
595 Ga0316578_10204380
596 Ga0316578_10309485
597 Ga0307405_10383560
598 Ga0316577_10007480
599 Ga0316577_10010150
600 Ga0316577_10024814
601 Ga0316577_10028947
602 Ga0316577_10054663
603 Ga0316577_10178605
604 Ga0316577_10182641
605 Ga0307413_10188473
606 Ga0307410_10036236
607 Ga0307407_10040666
608 Ga0307412_10191260
609 Ga0307409_100761851
610 Ga0307416_100190665
611 Ga0307411_10182672
612 Ga0307415_100232039
613 Ga0316585_10008775
614 Ga0316586_1024533
615 Ga0316574_0000466
616 Ga0316574_0011951
617 Ga0316574_0064176
618 Ga0316574_0090708
619 Ga0373931_0086615
620 Ga0316582_0008099
621 Ga0316582_0010131
622 Ga0316582_0085320
623 Ga0316582_0087421
624 Ga0316582_0145481
625 Ga0316582_0189108
626 Ga0316582_0297336
627 Ga0316584_0028506
628 Ga0316584_0038646
629 Ga0316584_0044885
630 Ga0316584_0060763
631 Ga0316584_0082628
632 Ga0316584_0096730
633 Ga0316584_0239007
634 Ga0316584_0272663
635 Ga0316584_0286999
636 Ga0395899_0007026
637 Ga0395899_0010630
638 Ga0395899_0058280
639 Ga0395900_0002330
640 Ga0395900_0011390
641 Ga0395900_0026603
642 Ga0395900_0117452
643 Ga0395898_0005121
644 Ga0395898_0015908
645 Ga0395898_0062491
646 Ga0395898_0362327
647 Ga0395898_0414093
648 Ga0395898_0459228
649 Ga0395905_0005901
650 Ga0395905_0007391
651 Ga0395905_0069582
652 Ga0316581_0017313
653 Ga0316581_0024724
654 Ga0316581_0036659
655 Ga0436364_0319394
656 Ga0395901_0008287
657 Ga0395901_0011603
658 Ga0395901_0014028
659 Ga0395901_0029860
660 Ga0395901_0074579
661 Ga0395901_0194483
662 Ga0395901_0267464
663 Ga0395901_0619429
664 Ga0242422_04265
665 Ga0400489_10700
666 Ga0400489_30680
667 Ga0400487_63449
668 Ga0436360_0261807
669 Ga0436360_0311355
670 Ga0439443_000811
671 Ga0439448_0001975
672 Ga0439450_000917
673 Ga0439454_010080
674 Ga0439455_0005191
675 Ga0439456_001980
676 Ga0439463_001353
677 Ga0450900_005477
678 Ga0450902_001605
679 Ga0439458_0002103
680 Ga0439435_0024920
681 Ga0439444_0001567
682 Ga0439460_0024295
683 Ga0451577_0006425
684 Ga0451577_0046204
685 Ga0451577_0078459
686 Ga0451577_0096816
687 Ga0451577_0163584
688 Ga0451577_0241129
689 Ga0451577_0340937
690 Ga0439440_0005710
691 Ga0466972_0003336
692 Ga0453683_0005842
693 Ga0453683_0018399
694 Ga0453683_0023542
695 Ga0453683_0025795
696 Ga0466965_0000476
697 Ga0466963_0177174
698 Ga0453684_0000003
699 Ga0453684_0000074
700 Ga0453684_0000106
701 Ga0453684_0000599
702 Ga0453684_0000933
703 Ga0453684_0000958
704 Ga0453684_0001419
705 Ga0453684_0002081
706 Ga0453684_0003342
707 Ga0453684_0004013
708 Ga0453684_0004448
709 Ga0453684_0006288
710 Ga0453684_0010070
711 Ga0453684_0013691
712 Ga0453684_0015503
713 Ga0453684_0015883
714 Ga0453684_0019648
715 Ga0453684_0022466
716 Ga0453684_0074299
717 Ga0453684_0161845
718 Ga0453684_0170096
719 Ga0453684_0201276
720 Ga0453684_0206671
721 Ga0453684_0293389
722 Ga0453684_0314426
723 Ga0453684_0347126
724 Ga0453684_0351231
725 Ga0453684_0378265
726 Ga0453684_0457061
727 Ga0453684_0496012
728 Ga0453684_0519820
729 Ga0453684_0559638
730 Ga0453684_0647490
731 Ga0453684_0662930
732 Ga0453684_0684118
733 Ga0453684_0723249
734 Ga0453684_0769179
735 Ga0453684_0779411
736 Ga0453684_0795561
737 Ga0466968_0001583
738 Ga0466968_0060632
739 Ga0466968_0230577
740 Ga0466957_0019542
741 Ga0466957_0072393
742 Ga0466960_0000421
743 Ga0451576_0033104
744 Ga0451576_0033705
745 Ga0451576_0054863
746 Ga0451576_0108132
747 Ga0451576_0741824
748 Ga0466958_0021545
749 Ga0466958_0097947
750 Ga0466967_0038149
751 Ga0466967_0762091
752 Ga0495653_0091546
753 Ga0495618_0576148
754 Ga0495640_0086473
755 Ga0495684_0077556
756 Ga0496102_0152675
757 Ga0496104_0016403
758 Ga0496106_0077443
759 Ga0496107_0079735
760 Ga0496108_0106817
761 Ga0496110_0232973
762 Ga0496111_0026238
763 Ga0496112_0223994
764 Ga0496112_0234304
765 Ga0496112_0654526
766 Ga0496113_0052557
767 Ga0496113_0321898
768 Ga0496114_0313141
769 Ga0501308_008109
770 Ga0501034_0220818
771 Ga0501040_0180865
772 Ga0501042_0082622
773 Ga0501046_0416447
774 Ga0501071_0341177
775 Ga0501075_0061287
776 Ga0501076_0308596
777 Ga0501077_0160386
778 Ga0501199_012933
779 Ga0501233_069255
780 Ga0501079_0473278
781 nmdc:mga05p37_10800_c1
782 nmdc:mga05p37_1360812_c1
783 nmdc:mga05p37_136090_c1
784 nmdc:mga05p37_14417_c1
785 nmdc:mga05p37_30473_c1
786 nmdc:mga05p37_337027_c1
787 nmdc:mga05p37_34068_c1
788 nmdc:mga05p37_348084_c1
789 nmdc:mga05p37_395043_c1
790 nmdc:mga05p37_428724_c1
791 nmdc:mga05p37_466497_c1
792 nmdc:mga05p37_483005_c1
793 nmdc:mga05p37_606137_c1
794 nmdc:mga05p37_77323_c1
795 nmdc:mga09592_13101_c1
796 nmdc:mga09592_20811_c1
797 nmdc:mga09592_635977_c1
798 nmdc:mga06r32_123701_c1
799 nmdc:mga06r32_147804_c1
800 nmdc:mga06r32_3513_c1
801 nmdc:mga06r32_9474_c1
802 nmdc:mga0n895_206319_c1
803 nmdc:mga0n895_407471_c1
804 nmdc:mga0rr50_211484_c1
805 nmdc:mga0rr50_21613_c1
806 nmdc:mga08x19_113493_c1
807 nmdc:mga08x19_200305_c1
808 nmdc:mga0a205_132680_c1
809 nmdc:mga0a205_200879_c1
810 nmdc:mga0a205_5065_c1
811 Ga0495612_0098589
812 Ga0495619_0028878
813 Ga0495619_0532842
814 Ga0501084_0251333
815 Ga0501084_0258823
816 Ga0590074_002575
817 Ga0530510_0123373
818 2673167978

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

38

261

0.9

PF09140

MipZ

ATPase MipZ

36

98

0.85

PF13614

AAA_31

AAA domain

35

209

0.82

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

35

281

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1g3r-assembly1.cif.gz_A crystal structure analysis of pyrococcus furiosus cell division atpase mind 0.8929 1 250
1ion-assembly1.cif.gz_A the septum site-determining protein mind complexed with mg-adp from pyrococcus horikoshii ot3 0.8898 1 246
1g3r-assembly1.cif.gz_A crystal structure analysis of pyrococcus furiosus cell division atpase mind 0.8789 1 250
4v03-assembly1.cif.gz_A mind cell division protein, aquifex aeolicus 0.8679 2 250
4v02-assembly1.cif.gz_A minc:mind cell division protein complex, aquifex aeolicus 0.8661 2 250
ID Description Score Start End Superfamily
af_Q57633_4_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8844 4 247 3.40.50.300
af_Q57633_4_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.87 4 247 3.40.50.300
4v02A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8661 2 250 3.40.50.300
1hyqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8637 3 247 3.40.50.300
1ionA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8612 2 246 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A352AID9-F1-model_v4 CDP-3, 6-dideoxy-D-glycero-L-glycero-4-hexulose-4-reductase 0.9882 1 251 GO:0005524
AF-A0A3N5SSN7-F1-model_v4 MinD/ParA family protein 0.9878 120 251
AF-A0A7V1SJY8-F1-model_v4 MinD/ParA family protein 0.9858 1 206
AF-A0A349H145-F1-model_v4 CDP-3, 6-dideoxy-D-glycero-L-glycero-4-hexulose-4-reductase 0.9851 1 251 GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782
AF-A0A7W2BXZ1-F1-model_v4 deleted 0.9843 1 251

Map