F437170

General Info

Members Datasets Scaffolds Average Seq Length
410 257 410 91

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100010321|Ga0070713_1000103212
Length 102
Sequence MSVVVKIPTQLRAAAGGESEAVLDGASTVQEVLERLFARHEELRARIADEDGSLRRFVNVYLAGEDIRFLDGLQTPVADGAEMTILPAVAGGCAAPRAPRRS

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
86 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
137 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
138 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
141 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
142 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
145 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
172 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
173 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 6.59
Rhizosphere 86.59
Stem 0
Stem Tuber 0
Unclassified 5.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000606 3300001977 Bacteria 5446
2 JGI24740J21852_10015814 3300001979 Bacteria 2743
3 JGI24743J22301_10059083 3300001991 Bacteria 788
4 JGI25406J46586_10141328 3300003203 Bacteria 704
5 JGI25407J50210_10008074 3300003373 Bacteria 2648
6 JGI25407J50210_10157707 3300003373 Unclassified 559
7 Ga0070683_100106471 3300005329 Bacteria 2644
8 Ga0070670_100465215 3300005331 Bacteria 1122
9 Ga0070666_10441717 3300005335 Unclassified 939
10 Ga0070682_100051800 3300005337 Bacteria 2567
11 Ga0070682_100301082 3300005337 Bacteria 1177
12 Ga0070660_100430756 3300005339 Bacteria 1093
13 Ga0070687_101208040 3300005343 Unclassified 558
14 Ga0070692_10345411 3300005345 Bacteria 923
15 Ga0070692_10465477 3300005345 Unclassified 812
16 Ga0070669_100702782 3300005353 Unclassified 854
17 Ga0070673_100284337 3300005364 Bacteria 1452
18 Ga0070673_102123020 3300005364 Unclassified 534
19 Ga0070688_101551619 3300005365 Bacteria 540
20 Ga0070659_100004223 3300005366 Bacteria 10260
21 Ga0070667_100000603 3300005367 Bacteria 35115
22 Ga0070709_10024419 3300005434 Bacteria 3558
23 Ga0070709_10071002 3300005434 Bacteria 2247
24 Ga0070709_10976475 3300005434 Bacteria 673
25 Ga0070714_100664345 3300005435 Bacteria 1004
26 Ga0070713_100010321 3300005436 Bacteria 6745
27 Ga0070713_100078160 3300005436 Bacteria 2816
28 Ga0070713_100547218 3300005436 Bacteria 1096
29 Ga0070713_101921893 3300005436 Bacteria 574
30 Ga0070710_10226104 3300005437 Bacteria 1193
31 Ga0070710_11326210 3300005437 Unclassified 536
32 Ga0070711_100003452 3300005439 Bacteria 9210
33 Ga0070711_100008252 3300005439 Bacteria 6371
34 Ga0070711_100170896 3300005439 Bacteria 1656
35 Ga0070711_100630567 3300005439 Bacteria 897
36 Ga0070711_101292566 3300005439 Bacteria 633
37 Ga0070700_100218882 3300005441 Bacteria 1348
38 Ga0070700_100256690 3300005441 Bacteria 1257
39 Ga0070700_100508906 3300005441 Bacteria 928
40 Ga0070700_101961977 3300005441 Bacteria 507
41 Ga0070678_100171534 3300005456 Bacteria 1767
42 Ga0070662_101149153 3300005457 Unclassified 667
43 Ga0070681_10918815 3300005458 Bacteria 794
44 Ga0070685_10505542 3300005466 Bacteria 856
45 Ga0070707_100376382 3300005468 Bacteria 1379
46 Ga0070699_100738491 3300005518 Unclassified 900
47 Ga0070699_101264729 3300005518 Bacteria 677
48 Ga0070697_101210063 3300005536 Bacteria 673
49 Ga0070672_100000001 3300005543 Bacteria 204624
50 Ga0070665_100080084 3300005548 Bacteria 3272
51 Ga0070704_101262647 3300005549 Bacteria 675
52 Ga0070664_100033909 3300005564 Bacteria 4280
53 Ga0070664_101537988 3300005564 Bacteria 630
54 Ga0068857_100439896 3300005577 Bacteria 1218
55 Ga0068854_100001203 3300005578 Bacteria 15515
56 Ga0068856_100178692 3300005614 Bacteria 2135
57 Ga0070702_100140411 3300005615 Bacteria 1538
58 Ga0070702_100241286 3300005615 Bacteria 1220
59 Ga0068852_100248773 3300005616 Bacteria 1702
60 Ga0068859_101235602 3300005617 Bacteria 823
61 Ga0068866_10377011 3300005718 Bacteria 909
62 Ga0068861_100460464 3300005719 Bacteria 1141
63 Ga0068858_100111574 3300005842 Bacteria 2554
64 Ga0068858_100277012 3300005842 Bacteria 1597
65 Ga0068858_100383433 3300005842 Bacteria 1349
66 Ga0068860_100422900 3300005843 Bacteria 1321
67 Ga0068860_100892261 3300005843 Bacteria 905
68 Ga0068862_100002782 3300005844 Bacteria 15329
69 Ga0068862_100296380 3300005844 Bacteria 1486
70 Ga0081455_10010756 3300005937 Bacteria 9252
71 Ga0081455_10020661 3300005937 Bacteria 6192
72 Ga0081455_10390651 3300005937 Bacteria 969
73 Ga0081538_10013291 3300005981 Bacteria 6527
74 Ga0081538_10018966 3300005981 Bacteria 5138
75 Ga0081539_10000878 3300005985 Bacteria 57633
76 Ga0081539_10060519 3300005985 Bacteria 2079
77 Ga0075365_10518036 3300006038 Bacteria 843
78 Ga0075363_100276259 3300006048 Bacteria 971
79 Ga0070716_100232765 3300006173 Bacteria 1245
80 Ga0070716_100857117 3300006173 Bacteria 708
81 Ga0070716_101329208 3300006173 Bacteria 582
82 Ga0070712_100015593 3300006175 Bacteria 4899
83 Ga0070712_100064510 3300006175 Bacteria 2597
84 Ga0070712_100310146 3300006175 Bacteria 1280
85 Ga0070712_100520900 3300006175 Bacteria 999
86 Ga0068871_102181289 3300006358 Bacteria 528
87 Ga0075430_100095984 3300006846 Bacteria 2478
88 Ga0075434_101646316 3300006871 Bacteria 650
89 Ga0068865_100338105 3300006881 Bacteria 1216
90 Ga0068865_100767890 3300006881 Bacteria 829
91 Ga0075436_100799970 3300006914 Bacteria 702
92 Ga0097620_101235378 3300006931 Bacteria 823
93 Ga0075435_101369871 3300007076 Bacteria 620
94 Ga0105251_10464340 3300009011 Bacteria 588
95 Ga0105240_10191104 3300009093 Bacteria 2408
96 Ga0111539_10367222 3300009094 Bacteria 1675
97 Ga0105245_10010687 3300009098 Bacteria 7986
98 Ga0105247_10673553 3300009101 Bacteria 775
99 Ga0114129_12877831 3300009147 Bacteria 570
100 Ga0105243_10758763 3300009148 Bacteria 952
101 Ga0105242_12461136 3300009176 Bacteria 568
102 Ga0105248_10474174 3300009177 Bacteria 1411
103 Ga0105237_10012481 3300009545 Bacteria 8953
104 Ga0105238_11048507 3300009551 Bacteria 837
105 Ga0105249_10003360 3300009553 Bacteria 13850
106 Ga0105249_10771190 3300009553 Bacteria 1024
107 Ga0105239_11654430 3300010375 Bacteria 741
108 Ga0157320_1004053 3300012481 Bacteria 917
109 Ga0157370_11494947 3300013104 Unclassified 607
110 Ga0157374_10055261 3300013296 Unclassified 3704
111 Ga0157374_10063814 3300013296 Bacteria 3455
112 Ga0157374_10545205 3300013296 Unclassified 1167
113 Ga0157374_10695016 3300013296 Bacteria 1030
114 Ga0157378_10728005 3300013297 Unclassified 1013
115 Ga0163162_10691039 3300013306 Bacteria 1142
116 Ga0157372_12199989 3300013307 Bacteria 634
117 Ga0157372_12225998 3300013307 Bacteria 630
118 Ga0157375_11600174 3300013308 Unclassified 770
119 Ga0182008_10217083 3300014497 Unclassified 977
120 Ga0157377_10572636 3300014745 Unclassified 801
121 Ga0157379_10259435 3300014968 Bacteria 1579
122 Ga0157379_10292845 3300014968 Bacteria 1483
123 Ga0157379_10338281 3300014968 Bacteria 1376
124 Ga0157379_12352455 3300014968 Bacteria 531
125 Ga0206354_11215378 3300020081 Bacteria 820
126 Ga0206353_11557784 3300020082 Bacteria 666
127 Ga0213873_10005291 3300021358 Bacteria 2466
128 Ga0213874_10005320 3300021377 Bacteria 2993
129 Ga0213874_10099137 3300021377 Bacteria 966
130 Ga0213874_10376856 3300021377 Bacteria 548
131 Ga0213876_10097998 3300021384 Bacteria 1553
132 Ga0213876_10143821 3300021384 Bacteria 1268
133 Ga0213876_10235547 3300021384 Bacteria 973
134 Ga0213876_10523021 3300021384 Bacteria 631
135 Ga0213875_10021405 3300021388 Bacteria 3098
136 Ga0213875_10038176 3300021388 Bacteria 2263
137 Ga0213875_10147006 3300021388 Bacteria 1104
138 Ga0213875_10324833 3300021388 Bacteria 729
139 Ga0213871_10229218 3300021441 Bacteria 586
140 Ga0224712_10054057 3300022467 Bacteria 1575
141 Ga0224712_10178203 3300022467 Bacteria 956
142 Ga0207692_10890733 3300025898 Unclassified 585
143 Ga0207642_10409825 3300025899 Bacteria 813
144 Ga0207710_10057038 3300025900 Bacteria 1763
145 Ga0207699_10092555 3300025906 Bacteria 1901
146 Ga0207707_11204852 3300025912 Bacteria 613
147 Ga0207695_10826052 3300025913 Unclassified 807
148 Ga0207671_10026655 3300025914 Bacteria 4327
149 Ga0207671_10855574 3300025914 Bacteria 720
150 Ga0207693_10024222 3300025915 Bacteria 4819
151 Ga0207693_10027535 3300025915 Bacteria 4492
152 Ga0207693_10210398 3300025915 Bacteria 1529
153 Ga0207693_10386763 3300025915 Bacteria 1094
154 Ga0207663_10000972 3300025916 Bacteria 13103
155 Ga0207663_10269568 3300025916 Bacteria 1260
156 Ga0207663_10619058 3300025916 Bacteria 852
157 Ga0207663_11168331 3300025916 Bacteria 619
158 Ga0207660_11345543 3300025917 Bacteria 579
159 Ga0207662_10522597 3300025918 Bacteria 819
160 Ga0207652_11320331 3300025921 Bacteria 624
161 Ga0207694_10703995 3300025924 Bacteria 852
162 Ga0207687_10716747 3300025927 Bacteria 850
163 Ga0207700_10103937 3300025928 Bacteria 2272
164 Ga0207700_10219840 3300025928 Bacteria 1610
165 Ga0207664_10122560 3300025929 Bacteria 2178
166 Ga0207664_10533306 3300025929 Bacteria 1052
167 Ga0207664_10919090 3300025929 Unclassified 785
168 Ga0207644_11065678 3300025931 Unclassified 679
169 Ga0207690_10004766 3300025932 Bacteria 8003
170 Ga0207706_10371344 3300025933 Bacteria 1242
171 Ga0207709_10142741 3300025935 Bacteria 1648
172 Ga0207670_10484658 3300025936 Bacteria 1002
173 Ga0207669_10225889 3300025937 Bacteria 1378
174 Ga0207704_11342262 3300025938 Bacteria 612
175 Ga0207665_10061536 3300025939 Bacteria 2545
176 Ga0207665_10298397 3300025939 Bacteria 1204
177 Ga0207691_10000017 3300025940 Bacteria 134441
178 Ga0207661_10798699 3300025944 Bacteria 869
179 Ga0207679_10408642 3300025945 Bacteria 1196
180 Ga0207679_10535586 3300025945 Bacteria 1049
181 Ga0207712_10058339 3300025961 Bacteria 2727
182 Ga0207712_10351020 3300025961 Bacteria 1226
183 Ga0207668_10024603 3300025972 Bacteria 3889
184 Ga0207668_10845784 3300025972 Bacteria 812
185 Ga0207640_10000093 3300025981 Bacteria 70374
186 Ga0207640_10806381 3300025981 Bacteria 814
187 Ga0207658_10003551 3300025986 Bacteria 11011
188 Ga0207677_11160553 3300026023 Bacteria 706
189 Ga0207703_10493400 3300026035 Bacteria 1149
190 Ga0207678_11754146 3300026067 Bacteria 544
191 Ga0207708_10352932 3300026075 Bacteria 1207
192 Ga0207708_10589065 3300026075 Bacteria 941
193 Ga0207708_11716154 3300026075 Bacteria 551
194 Ga0207702_10120546 3300026078 Bacteria 2347
195 Ga0207641_10250058 3300026088 Bacteria 1655
196 Ga0207641_10519522 3300026088 Bacteria 1158
197 Ga0207648_10593159 3300026089 Bacteria 1021
198 Ga0207676_10993324 3300026095 Bacteria 827
199 Ga0207674_10468108 3300026116 Bacteria 1218
200 Ga0207675_100086557 3300026118 Bacteria 2942
201 Ga0207675_100586009 3300026118 Bacteria 1117
202 Ga0207698_10776550 3300026142 Bacteria 959
203 Ga0268266_10058937 3300028379 Bacteria 3307
204 Ga0268266_11441054 3300028379 Bacteria 664
205 Ga0268266_11775455 3300028379 Unclassified 592
206 Ga0268265_10002889 3300028380 Bacteria 12617
207 Ga0268264_10130379 3300028381 Bacteria 2228
208 Ga0268264_10409470 3300028381 Bacteria 1305
209 Ga0268264_10442007 3300028381 Bacteria 1258
210 Ga0268264_10511010 3300028381 Bacteria 1173
211 Ga0268264_11663735 3300028381 Bacteria 649
212 Ga0265337_1009373 3300028556 Bacteria 3497
213 Ga0265326_10000716 3300028558 Bacteria 12258
214 Ga0265319_1000469 3300028563 Bacteria 28589
215 Ga0265319_1000590 3300028563 Bacteria 24344
216 Ga0265319_1012860 3300028563 Bacteria 3359
217 Ga0265334_10215934 3300028573 Bacteria 664
218 Ga0265318_10011178 3300028577 Bacteria 3877
219 Ga0265318_10091169 3300028577 Bacteria 1122
220 Ga0265322_10014065 3300028654 Bacteria 2315
221 Ga0265336_10000005 3300028666 Bacteria 399349
222 Ga0265336_10071862 3300028666 Bacteria 1034
223 Ga0265338_10000001 3300028800 Bacteria 1177449
224 Ga0265338_10000244 3300028800 Bacteria 100528
225 Ga0265338_10012520 3300028800 Bacteria 9665
226 Ga0265338_10015930 3300028800 Bacteria 8224
227 Ga0265338_10127480 3300028800 Bacteria 2017
228 Ga0265324_10004892 3300029957 Bacteria 5898
229 Ga0265324_10066886 3300029957 Bacteria 1226
230 Ga0265330_10257273 3300031235 Bacteria 735
231 Ga0265332_10151308 3300031238 Bacteria 971
232 Ga0265328_10182987 3300031239 Bacteria 793
233 Ga0265320_10024699 3300031240 Bacteria 3173
234 Ga0265320_10085885 3300031240 Bacteria 1464
235 Ga0265320_10109999 3300031240 Bacteria 1263
236 Ga0265325_10079016 3300031241 Bacteria 1638
237 Ga0265325_10358073 3300031241 Bacteria 644
238 Ga0265340_10000001 3300031247 Bacteria 1647668
239 Ga0265340_10155707 3300031247 Bacteria 1040
240 Ga0265331_10527426 3300031250 Bacteria 532
241 Ga0265327_10004535 3300031251 Bacteria 12243
242 Ga0265327_10024251 3300031251 Bacteria 3570
243 Ga0265327_10208875 3300031251 Bacteria 882
244 Ga0265316_10020166 3300031344 Bacteria 5679
245 Ga0265316_10821085 3300031344 Bacteria 651
246 Ga0307408_100396011 3300031548 Bacteria 1185
247 Ga0265313_10141817 3300031595 Bacteria 1033
248 Ga0265313_10193487 3300031595 Bacteria 849
249 Ga0265314_10102510 3300031711 Bacteria 1836
250 Ga0265342_10082727 3300031712 Bacteria 1852
251 Ga0307409_100227340 3300031995 Bacteria 1689
252 Ga0307409_100743786 3300031995 Bacteria 984
253 Ga0307409_102184680 3300031995 Bacteria 583
254 Ga0307416_101675121 3300032002 Bacteria 741
255 Ga0307415_100292148 3300032126 Bacteria 1346
256 Ga0307415_100803941 3300032126 Bacteria 859
257 Ga0307415_101668815 3300032126 Bacteria 614
258 Ga0373947_1224475 3300035725 Bacteria 511
259 Ga0373925_0328344 3300037068 Bacteria 1239
260 Ga0395900_0704931 3300037418 Bacteria 943
261 Ga0395900_0724967 3300037418 Bacteria 926
262 Ga0395898_1690432 3300037466 Bacteria 556
263 Ga0395905_0833622 3300037471 Bacteria 825
264 Ga0436364_0619416 3300037853 Bacteria 28891
265 Ga0436364_0951314 3300037853 Bacteria 2785
266 Ga0436364_1374648 3300037853 Bacteria 1803
267 Ga0395901_0158015 3300038443 Bacteria 2381
268 Ga0395901_0208414 3300038443 Unclassified 2047
269 Ga0395901_1163283 3300038443 Bacteria 739
270 Ga0395901_1601705 3300038443 Bacteria 605
271 Ga0436365_0977418 3300039437 Bacteria 1035
272 Ga0436365_1429493 3300039437 Bacteria 6046
273 Ga0436365_1725440 3300039437 Bacteria 801
274 Ga0436363_0038523 3300039450 Bacteria 2166
275 Ga0436363_0762001 3300039450 Bacteria 6930
276 Ga0436363_0931960 3300039450 Bacteria 2728
277 Ga0436362_0524071 3300039453 Bacteria 1094
278 Ga0436362_0701385 3300039453 Bacteria 5698
279 Ga0451802_0263170 3300041460 Bacteria 746
280 Ga0451833_1334984 3300041491 Bacteria 525
281 Ga0451849_0090613 3300041505 Bacteria 619
282 Ga0451853_0120650 3300041512 Bacteria 614
283 Ga0439458_0178006 3300042157 Bacteria 577
284 Ga0466972_0252349 3300044658 Bacteria 825
285 Ga0466965_0146789 3300044683 Bacteria 1231
286 Ga0466965_0209522 3300044683 Bacteria 1036
287 Ga0466965_0442447 3300044683 Bacteria 723
288 Ga0466965_0554912 3300044683 Bacteria 649
289 Ga0466963_0649040 3300044694 Bacteria 745
290 Ga0466964_0625747 3300044706 Bacteria 593
291 Ga0466971_0068749 3300044719 Bacteria 1607
292 Ga0466968_0089033 3300044735 Bacteria 1365
293 Ga0466970_0072744 3300044765 Bacteria 1850
294 Ga0466970_0298362 3300044765 Bacteria 908
295 Ga0466957_0482029 3300044842 Bacteria 858
296 Ga0466960_0255483 3300044901 Bacteria 975
297 Ga0466960_0315932 3300044901 Bacteria 884
298 Ga0466960_0615959 3300044901 Bacteria 645
299 Ga0466960_0924743 3300044901 Bacteria 533
300 Ga0466960_0963718 3300044901 Bacteria 523
301 Ga0466958_0010414 3300045836 Bacteria 5207
302 Ga0466967_0007296 3300045976 Bacteria 7958
303 Ga0466967_0041629 3300045976 Bacteria 3963
304 Ga0466967_0236217 3300045976 Bacteria 1742
305 Ga0466967_0292901 3300045976 Bacteria 1564
306 Ga0466967_0734929 3300045976 Bacteria 978
307 Ga0466967_0783112 3300045976 Bacteria 947
308 Ga0466967_0902353 3300045976 Bacteria 879
309 Ga0466967_1125994 3300045976 Bacteria 782
310 Ga0466967_1134231 3300045976 Bacteria 779
311 Ga0466967_1298652 3300045976 Bacteria 725
312 Ga0466967_1316895 3300045976 Bacteria 719
313 Ga0466967_1568373 3300045976 Bacteria 656
314 Ga0466967_1844969 3300045976 Bacteria 602
315 Ga0466967_1865958 3300045976 Bacteria 598
316 Ga0466967_2440277 3300045976 Bacteria 518
317 Ga0495592_0114874 3300046454 Bacteria 1901
318 Ga0495629_0498474 3300046459 Bacteria 821
319 Ga0495638_0021742 3300046460 Bacteria 4220
320 Ga0495641_0018456 3300046461 Bacteria 3599
321 Ga0495651_0976346 3300046462 Bacteria 515
322 Ga0495653_0351360 3300046463 Bacteria 948
323 Ga0495639_0487665 3300046475 Bacteria 628
324 Ga0495662_0000848 3300046476 Bacteria 14886
325 Ga0495664_0000012 3300046477 Bacteria 226118
326 Ga0495584_0291364 3300046491 Bacteria 829
327 Ga0495618_0000115 3300046514 Bacteria 58375
328 Ga0495630_0000533 3300046517 Bacteria 27959
329 Ga0495666_0309142 3300046526 Bacteria 714
330 Ga0495665_0375889 3300046531 Bacteria 722
331 Ga0495586_0105333 3300046535 Unclassified 1568
332 Ga0495645_0000012 3300046543 Bacteria 209044
333 Ga0495645_0000315 3300046543 Bacteria 34756
334 Ga0495667_0545000 3300046559 Bacteria 725
335 Ga0495625_0000349 3300046660 Bacteria 70631
336 Ga0495625_0051027 3300046660 Bacteria 2967
337 Ga0495635_0212729 3300046663 Bacteria 1309
338 Ga0495657_0042789 3300046675 Bacteria 3090
339 Ga0495599_0317969 3300046678 Bacteria 937
340 Ga0495646_0230562 3300046680 Bacteria 998
341 Ga0495647_0191662 3300046681 Bacteria 893
342 Ga0495669_0064807 3300046684 Bacteria 1658
343 Ga0495624_0001010 3300046690 Bacteria 22278
344 Ga0495600_0013117 3300046809 Bacteria 5198
345 Ga0495604_0212968 3300047317 Bacteria 1334
346 Ga0495674_0000030 3300047319 Bacteria 115975
347 Ga0495672_0294379 3300047320 Bacteria 771
348 Ga0495676_0123451 3300047321 Bacteria 1880
349 Ga0495676_0361496 3300047321 Bacteria 969
350 Ga0495675_0067894 3300047444 Bacteria 2253
351 Ga0495684_0334463 3300047471 Bacteria 1079
352 Ga0495686_0270852 3300047472 Bacteria 947
353 Ga0495686_0471506 3300047472 Bacteria 664
354 Ga0495602_0000007 3300048088 Bacteria 273212
355 Ga0496100_0087453 3300048903 Bacteria 2119
356 Ga0496100_1222870 3300048903 Bacteria 593
357 Ga0496102_0000027 3300048905 Bacteria 225466
358 Ga0496102_0072496 3300048905 Bacteria 3165
359 Ga0496102_1694443 3300048905 Bacteria 550
360 Ga0496103_0000062 3300048906 Bacteria 129593
361 Ga0496103_0078734 3300048906 Bacteria 2070
362 Ga0496103_0102234 3300048906 Bacteria 1815
363 Ga0496104_0534843 3300048907 Bacteria 1083
364 Ga0496105_0076330 3300048908 Bacteria 2767
365 Ga0496106_0363441 3300048909 Bacteria 1163
366 Ga0496106_1108917 3300048909 Bacteria 620
367 Ga0496107_0728762 3300048910 Bacteria 728
368 Ga0496108_1550518 3300048911 Bacteria 550
369 Ga0496109_0000942 3300048912 Bacteria 24081
370 Ga0496109_1058143 3300048912 Bacteria 749
371 Ga0496110_0065111 3300048913 Bacteria 3222
372 Ga0496110_1479637 3300048913 Bacteria 589
373 Ga0496112_0008141 3300048915 Bacteria 9368
374 Ga0496112_0556163 3300048915 Bacteria 1081
375 Ga0496113_0000013 3300048916 Bacteria 81224
376 Ga0496113_0308880 3300048916 Bacteria 1267
377 Ga0496114_0322699 3300048917 Bacteria 1365
378 Ga0496114_1656659 3300048917 Bacteria 528
379 Ga0496115_0000222 3300048918 Bacteria 52327
380 Ga0496115_0000245 3300048918 Bacteria 49174
381 Ga0496124_0842353 3300048927 Unclassified 563
382 Ga0501034_0578126 3300049571 Bacteria 1031
383 Ga0501047_0010850 3300049581 Bacteria 8610
384 Ga0501047_0097769 3300049581 Bacteria 2814
385 Ga0501067_0266091 3300049583 Bacteria 954
386 Ga0501068_0130662 3300049584 Bacteria 1570
387 Ga0501069_0031019 3300049585 Bacteria 2938
388 Ga0501072_0100661 3300049588 Bacteria 2297
389 Ga0501073_0262196 3300049589 Bacteria 1192
390 Ga0501074_0028941 3300049590 Bacteria 4013
391 Ga0501080_0111029 3300049742 Bacteria 2541
392 Ga0501080_0413823 3300049742 Bacteria 1212
393 Ga0501080_0467794 3300049742 Bacteria 1129
394 Ga0501083_0003895 3300049744 Bacteria 10485
395 Ga0501083_0069388 3300049744 Bacteria 2345
396 Ga0501044_0355241 3300049823 Bacteria 1384
397 nmdc:mga04h51_419953_c1 3300050495 Bacteria 562
398 nmdc:mga05p37_1028717_c1 3300050507 Bacteria 871
399 nmdc:mga0qj67_382876_c1 3300050509 Bacteria 1136
400 nmdc:mga08y16_350103_c1 3300050511 Bacteria 1517
401 nmdc:mga0n895_168200_c1 3300050512 Bacteria 2224
402 Ga0495601_0000165 3300053077 Bacteria 35521
403 Ga0495601_0001773 3300053077 Bacteria 11954
404 Ga0495601_0089146 3300053077 Bacteria 1983
405 Ga0495601_0963744 3300053077 Bacteria 537
406 Ga0495595_0019433 3300053084 Bacteria 2947
407 Ga0495619_0589708 3300053085 Bacteria 761
408 Ga0500641_0001622 3300053096 Bacteria 8015
409 Ga0501082_0505992 3300060353 Bacteria 1056
410 Ga0466962_0241201 3300061719 Bacteria 887

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021384 Ga0213876_10523021 Ga0213876_105230211 88
2 3300005335 Ga0070666_10441717 Ga0070666_104417172 89
3 3300005343 Ga0070687_101208040 Ga0070687_1012080402 89
4 3300005353 Ga0070669_100702782 Ga0070669_1007027822 89
5 3300005364 Ga0070673_100284337 Ga0070673_1002843372 89
6 3300005364 Ga0070673_102123020 Ga0070673_1021230202 89
7 3300005457 Ga0070662_101149153 Ga0070662_1011491531 89
8 3300005518 Ga0070699_100738491 Ga0070699_1007384912 89
9 3300005616 Ga0068852_100248773 Ga0068852_1002487733 89
10 3300006881 Ga0068865_100338105 Ga0068865_1003381051 89
11 3300009093 Ga0105240_10191104 Ga0105240_101911042 89
12 3300009176 Ga0105242_12461136 Ga0105242_124611361 89
13 3300009177 Ga0105248_10474174 Ga0105248_104741742 89
14 3300013104 Ga0157370_11494947 Ga0157370_114949472 89
15 3300013296 Ga0157374_10055261 Ga0157374_100552614 89
16 3300013296 Ga0157374_10545205 Ga0157374_105452052 89
17 3300013297 Ga0157378_10728005 Ga0157378_107280052 89
18 3300013308 Ga0157375_11600174 Ga0157375_116001743 89
19 3300014497 Ga0182008_10217083 Ga0182008_102170832 89
20 3300014745 Ga0157377_10572636 Ga0157377_105726362 89
21 3300025913 Ga0207695_10826052 Ga0207695_108260522 89
22 3300025931 Ga0207644_11065678 Ga0207644_110656782 89
23 3300025933 Ga0207706_10371344 Ga0207706_103713441 89
24 3300025936 Ga0207670_10484658 Ga0207670_104846582 89
25 3300025945 Ga0207679_10408642 Ga0207679_104086422 89
26 3300026095 Ga0207676_10993324 Ga0207676_109933242 89
27 3300048912 Ga0496109_0000942 Ga0496109_0000942_17518_17790 89
28 3300048913 Ga0496110_1479637 Ga0496110_1479637_49_318 89
29 3300048917 Ga0496114_0322699 Ga0496114_0322699_181_453 89
30 3300048927 Ga0496124_0842353 Ga0496124_0842353_149_418 89
31 3300001977 JGI24746J21847_1000606 JGI24746J21847_10006062 90
32 3300001979 JGI24740J21852_10015814 JGI24740J21852_100158142 90
33 3300001991 JGI24743J22301_10059083 JGI24743J22301_100590832 90
34 3300003203 JGI25406J46586_10141328 JGI25406J46586_101413281 90
35 3300003373 JGI25407J50210_10008074 JGI25407J50210_100080742 90
36 3300003373 JGI25407J50210_10157707 JGI25407J50210_101577072 90
37 3300005329 Ga0070683_100106471 Ga0070683_1001064712 90
38 3300005331 Ga0070670_100465215 Ga0070670_1004652152 90
39 3300005337 Ga0070682_100051800 Ga0070682_1000518002 90
40 3300005337 Ga0070682_100301082 Ga0070682_1003010822 90
41 3300005339 Ga0070660_100430756 Ga0070660_1004307562 90
42 3300005345 Ga0070692_10345411 Ga0070692_103454112 90
43 3300005345 Ga0070692_10465477 Ga0070692_104654772 90
44 3300005365 Ga0070688_101551619 Ga0070688_1015516191 90
45 3300005366 Ga0070659_100004223 Ga0070659_1000042235 90
46 3300005367 Ga0070667_100000603 Ga0070667_10000060314 90
47 3300005434 Ga0070709_10024419 Ga0070709_100244192 90
48 3300005434 Ga0070709_10071002 Ga0070709_100710022 90
49 3300005434 Ga0070709_10976475 Ga0070709_109764752 90
50 3300005435 Ga0070714_100664345 Ga0070714_1006643452 90
51 3300005436 Ga0070713_100010321 Ga0070713_1000103212 90
52 3300005436 Ga0070713_100078160 Ga0070713_1000781605 90
53 3300005436 Ga0070713_100547218 Ga0070713_1005472182 90
54 3300005436 Ga0070713_101921893 Ga0070713_1019218931 90
55 3300005437 Ga0070710_10226104 Ga0070710_102261042 90
56 3300005437 Ga0070710_11326210 Ga0070710_113262101 90
57 3300005439 Ga0070711_100003452 Ga0070711_10000345212 90
58 3300005439 Ga0070711_100008252 Ga0070711_1000082522 90
59 3300005439 Ga0070711_100170896 Ga0070711_1001708961 90
60 3300005439 Ga0070711_100630567 Ga0070711_1006305672 90
61 3300005439 Ga0070711_101292566 Ga0070711_1012925662 90
62 3300005441 Ga0070700_100218882 Ga0070700_1002188823 90
63 3300005441 Ga0070700_100256690 Ga0070700_1002566902 90
64 3300005441 Ga0070700_100508906 Ga0070700_1005089061 90
65 3300005441 Ga0070700_101961977 Ga0070700_1019619771 90
66 3300005456 Ga0070678_100171534 Ga0070678_1001715342 90
67 3300005458 Ga0070681_10918815 Ga0070681_109188151 90
68 3300005466 Ga0070685_10505542 Ga0070685_105055422 90
69 3300005468 Ga0070707_100376382 Ga0070707_1003763822 90
70 3300005518 Ga0070699_101264729 Ga0070699_1012647292 90
71 3300005536 Ga0070697_101210063 Ga0070697_1012100632 90
72 3300005543 Ga0070672_100000001 Ga0070672_10000000197 90
73 3300005548 Ga0070665_100080084 Ga0070665_1000800842 90
74 3300005549 Ga0070704_101262647 Ga0070704_1012626472 90
75 3300005564 Ga0070664_100033909 Ga0070664_1000339092 90
76 3300005564 Ga0070664_101537988 Ga0070664_1015379882 90
77 3300005577 Ga0068857_100439896 Ga0068857_1004398962 90
78 3300005578 Ga0068854_100001203 Ga0068854_10000120314 90
79 3300005614 Ga0068856_100178692 Ga0068856_1001786924 90
80 3300005615 Ga0070702_100140411 Ga0070702_1001404113 90
81 3300005615 Ga0070702_100241286 Ga0070702_1002412862 90
82 3300005617 Ga0068859_101235602 Ga0068859_1012356022 90
83 3300005718 Ga0068866_10377011 Ga0068866_103770112 90
84 3300005719 Ga0068861_100460464 Ga0068861_1004604642 90
85 3300005842 Ga0068858_100111574 Ga0068858_1001115742 90
86 3300005842 Ga0068858_100277012 Ga0068858_1002770122 90
87 3300005842 Ga0068858_100383433 Ga0068858_1003834332 90
88 3300005843 Ga0068860_100422900 Ga0068860_1004229002 90
89 3300005843 Ga0068860_100892261 Ga0068860_1008922611 90
90 3300005844 Ga0068862_100002782 Ga0068862_1000027827 90
91 3300005844 Ga0068862_100296380 Ga0068862_1002963802 90
92 3300005937 Ga0081455_10010756 Ga0081455_100107569 90
93 3300005937 Ga0081455_10020661 Ga0081455_100206613 90
94 3300005937 Ga0081455_10390651 Ga0081455_103906512 90
95 3300005981 Ga0081538_10013291 Ga0081538_100132917 90
96 3300005981 Ga0081538_10018966 Ga0081538_100189665 90
97 3300005985 Ga0081539_10000878 Ga0081539_1000087810 90
98 3300005985 Ga0081539_10060519 Ga0081539_100605192 90
99 3300006038 Ga0075365_10518036 Ga0075365_105180362 90
100 3300006048 Ga0075363_100276259 Ga0075363_1002762592 90
101 3300006173 Ga0070716_100232765 Ga0070716_1002327652 90
102 3300006173 Ga0070716_100857117 Ga0070716_1008571172 90
103 3300006173 Ga0070716_101329208 Ga0070716_1013292081 90
104 3300006175 Ga0070712_100015593 Ga0070712_1000155935 90
105 3300006175 Ga0070712_100064510 Ga0070712_1000645102 90
106 3300006175 Ga0070712_100310146 Ga0070712_1003101462 90
107 3300006175 Ga0070712_100520900 Ga0070712_1005209002 90
108 3300006358 Ga0068871_102181289 Ga0068871_1021812892 90
109 3300006846 Ga0075430_100095984 Ga0075430_1000959843 90
110 3300006871 Ga0075434_101646316 Ga0075434_1016463162 90
111 3300006881 Ga0068865_100767890 Ga0068865_1007678902 90
112 3300006914 Ga0075436_100799970 Ga0075436_1007999702 90
113 3300006931 Ga0097620_101235378 Ga0097620_1012353782 90
114 3300007076 Ga0075435_101369871 Ga0075435_1013698712 90
115 3300009011 Ga0105251_10464340 Ga0105251_104643402 90
116 3300009094 Ga0111539_10367222 Ga0111539_103672222 90
117 3300009098 Ga0105245_10010687 Ga0105245_100106873 90
118 3300009101 Ga0105247_10673553 Ga0105247_106735532 90
119 3300009147 Ga0114129_12877831 Ga0114129_128778312 90
120 3300009148 Ga0105243_10758763 Ga0105243_107587632 90
121 3300009545 Ga0105237_10012481 Ga0105237_100124815 90
122 3300009551 Ga0105238_11048507 Ga0105238_110485072 90
123 3300009553 Ga0105249_10003360 Ga0105249_100033605 90
124 3300009553 Ga0105249_10771190 Ga0105249_107711902 90
125 3300010375 Ga0105239_11654430 Ga0105239_116544302 90
126 3300012481 Ga0157320_1004053 Ga0157320_10040531 90
127 3300013296 Ga0157374_10063814 Ga0157374_100638142 90
128 3300013296 Ga0157374_10695016 Ga0157374_106950162 90
129 3300013306 Ga0163162_10691039 Ga0163162_106910392 90
130 3300013307 Ga0157372_12199989 Ga0157372_121999892 90
131 3300013307 Ga0157372_12225998 Ga0157372_122259982 90
132 3300014968 Ga0157379_10259435 Ga0157379_102594352 90
133 3300014968 Ga0157379_10292845 Ga0157379_102928452 90
134 3300014968 Ga0157379_10338281 Ga0157379_103382813 90
135 3300014968 Ga0157379_12352455 Ga0157379_123524551 90
136 3300020081 Ga0206354_11215378 Ga0206354_112153782 90
137 3300020082 Ga0206353_11557784 Ga0206353_115577842 90
138 3300021358 Ga0213873_10005291 Ga0213873_100052913 90
139 3300021377 Ga0213874_10005320 Ga0213874_100053201 90
140 3300021377 Ga0213874_10099137 Ga0213874_100991372 90
141 3300021377 Ga0213874_10376856 Ga0213874_103768562 90
142 3300021384 Ga0213876_10097998 Ga0213876_100979982 90
143 3300021384 Ga0213876_10143821 Ga0213876_101438211 90
144 3300021384 Ga0213876_10235547 Ga0213876_102355472 90
145 3300021388 Ga0213875_10021405 Ga0213875_100214052 90
146 3300021388 Ga0213875_10038176 Ga0213875_100381763 90
147 3300021388 Ga0213875_10147006 Ga0213875_101470062 90
148 3300021388 Ga0213875_10324833 Ga0213875_103248332 90
149 3300021441 Ga0213871_10229218 Ga0213871_102292181 90
150 3300022467 Ga0224712_10054057 Ga0224712_100540572 90
151 3300022467 Ga0224712_10178203 Ga0224712_101782033 90
152 3300025898 Ga0207692_10890733 Ga0207692_108907332 90
153 3300025899 Ga0207642_10409825 Ga0207642_104098252 90
154 3300025900 Ga0207710_10057038 Ga0207710_100570382 90
155 3300025906 Ga0207699_10092555 Ga0207699_100925552 90
156 3300025912 Ga0207707_11204852 Ga0207707_112048522 90
157 3300025914 Ga0207671_10026655 Ga0207671_100266552 90
158 3300025914 Ga0207671_10855574 Ga0207671_108555741 90
159 3300025915 Ga0207693_10024222 Ga0207693_100242224 90
160 3300025915 Ga0207693_10027535 Ga0207693_100275355 90
161 3300025915 Ga0207693_10210398 Ga0207693_102103982 90
162 3300025915 Ga0207693_10386763 Ga0207693_103867632 90
163 3300025916 Ga0207663_10000972 Ga0207663_100009725 90
164 3300025916 Ga0207663_10269568 Ga0207663_102695682 90
165 3300025916 Ga0207663_10619058 Ga0207663_106190582 90
166 3300025916 Ga0207663_11168331 Ga0207663_111683312 90
167 3300025917 Ga0207660_11345543 Ga0207660_113455432 90
168 3300025918 Ga0207662_10522597 Ga0207662_105225972 90
169 3300025921 Ga0207652_11320331 Ga0207652_113203312 90
170 3300025924 Ga0207694_10703995 Ga0207694_107039952 90
171 3300025927 Ga0207687_10716747 Ga0207687_107167472 90
172 3300025928 Ga0207700_10103937 Ga0207700_101039374 90
173 3300025928 Ga0207700_10219840 Ga0207700_102198402 90
174 3300025929 Ga0207664_10122560 Ga0207664_101225602 90
175 3300025929 Ga0207664_10533306 Ga0207664_105333062 90
176 3300025929 Ga0207664_10919090 Ga0207664_109190902 90
177 3300025932 Ga0207690_10004766 Ga0207690_100047669 90
178 3300025935 Ga0207709_10142741 Ga0207709_101427412 90
179 3300025937 Ga0207669_10225889 Ga0207669_102258892 90
180 3300025938 Ga0207704_11342262 Ga0207704_113422622 90
181 3300025939 Ga0207665_10061536 Ga0207665_100615363 90
182 3300025939 Ga0207665_10298397 Ga0207665_102983972 90
183 3300025940 Ga0207691_10000017 Ga0207691_1000001724 90
184 3300025944 Ga0207661_10798699 Ga0207661_107986992 90
185 3300025945 Ga0207679_10535586 Ga0207679_105355861 90
186 3300025961 Ga0207712_10058339 Ga0207712_100583392 90
187 3300025961 Ga0207712_10351020 Ga0207712_103510202 90
188 3300025972 Ga0207668_10024603 Ga0207668_100246034 90
189 3300025972 Ga0207668_10845784 Ga0207668_108457842 90
190 3300025981 Ga0207640_10000093 Ga0207640_1000009325 90
191 3300025981 Ga0207640_10806381 Ga0207640_108063812 90
192 3300025986 Ga0207658_10003551 Ga0207658_100035517 90
193 3300026023 Ga0207677_11160553 Ga0207677_111605532 90
194 3300026035 Ga0207703_10493400 Ga0207703_104934002 90
195 3300026067 Ga0207678_11754146 Ga0207678_117541462 90
196 3300026075 Ga0207708_10352932 Ga0207708_103529322 90
197 3300026075 Ga0207708_10589065 Ga0207708_105890652 90
198 3300026075 Ga0207708_11716154 Ga0207708_117161541 90
199 3300026078 Ga0207702_10120546 Ga0207702_101205463 90
200 3300026088 Ga0207641_10250058 Ga0207641_102500583 90
201 3300026088 Ga0207641_10519522 Ga0207641_105195222 90
202 3300026089 Ga0207648_10593159 Ga0207648_105931592 90
203 3300026116 Ga0207674_10468108 Ga0207674_104681082 90
204 3300026118 Ga0207675_100086557 Ga0207675_1000865572 90
205 3300026118 Ga0207675_100586009 Ga0207675_1005860092 90
206 3300026142 Ga0207698_10776550 Ga0207698_107765502 90
207 3300028379 Ga0268266_10058937 Ga0268266_100589374 90
208 3300028379 Ga0268266_11441054 Ga0268266_114410542 90
209 3300028379 Ga0268266_11775455 Ga0268266_117754552 90
210 3300028380 Ga0268265_10002889 Ga0268265_1000288913 90
211 3300028381 Ga0268264_10130379 Ga0268264_101303792 90
212 3300028381 Ga0268264_10409470 Ga0268264_104094702 90
213 3300028381 Ga0268264_10442007 Ga0268264_104420072 90
214 3300028381 Ga0268264_10511010 Ga0268264_105110102 90
215 3300028381 Ga0268264_11663735 Ga0268264_116637352 90
216 3300028556 Ga0265337_1009373 Ga0265337_10093732 90
217 3300028558 Ga0265326_10000716 Ga0265326_100007162 90
218 3300028563 Ga0265319_1000469 Ga0265319_100046923 90
219 3300028563 Ga0265319_1000590 Ga0265319_100059020 90
220 3300028563 Ga0265319_1012860 Ga0265319_10128605 90
221 3300028573 Ga0265334_10215934 Ga0265334_102159342 90
222 3300028577 Ga0265318_10011178 Ga0265318_100111786 90
223 3300028577 Ga0265318_10091169 Ga0265318_100911692 90
224 3300028654 Ga0265322_10014065 Ga0265322_100140652 90
225 3300028666 Ga0265336_10000005 Ga0265336_10000005146 90
226 3300028666 Ga0265336_10071862 Ga0265336_100718622 90
227 3300028800 Ga0265338_10000001 Ga0265338_10000001962 90
228 3300028800 Ga0265338_10000244 Ga0265338_1000024491 90
229 3300028800 Ga0265338_10012520 Ga0265338_100125204 90
230 3300028800 Ga0265338_10015930 Ga0265338_1001593013 90
231 3300028800 Ga0265338_10127480 Ga0265338_101274802 90
232 3300029957 Ga0265324_10004892 Ga0265324_100048923 90
233 3300029957 Ga0265324_10066886 Ga0265324_100668862 90
234 3300031235 Ga0265330_10257273 Ga0265330_102572731 90
235 3300031238 Ga0265332_10151308 Ga0265332_101513082 90
236 3300031239 Ga0265328_10182987 Ga0265328_101829872 90
237 3300031240 Ga0265320_10024699 Ga0265320_100246992 90
238 3300031240 Ga0265320_10085885 Ga0265320_100858853 90
239 3300031240 Ga0265320_10109999 Ga0265320_101099993 90
240 3300031241 Ga0265325_10079016 Ga0265325_100790162 90
241 3300031241 Ga0265325_10358073 Ga0265325_103580732 90
242 3300031247 Ga0265340_10000001 Ga0265340_10000001960 90
243 3300031247 Ga0265340_10155707 Ga0265340_101557072 90
244 3300031250 Ga0265331_10527426 Ga0265331_105274262 90
245 3300031251 Ga0265327_10004535 Ga0265327_1000453513 90
246 3300031251 Ga0265327_10024251 Ga0265327_100242514 90
247 3300031251 Ga0265327_10208875 Ga0265327_102088752 90
248 3300031344 Ga0265316_10020166 Ga0265316_100201663 90
249 3300031344 Ga0265316_10821085 Ga0265316_108210852 90
250 3300031548 Ga0307408_100396011 Ga0307408_1003960112 90
251 3300031595 Ga0265313_10141817 Ga0265313_101418172 90
252 3300031595 Ga0265313_10193487 Ga0265313_101934872 90
253 3300031711 Ga0265314_10102510 Ga0265314_101025102 90
254 3300031712 Ga0265342_10082727 Ga0265342_100827272 90
255 3300031995 Ga0307409_100227340 Ga0307409_1002273402 90
256 3300031995 Ga0307409_100743786 Ga0307409_1007437862 90
257 3300031995 Ga0307409_102184680 Ga0307409_1021846802 90
258 3300032002 Ga0307416_101675121 Ga0307416_1016751212 90
259 3300032126 Ga0307415_100292148 Ga0307415_1002921482 90
260 3300032126 Ga0307415_100803941 Ga0307415_1008039412 90
261 3300032126 Ga0307415_101668815 Ga0307415_1016688152 90
262 3300035725 Ga0373947_1224475 Ga0373947_1224475_82_357 90
263 3300037068 Ga0373925_0328344 Ga0373925_0328344_546_821 90
264 3300037418 Ga0395900_0704931 Ga0395900_0704931_59_331 90
265 3300037418 Ga0395900_0724967 Ga0395900_0724967_172_444 90
266 3300037466 Ga0395898_1690432 Ga0395898_1690432_264_536 90
267 3300037471 Ga0395905_0833622 Ga0395905_0833622_58_330 90
268 3300037853 Ga0436364_0619416 Ga0436364_0619416_27218_27490 90
269 3300037853 Ga0436364_0951314 Ga0436364_0951314_1951_2223 90
270 3300037853 Ga0436364_1374648 Ga0436364_1374648_374_646 90
271 3300038443 Ga0395901_0158015 Ga0395901_0158015_1922_2194 90
272 3300038443 Ga0395901_0208414 Ga0395901_0208414_158_430 90
273 3300038443 Ga0395901_1163283 Ga0395901_1163283_157_432 90
274 3300038443 Ga0395901_1601705 Ga0395901_1601705_199_474 90
275 3300039437 Ga0436365_0977418 Ga0436365_0977418_73_345 90
276 3300039437 Ga0436365_1429493 Ga0436365_1429493_4400_4672 90
277 3300039437 Ga0436365_1725440 Ga0436365_1725440_213_488 90
278 3300039450 Ga0436363_0038523 Ga0436363_0038523_287_559 90
279 3300039450 Ga0436363_0762001 Ga0436363_0762001_1262_1534 90
280 3300039450 Ga0436363_0931960 Ga0436363_0931960_1174_1446 90
281 3300039453 Ga0436362_0524071 Ga0436362_0524071_350_622 90
282 3300039453 Ga0436362_0701385 Ga0436362_0701385_4619_4891 90
283 3300041460 Ga0451802_0263170 Ga0451802_0263170_348_620 90
284 3300041491 Ga0451833_1334984 Ga0451833_1334984_93_368 90
285 3300041505 Ga0451849_0090613 Ga0451849_0090613_258_530 90
286 3300041512 Ga0451853_0120650 Ga0451853_0120650_124_399 90
287 3300042157 Ga0439458_0178006 Ga0439458_0178006_57_332 90
288 3300044658 Ga0466972_0252349 Ga0466972_0252349_466_741 90
289 3300044683 Ga0466965_0146789 Ga0466965_0146789_284_559 90
290 3300044683 Ga0466965_0209522 Ga0466965_0209522_384_656 90
291 3300044683 Ga0466965_0442447 Ga0466965_0442447_214_486 90
292 3300044683 Ga0466965_0554912 Ga0466965_0554912_14_289 90
293 3300044694 Ga0466963_0649040 Ga0466963_0649040_82_357 90
294 3300044706 Ga0466964_0625747 Ga0466964_0625747_31_306 90
295 3300044719 Ga0466971_0068749 Ga0466971_0068749_1126_1401 90
296 3300044735 Ga0466968_0089033 Ga0466968_0089033_403_675 90
297 3300044765 Ga0466970_0072744 Ga0466970_0072744_119_391 90
298 3300044765 Ga0466970_0298362 Ga0466970_0298362_198_473 90
299 3300044842 Ga0466957_0482029 Ga0466957_0482029_210_485 90
300 3300044901 Ga0466960_0255483 Ga0466960_0255483_385_660 90
301 3300044901 Ga0466960_0315932 Ga0466960_0315932_284_556 90
302 3300044901 Ga0466960_0615959 Ga0466960_0615959_283_558 90
303 3300044901 Ga0466960_0924743 Ga0466960_0924743_119_391 90
304 3300044901 Ga0466960_0963718 Ga0466960_0963718_167_442 90
305 3300045836 Ga0466958_0010414 Ga0466958_0010414_3134_3409 90
306 3300045976 Ga0466967_0007296 Ga0466967_0007296_5245_5520 90
307 3300045976 Ga0466967_0041629 Ga0466967_0041629_2413_2688 90
308 3300045976 Ga0466967_0236217 Ga0466967_0236217_184_459 90
309 3300045976 Ga0466967_0292901 Ga0466967_0292901_739_1014 90
310 3300045976 Ga0466967_0734929 Ga0466967_0734929_562_837 90
311 3300045976 Ga0466967_0783112 Ga0466967_0783112_211_483 90
312 3300045976 Ga0466967_0902353 Ga0466967_0902353_337_612 90
313 3300045976 Ga0466967_1125994 Ga0466967_1125994_459_734 90
314 3300045976 Ga0466967_1134231 Ga0466967_1134231_211_486 90
315 3300045976 Ga0466967_1298652 Ga0466967_1298652_234_509 90
316 3300045976 Ga0466967_1316895 Ga0466967_1316895_153_428 90
317 3300045976 Ga0466967_1568373 Ga0466967_1568373_323_595 90
318 3300045976 Ga0466967_1844969 Ga0466967_1844969_219_494 90
319 3300045976 Ga0466967_1865958 Ga0466967_1865958_257_532 90
320 3300045976 Ga0466967_2440277 Ga0466967_2440277_220_495 90
321 3300046454 Ga0495592_0114874 Ga0495592_0114874_853_1125 90
322 3300046459 Ga0495629_0498474 Ga0495629_0498474_449_724 90
323 3300046460 Ga0495638_0021742 Ga0495638_0021742_1655_1927 90
324 3300046461 Ga0495641_0018456 Ga0495641_0018456_1590_1862 90
325 3300046462 Ga0495651_0976346 Ga0495651_0976346_98_373 90
326 3300046463 Ga0495653_0351360 Ga0495653_0351360_164_439 90
327 3300046475 Ga0495639_0487665 Ga0495639_0487665_250_522 90
328 3300046476 Ga0495662_0000848 Ga0495662_0000848_8949_9221 90
329 3300046477 Ga0495664_0000012 Ga0495664_0000012_82261_82536 90
330 3300046491 Ga0495584_0291364 Ga0495584_0291364_289_561 90
331 3300046514 Ga0495618_0000115 Ga0495618_0000115_55122_55400 90
332 3300046517 Ga0495630_0000533 Ga0495630_0000533_8235_8510 90
333 3300046526 Ga0495666_0309142 Ga0495666_0309142_39_314 90
334 3300046531 Ga0495665_0375889 Ga0495665_0375889_363_638 90
335 3300046535 Ga0495586_0105333 Ga0495586_0105333_97_369 90
336 3300046543 Ga0495645_0000012 Ga0495645_0000012_170721_170999 90
337 3300046543 Ga0495645_0000315 Ga0495645_0000315_22362_22637 90
338 3300046559 Ga0495667_0545000 Ga0495667_0545000_419_694 90
339 3300046660 Ga0495625_0000349 Ga0495625_0000349_54553_54828 90
340 3300046660 Ga0495625_0051027 Ga0495625_0051027_865_1137 90
341 3300046663 Ga0495635_0212729 Ga0495635_0212729_387_662 90
342 3300046675 Ga0495657_0042789 Ga0495657_0042789_578_853 90
343 3300046678 Ga0495599_0317969 Ga0495599_0317969_10_285 90
344 3300046680 Ga0495646_0230562 Ga0495646_0230562_643_918 90
345 3300046681 Ga0495647_0191662 Ga0495647_0191662_255_530 90
346 3300046684 Ga0495669_0064807 Ga0495669_0064807_1275_1547 90
347 3300046690 Ga0495624_0001010 Ga0495624_0001010_20483_20755 90
348 3300046809 Ga0495600_0013117 Ga0495600_0013117_3045_3320 90
349 3300047317 Ga0495604_0212968 Ga0495604_0212968_284_556 90
350 3300047319 Ga0495674_0000030 Ga0495674_0000030_12526_12798 90
351 3300047320 Ga0495672_0294379 Ga0495672_0294379_162_437 90
352 3300047321 Ga0495676_0123451 Ga0495676_0123451_60_335 90
353 3300047321 Ga0495676_0361496 Ga0495676_0361496_72_347 90
354 3300047444 Ga0495675_0067894 Ga0495675_0067894_89_361 90
355 3300047471 Ga0495684_0334463 Ga0495684_0334463_145_420 90
356 3300047472 Ga0495686_0270852 Ga0495686_0270852_452_724 90
357 3300047472 Ga0495686_0471506 Ga0495686_0471506_206_478 90
358 3300048088 Ga0495602_0000007 Ga0495602_0000007_151260_151532 90
359 3300048903 Ga0496100_0087453 Ga0496100_0087453_199_474 90
360 3300048903 Ga0496100_1222870 Ga0496100_1222870_107_379 90
361 3300048905 Ga0496102_0000027 Ga0496102_0000027_93943_94218 90
362 3300048905 Ga0496102_0072496 Ga0496102_0072496_1512_1784 90
363 3300048905 Ga0496102_1694443 Ga0496102_1694443_105_380 90
364 3300048906 Ga0496103_0000062 Ga0496103_0000062_82866_83141 90
365 3300048906 Ga0496103_0078734 Ga0496103_0078734_1037_1309 90
366 3300048906 Ga0496103_0102234 Ga0496103_0102234_1351_1626 90
367 3300048907 Ga0496104_0534843 Ga0496104_0534843_324_599 90
368 3300048908 Ga0496105_0076330 Ga0496105_0076330_1479_1754 90
369 3300048909 Ga0496106_0363441 Ga0496106_0363441_729_1004 90
370 3300048909 Ga0496106_1108917 Ga0496106_1108917_303_578 90
371 3300048910 Ga0496107_0728762 Ga0496107_0728762_315_587 90
372 3300048911 Ga0496108_1550518 Ga0496108_1550518_183_458 90
373 3300048912 Ga0496109_1058143 Ga0496109_1058143_261_536 90
374 3300048913 Ga0496110_0065111 Ga0496110_0065111_1450_1731 90
375 3300048915 Ga0496112_0008141 Ga0496112_0008141_2100_2372 90
376 3300048915 Ga0496112_0556163 Ga0496112_0556163_201_476 90
377 3300048916 Ga0496113_0000013 Ga0496113_0000013_27951_28223 90
378 3300048916 Ga0496113_0308880 Ga0496113_0308880_226_501 90
379 3300048917 Ga0496114_1656659 Ga0496114_1656659_207_482 90
380 3300048918 Ga0496115_0000222 Ga0496115_0000222_48032_48307 90
381 3300048918 Ga0496115_0000245 Ga0496115_0000245_45043_45318 90
382 3300049571 Ga0501034_0578126 Ga0501034_0578126_640_915 90
383 3300049581 Ga0501047_0010850 Ga0501047_0010850_3397_3669 90
384 3300049581 Ga0501047_0097769 Ga0501047_0097769_1591_1869 90
385 3300049583 Ga0501067_0266091 Ga0501067_0266091_323_598 90
386 3300049584 Ga0501068_0130662 Ga0501068_0130662_731_1006 90
387 3300049585 Ga0501069_0031019 Ga0501069_0031019_761_1036 90
388 3300049588 Ga0501072_0100661 Ga0501072_0100661_581_856 90
389 3300049589 Ga0501073_0262196 Ga0501073_0262196_78_353 90
390 3300049590 Ga0501074_0028941 Ga0501074_0028941_3375_3650 90
391 3300049742 Ga0501080_0111029 Ga0501080_0111029_560_835 90
392 3300049742 Ga0501080_0413823 Ga0501080_0413823_131_403 90
393 3300049742 Ga0501080_0467794 Ga0501080_0467794_471_746 90
394 3300049744 Ga0501083_0003895 Ga0501083_0003895_3805_4077 90
395 3300049744 Ga0501083_0069388 Ga0501083_0069388_663_938 90
396 3300049823 Ga0501044_0355241 Ga0501044_0355241_182_454 90
397 3300050495 nmdc:mga04h51_419953_c1 nmdc:mga04h51_419953_c1_114_389 90
398 3300050507 nmdc:mga05p37_1028717_c1 nmdc:mga05p37_1028717_c1_280_552 90
399 3300050509 nmdc:mga0qj67_382876_c1 nmdc:mga0qj67_382876_c1_465_737 90
400 3300050511 nmdc:mga08y16_350103_c1 nmdc:mga08y16_350103_c1_268_543 90
401 3300050512 nmdc:mga0n895_168200_c1 nmdc:mga0n895_168200_c1_513_788 90
402 3300053077 Ga0495601_0000165 Ga0495601_0000165_15734_16006 90
403 3300053077 Ga0495601_0001773 Ga0495601_0001773_5744_6019 90
404 3300053077 Ga0495601_0089146 Ga0495601_0089146_1005_1280 90
405 3300053077 Ga0495601_0963744 Ga0495601_0963744_135_410 90
406 3300053084 Ga0495595_0019433 Ga0495595_0019433_2413_2685 90
407 3300053085 Ga0495619_0589708 Ga0495619_0589708_42_317 90
408 3300053096 Ga0500641_0001622 Ga0500641_0001622_4324_4596 90
409 3300060353 Ga0501082_0505992 Ga0501082_0505992_382_654 90
410 3300061719 Ga0466962_0241201 Ga0466962_0241201_236_511 90

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

5

92

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9466 2 90
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9366 2 90
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.9238 4 90
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.9076 3 87
1v8c-assembly3.cif.gz_B crystal structure of moad related protein from thermus thermophilus hb8 0.9072 4 85
ID Description Score Start End Superfamily
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9466 2 90 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9366 2 90 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9072 4 85 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8947 2 87 3.10.20.30
2l52A00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8872 2 90 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A838PUQ2-F1-model_v4 MoaD/ThiS family protein 0.9873 1 82
AF-A0A538C6W4-F1-model_v4 MoaD/ThiS family protein 0.9871 1 90
AF-A0A7V9IXR5-F1-model_v4 MoaD/ThiS family protein 0.984 4 73
AF-A0A7C5YAF4-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9834 1 81
AF-A0A2H5UWN0-F1-model_v4 Sulfur carrier protein CysO 0.9807 1 90

Feature Viewer

pLDDT pTM Quality
91.7 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map