F437181

General Info

Members Datasets Scaffolds Average Seq Length
410 202 403 182

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100336286|Ga0070706_1003362863
Length 211
Sequence MHLLSSFSECYPNHCSEVTSYVTPDATTMVTDLHTQLDLVRDFVNTFDLETGIDKIATSDELATWFSEQGLVHDLIEPTEQEVEDAHSLREAIRELLLAHNGVEVDAATASQTLEEAGRKAHLGVRFEDGRPVLAPEGDGACAALGRIVATVAELAPTDEWKRMKTCRDEHCRVVFYDKSRNRSRAWCSMEVCGNREKARSFRQRHAHSAS

Samples

Sample ID Description Type Environment
1 2558860280 Kutzneria sp. 744 Isolate Unclassified
2 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
3 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
4 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
91 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
92 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
133 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
134 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
140 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
198 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
199 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.8
Metatranscriptomes 0.49
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.95
Rhizosphere 87.07
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10028586 3300005327 Bacteria 4478
2 Ga0070683_100129799 3300005329 Bacteria 2385
3 Ga0070680_100037484 3300005336 Bacteria 3917
4 Ga0070682_100418294 3300005337 Bacteria 1018
5 Ga0070682_100484767 3300005337 Bacteria 955
6 Ga0068868_100317308 3300005338 Bacteria 1327
7 Ga0068868_100470010 3300005338 Bacteria 1097
8 Ga0070660_100051424 3300005339 Bacteria 3173
9 Ga0070671_100481918 3300005355 Bacteria 1066
10 Ga0070659_100032341 3300005366 Bacteria 4056
11 Ga0070703_10193187 3300005406 Bacteria 794
12 Ga0070709_10045926 3300005434 Bacteria 2714
13 Ga0070714_100008658 3300005435 Bacteria 7956
14 Ga0070714_100024330 3300005435 Bacteria 4984
15 Ga0070714_100033947 3300005435 Bacteria 4271
16 Ga0070714_100037311 3300005435 Bacteria 4083
17 Ga0070714_100070280 3300005435 Bacteria 3026
18 Ga0070714_101452819 3300005435 Bacteria 670
19 Ga0070713_100041466 3300005436 Bacteria 3750
20 Ga0070713_100130919 3300005436 Bacteria 2212
21 Ga0070710_10003439 3300005437 Bacteria 7503
22 Ga0070710_10009232 3300005437 Bacteria 4820
23 Ga0070711_100027039 3300005439 Bacteria 3763
24 Ga0070711_100047147 3300005439 Bacteria 2940
25 Ga0070694_100089405 3300005444 Bacteria 2158
26 Ga0070681_10051474 3300005458 Bacteria 4108
27 Ga0070681_10079821 3300005458 Bacteria 3228
28 Ga0070706_100336286 3300005467 Bacteria 1408
29 Ga0070707_100001986 3300005468 Bacteria 19582
30 Ga0070707_100440146 3300005468 Bacteria 1264
31 Ga0070698_100219347 3300005471 Bacteria 1836
32 Ga0070699_100607965 3300005518 Unclassified 997
33 Ga0070679_100072110 3300005530 Bacteria 3445
34 Ga0070679_100078303 3300005530 Bacteria 3294
35 Ga0070679_100089487 3300005530 Bacteria 3065
36 Ga0070684_100064797 3300005535 Bacteria 3206
37 Ga0070684_100201828 3300005535 Bacteria 1811
38 Ga0070684_100995624 3300005535 Bacteria 787
39 Ga0070695_100000814 3300005545 Bacteria 16811
40 Ga0070696_100297114 3300005546 Unclassified 1236
41 Ga0070704_100064573 3300005549 Bacteria 2632
42 Ga0068855_100248344 3300005563 Bacteria 1985
43 Ga0068855_100294375 3300005563 Unclassified 1799
44 Ga0070664_100174483 3300005564 Bacteria 1908
45 Ga0068854_100289205 3300005578 Bacteria 1322
46 Ga0068856_100145685 3300005614 Bacteria 2376
47 Ga0068852_100097658 3300005616 Bacteria 2643
48 Ga0068851_10491877 3300005834 Bacteria 734
49 Ga0068863_100412618 3300005841 Bacteria 1322
50 Ga0068858_101400072 3300005842 Unclassified 689
51 Ga0070717_10007800 3300006028 Bacteria 7966
52 Ga0070717_10056185 3300006028 Bacteria 3251
53 Ga0070717_10088713 3300006028 Bacteria 2607
54 Ga0070717_10236822 3300006028 Bacteria 1608
55 Ga0070715_10021489 3300006163 Bacteria 2503
56 Ga0070715_10069226 3300006163 Bacteria 1572
57 Ga0070716_100019365 3300006173 Bacteria 3556
58 Ga0070712_100016542 3300006175 Bacteria 4765
59 Ga0070712_100206280 3300006175 Unclassified 1547
60 Ga0070712_100543346 3300006175 Bacteria 978
61 Ga0097621_100857940 3300006237 Bacteria 844
62 Ga0075434_100157187 3300006871 Bacteria 2293
63 Ga0099795_10082408 3300007788 Bacteria 1233
64 Ga0105251_10123382 3300009011 Bacteria 1176
65 Ga0105240_10040071 3300009093 Bacteria 5995
66 Ga0105240_10153851 3300009093 Bacteria 2737
67 Ga0105240_10407593 3300009093 Unclassified 1530
68 Ga0105240_10902481 3300009093 Bacteria 950
69 Ga0111539_10259034 3300009094 Bacteria 2025
70 Ga0105245_10521741 3300009098 Bacteria 1206
71 Ga0105247_10048396 3300009101 Bacteria 2611
72 Ga0114129_10313509 3300009147 Bacteria 2087
73 Ga0105248_10088356 3300009177 Bacteria 3488
74 Ga0105237_10011717 3300009545 Bacteria 9272
75 Ga0105238_11399165 3300009551 Bacteria 727
76 Ga0105239_10658587 3300010375 Bacteria 1196
77 Ga0157369_10915916 3300013105 Unclassified 899
78 Ga0157374_10053595 3300013296 Bacteria 3760
79 Ga0163162_11484963 3300013306 Bacteria 772
80 Ga0157372_10018568 3300013307 Bacteria 7480
81 Ga0182008_10068894 3300014497 Unclassified 1741
82 Ga0157376_10036784 3300014969 Bacteria 3968
83 Ga0206356_10989153 3300020070 Bacteria 2931
84 Ga0206353_11954450 3300020082 Bacteria 2665
85 Ga0207692_10005324 3300025898 Bacteria 5149
86 Ga0207692_10028126 3300025898 Bacteria 2655
87 Ga0207692_10068332 3300025898 Bacteria 1863
88 Ga0207685_10067479 3300025905 Bacteria 1439
89 Ga0207699_10017684 3300025906 Bacteria 3760
90 Ga0207705_10079078 3300025909 Bacteria 2394
91 Ga0207707_10085947 3300025912 Bacteria 2749
92 Ga0207695_10251802 3300025913 Bacteria 1665
93 Ga0207695_10252136 3300025913 Bacteria 1664
94 Ga0207671_10027756 3300025914 Bacteria 4232
95 Ga0207693_10000282 3300025915 Bacteria 47278
96 Ga0207660_10319830 3300025917 Bacteria 1239
97 Ga0207657_10000988 3300025919 Bacteria 30190
98 Ga0207652_10447624 3300025921 Bacteria 1164
99 Ga0207646_10001768 3300025922 Bacteria 26172
100 Ga0207700_10045424 3300025928 Bacteria 3241
101 Ga0207700_10079100 3300025928 Bacteria 2559
102 Ga0207664_10007295 3300025929 Bacteria 7666
103 Ga0207664_10035721 3300025929 Bacteria 3836
104 Ga0207664_10044965 3300025929 Bacteria 3460
105 Ga0207664_10190897 3300025929 Unclassified 1763
106 Ga0207686_10306195 3300025934 Unclassified 1182
107 Ga0207665_10001074 3300025939 Bacteria 18382
108 Ga0207665_10050605 3300025939 Bacteria 2794
109 Ga0207711_10408641 3300025941 Unclassified 1262
110 Ga0207661_10074555 3300025944 Bacteria 2781
111 Ga0207661_10395142 3300025944 Bacteria 1253
112 Ga0207667_10541194 3300025949 Bacteria 1178
113 Ga0207677_10250380 3300026023 Bacteria 1438
114 Ga0207677_11026924 3300026023 Bacteria 749
115 Ga0207702_10116059 3300026078 Bacteria 2388
116 Ga0207641_10659413 3300026088 Bacteria 1028
117 Ga0207698_10207099 3300026142 Bacteria 1761
118 Ga0265338_10000924 3300028800 Bacteria 49511
119 Ga0265338_10116893 3300028800 Bacteria 2135
120 Ga0265324_10021117 3300029957 Bacteria 2336
121 Ga0265327_10048038 3300031251 Bacteria 2247
122 Ga0265313_10113507 3300031595 Bacteria 1189
123 Ga0316583_10057266 3300032133 Bacteria 1369
124 Ga0373926_0024316 3300035083 Bacteria 2109
125 Ga0373936_0093672 3300035113 Bacteria 1261
126 Ga0373953_0261626 3300035117 Bacteria 753
127 Ga0373956_0110362 3300035119 Bacteria 1280
128 Ga0373957_0301356 3300035120 Bacteria 680
129 Ga0373943_0004768 3300035170 Bacteria 6129
130 Ga0373924_0111082 3300035410 Bacteria 1185
131 Ga0373933_0050680 3300035724 Unclassified 2479
132 Ga0373947_0000371 3300035725 Bacteria 25349
133 Ga0373937_0000725 3300036401 Bacteria 28683
134 Ga0373925_0001462 3300037068 Bacteria 20386
135 Ga0395899_0045692 3300037312 Bacteria 3263
136 Ga0395900_0253268 3300037418 Bacteria 1761
137 Ga0395898_0109506 3300037466 Bacteria 2648
138 Ga0395905_0308059 3300037471 Bacteria 1472
139 Ga0395901_0459363 3300038443 Bacteria 1301
140 Ga0436363_1276431 3300039450 Bacteria 902
141 Ga0466965_0024499 3300044683 Bacteria 2920
142 Ga0466965_0257070 3300044683 Bacteria 938
143 Ga0466965_0539877 3300044683 Bacteria 657
144 Ga0466966_0059424 3300044684 Bacteria 2414
145 Ga0466961_0008333 3300044693 Bacteria 6599
146 Ga0466961_0014252 3300044693 Bacteria 5103
147 Ga0466961_0030814 3300044693 Bacteria 3446
148 Ga0466961_0118620 3300044693 Bacteria 1662
149 Ga0466963_0000102 3300044694 Bacteria 30465
150 Ga0466963_0003617 3300044694 Bacteria 8883
151 Ga0466963_0005276 3300044694 Bacteria 7547
152 Ga0466963_0012870 3300044694 Bacteria 5125
153 Ga0466963_0016078 3300044694 Bacteria 4647
154 Ga0466963_0019443 3300044694 Bacteria 4261
155 Ga0466963_0035681 3300044694 Bacteria 3240
156 Ga0466963_0038174 3300044694 Bacteria 3139
157 Ga0466964_0003428 3300044706 Bacteria 5785
158 Ga0466964_0006069 3300044706 Bacteria 4504
159 Ga0466964_0017967 3300044706 Bacteria 2709
160 Ga0466964_0068165 3300044706 Unclassified 1498
161 Ga0466964_0122918 3300044706 Bacteria 1172
162 Ga0466971_0015053 3300044719 Bacteria 3402
163 Ga0466971_0063321 3300044719 Bacteria 1674
164 Ga0466971_0081435 3300044719 Bacteria 1476
165 Ga0466968_0001167 3300044735 Bacteria 9315
166 Ga0466968_0091919 3300044735 Bacteria 1346
167 Ga0466970_0009132 3300044765 Bacteria 5004
168 Ga0466970_0038292 3300044765 Bacteria 2543
169 Ga0466970_0201142 3300044765 Bacteria 1108
170 Ga0466957_0005782 3300044842 Bacteria 6952
171 Ga0466957_0008474 3300044842 Bacteria 5849
172 Ga0466957_0010928 3300044842 Bacteria 5221
173 Ga0466957_0012050 3300044842 Bacteria 4998
174 Ga0466957_0188909 3300044842 Bacteria 1349
175 Ga0466957_0325143 3300044842 Unclassified 1038
176 Ga0466957_0400897 3300044842 Bacteria 938
177 Ga0466957_0512068 3300044842 Bacteria 833
178 Ga0466957_0609987 3300044842 Bacteria 764
179 Ga0466957_0647849 3300044842 Bacteria 742
180 Ga0466960_0018742 3300044901 Bacteria 3038
181 Ga0466960_0061333 3300044901 Bacteria 1846
182 Ga0466959_0024990 3300045049 Bacteria 4424
183 Ga0466959_0082093 3300045049 Unclassified 2322
184 Ga0466959_0387019 3300045049 Bacteria 951
185 Ga0466958_0005167 3300045836 Bacteria 6983
186 Ga0466958_0005361 3300045836 Bacteria 6889
187 Ga0466958_0010780 3300045836 Bacteria 5128
188 Ga0466958_0019589 3300045836 Bacteria 3939
189 Ga0466958_0023292 3300045836 Bacteria 3632
190 Ga0466958_0023638 3300045836 Bacteria 3610
191 Ga0466958_0106069 3300045836 Bacteria 1751
192 Ga0466958_0198218 3300045836 Bacteria 1277
193 Ga0466967_0000094 3300045976 Bacteria 31562
194 Ga0466967_0011615 3300045976 Bacteria 6686
195 Ga0466967_0014799 3300045976 Bacteria 6093
196 Ga0466967_0023089 3300045976 Bacteria 5091
197 Ga0466967_0039568 3300045976 Bacteria 4054
198 Ga0466967_0053118 3300045976 Bacteria 3560
199 Ga0466967_0076521 3300045976 Bacteria 3010
200 Ga0466967_0101536 3300045976 Bacteria 2629
201 Ga0466967_0122027 3300045976 Bacteria 2409
202 Ga0466967_0275727 3300045976 Bacteria 1612
203 Ga0466967_0347276 3300045976 Bacteria 1436
204 Ga0466967_0588715 3300045976 Bacteria 1097
205 Ga0495592_0000050 3300046454 Bacteria 111971
206 Ga0495592_0140719 3300046454 Unclassified 1679
207 Ga0495592_0204476 3300046454 Bacteria 1330
208 Ga0495592_0336732 3300046454 Bacteria 971
209 Ga0495603_0094958 3300046455 Bacteria 1742
210 Ga0495629_0006824 3300046459 Bacteria 8441
211 Ga0495629_0091126 3300046459 Bacteria 2127
212 Ga0495629_0107223 3300046459 Bacteria 1949
213 Ga0495641_0005829 3300046461 Bacteria 8165
214 Ga0495641_0029085 3300046461 Bacteria 2665
215 Ga0495641_0031545 3300046461 Bacteria 2531
216 Ga0495651_0000028 3300046462 Bacteria 105473
217 Ga0495651_0106647 3300046462 Bacteria 2076
218 Ga0495651_0556150 3300046462 Bacteria 728
219 Ga0495653_0001289 3300046463 Bacteria 19386
220 Ga0495653_0005665 3300046463 Bacteria 10200
221 Ga0495653_0039159 3300046463 Bacteria 3715
222 Ga0495653_0447260 3300046463 Bacteria 813
223 Ga0495580_0004702 3300046472 Bacteria 11446
224 Ga0495582_0003512 3300046473 Bacteria 8836
225 Ga0495582_0152107 3300046473 Unclassified 1314
226 Ga0495639_0000481 3300046475 Bacteria 19003
227 Ga0495662_0000184 3300046476 Bacteria 25256
228 Ga0495662_0000359 3300046476 Bacteria 20037
229 Ga0495662_0127326 3300046476 Unclassified 1251
230 Ga0495664_0006065 3300046477 Bacteria 6664
231 Ga0495664_0164078 3300046477 Bacteria 1348
232 Ga0495664_0248175 3300046477 Bacteria 1076
233 Ga0495584_0019684 3300046491 Bacteria 3429
234 Ga0495585_0178492 3300046492 Bacteria 1093
235 Ga0495607_0053355 3300046501 Bacteria 2337
236 Ga0495608_0002062 3300046511 Bacteria 14459
237 Ga0495608_0048015 3300046511 Bacteria 2837
238 Ga0495608_0081771 3300046511 Bacteria 2098
239 Ga0495608_0167776 3300046511 Unclassified 1393
240 Ga0495608_0456216 3300046511 Bacteria 777
241 Ga0495618_0001024 3300046514 Bacteria 19164
242 Ga0495618_0051562 3300046514 Bacteria 2599
243 Ga0495618_0113005 3300046514 Unclassified 1739
244 Ga0495618_0130561 3300046514 Bacteria 1607
245 Ga0495618_0232721 3300046514 Unclassified 1160
246 Ga0495618_0244664 3300046514 Bacteria 1127
247 Ga0495628_0000060 3300046516 Bacteria 87173
248 Ga0495628_0008128 3300046516 Bacteria 9029
249 Ga0495628_0177947 3300046516 Bacteria 1610
250 Ga0495630_0000995 3300046517 Bacteria 19714
251 Ga0495630_0104039 3300046517 Bacteria 2148
252 Ga0495630_0221223 3300046517 Unclassified 1445
253 Ga0495644_0157446 3300046523 Unclassified 870
254 Ga0495666_0000688 3300046526 Bacteria 15346
255 Ga0495652_0000969 3300046529 Bacteria 32863
256 Ga0495652_0008136 3300046529 Bacteria 9590
257 Ga0495652_0010648 3300046529 Bacteria 8330
258 Ga0495665_0004703 3300046531 Bacteria 7364
259 Ga0495640_0014224 3300046533 Bacteria 6030
260 Ga0495640_0123159 3300046533 Bacteria 1683
261 Ga0495640_0203567 3300046533 Unclassified 1254
262 Ga0495640_0213372 3300046533 Unclassified 1219
263 Ga0495586_0033309 3300046535 Bacteria 2765
264 Ga0495586_0067682 3300046535 Bacteria 1947
265 Ga0495587_0000062 3300046536 Bacteria 91862
266 Ga0495587_0086090 3300046536 Bacteria 1819
267 Ga0495645_0000207 3300046543 Bacteria 42086
268 Ga0495645_0004423 3300046543 Bacteria 9598
269 Ga0495645_0055416 3300046543 Bacteria 2879
270 Ga0495645_0379763 3300046543 Unclassified 904
271 Ga0495667_0009415 3300046559 Bacteria 6617
272 Ga0495667_0190482 3300046559 Bacteria 1314
273 Ga0495667_0256554 3300046559 Bacteria 1112
274 Ga0495656_0017577 3300046615 Bacteria 2731
275 Ga0495634_0024255 3300046642 Bacteria 4259
276 Ga0495634_0068329 3300046642 Bacteria 2348
277 Ga0495611_0025819 3300046648 Bacteria 2562
278 Ga0495635_0009343 3300046663 Bacteria 6852
279 Ga0495635_0074020 3300046663 Bacteria 2333
280 Ga0495635_0191008 3300046663 Unclassified 1390
281 Ga0495661_0179833 3300046665 Bacteria 1122
282 Ga0495657_0014967 3300046675 Bacteria 5690
283 Ga0495657_0136625 3300046675 Bacteria 1531
284 Ga0495599_0000202 3300046678 Bacteria 39562
285 Ga0495599_0180866 3300046678 Bacteria 1300
286 Ga0495623_0000230 3300046679 Bacteria 35964
287 Ga0495646_0013664 3300046680 Bacteria 5161
288 Ga0495646_0017844 3300046680 Bacteria 4497
289 Ga0495646_0019601 3300046680 Bacteria 4279
290 Ga0495647_0000670 3300046681 Bacteria 10187
291 Ga0495658_0023169 3300046683 Bacteria 3293
292 Ga0495613_0005595 3300046689 Bacteria 9434
293 Ga0495613_0028992 3300046689 Bacteria 4115
294 Ga0495613_0183245 3300046689 Unclassified 1482
295 Ga0495624_0027518 3300046690 Bacteria 3722
296 Ga0495624_0052653 3300046690 Bacteria 2571
297 Ga0495624_0067971 3300046690 Bacteria 2222
298 Ga0495670_0054914 3300046691 Bacteria 1997
299 Ga0495600_0008576 3300046809 Bacteria 6286
300 Ga0495600_0053048 3300046809 Bacteria 2648
301 Ga0495600_0247676 3300046809 Unclassified 1134
302 Ga0495600_0763222 3300046809 Bacteria 578
303 Ga0495581_0017948 3300047315 Bacteria 4111
304 Ga0495581_0236512 3300047315 Bacteria 1068
305 Ga0495604_0000262 3300047317 Bacteria 46873
306 Ga0495604_0045005 3300047317 Bacteria 3446
307 Ga0495604_0078218 3300047317 Bacteria 2483
308 Ga0495636_0052271 3300047318 Bacteria 1714
309 Ga0495674_0013316 3300047319 Bacteria 7734
310 Ga0495674_0354643 3300047319 Unclassified 1190
311 Ga0495674_0682323 3300047319 Unclassified 807
312 Ga0495676_0019630 3300047321 Bacteria 5942
313 Ga0495676_0032491 3300047321 Bacteria 4404
314 Ga0495676_0211460 3300047321 Bacteria 1341
315 Ga0495676_0722340 3300047321 Bacteria 644
316 Ga0495680_0020304 3300047322 Bacteria 5592
317 Ga0495680_0034009 3300047322 Bacteria 4123
318 Ga0495680_0109560 3300047322 Bacteria 2047
319 Ga0495675_0000020 3300047444 Bacteria 111526
320 Ga0495675_0045314 3300047444 Bacteria 2801
321 Ga0495677_0049076 3300047445 Unclassified 1551
322 Ga0495684_0012195 3300047471 Bacteria 6630
323 Ga0495684_0016556 3300047471 Bacteria 5679
324 Ga0495684_0039015 3300047471 Bacteria 3640
325 Ga0495593_0001863 3300047673 Bacteria 12556
326 Ga0495602_0000222 3300048088 Bacteria 53050
327 Ga0495602_0039532 3300048088 Bacteria 4342
328 Ga0495614_0001717 3300048089 Bacteria 9568
329 Ga0496100_0041479 3300048903 Bacteria 2933
330 Ga0496100_0206156 3300048903 Bacteria 1436
331 Ga0496101_0011809 3300048904 Bacteria 5809
332 Ga0496101_0108366 3300048904 Bacteria 2088
333 Ga0496102_0021075 3300048905 Bacteria 5764
334 Ga0496102_0082856 3300048905 Bacteria 2958
335 Ga0496103_0014385 3300048906 Bacteria 4700
336 Ga0496103_0018723 3300048906 Bacteria 4155
337 Ga0496104_0014672 3300048907 Bacteria 7078
338 Ga0496104_0015903 3300048907 Bacteria 6828
339 Ga0496104_0230125 3300048907 Bacteria 1765
340 Ga0496104_0441737 3300048907 Bacteria 1213
341 Ga0496105_0017378 3300048908 Bacteria 5765
342 Ga0496105_0019886 3300048908 Bacteria 5418
343 Ga0496105_0029719 3300048908 Bacteria 4473
344 Ga0496106_0115368 3300048909 Bacteria 2094
345 Ga0496106_0259759 3300048909 Bacteria 1390
346 Ga0496107_0009770 3300048910 Bacteria 6654
347 Ga0496107_0031675 3300048910 Bacteria 3776
348 Ga0496107_0323184 3300048910 Unclassified 1148
349 Ga0496108_0009079 3300048911 Bacteria 8054
350 Ga0496108_0034402 3300048911 Bacteria 4210
351 Ga0496108_0071809 3300048911 Bacteria 2921
352 Ga0496108_0397947 3300048911 Unclassified 1203
353 Ga0496109_0010667 3300048912 Bacteria 7860
354 Ga0496109_0026642 3300048912 Bacteria 5157
355 Ga0496109_0148123 3300048912 Bacteria 2197
356 Ga0496109_0329022 3300048912 Bacteria 1442
357 Ga0496109_1174499 3300048912 Bacteria 704
358 Ga0496110_1021754 3300048913 Bacteria 734
359 Ga0496111_0036366 3300048914 Bacteria 3520
360 Ga0496111_0046870 3300048914 Bacteria 3113
361 Ga0496112_0098299 3300048915 Bacteria 2896
362 Ga0496112_0106028 3300048915 Bacteria 2780
363 Ga0496112_0793866 3300048915 Bacteria 872
364 Ga0496113_0029330 3300048916 Bacteria 3971
365 Ga0496113_0131356 3300048916 Bacteria 1965
366 Ga0496113_0644251 3300048916 Bacteria 847
367 Ga0496114_0017907 3300048917 Bacteria 5725
368 Ga0496114_0052601 3300048917 Bacteria 3393
369 Ga0496114_0066011 3300048917 Bacteria 3033
370 Ga0496114_0382330 3300048917 Bacteria 1246
371 Ga0496115_0020647 3300048918 Bacteria 5082
372 Ga0496115_0048713 3300048918 Bacteria 3389
373 Ga0496115_0061199 3300048918 Bacteria 3035
374 Ga0496115_0079276 3300048918 Bacteria 2673
375 Ga0496115_0118095 3300048918 Bacteria 2181
376 Ga0496115_0209041 3300048918 Bacteria 1612
377 Ga0496115_0447098 3300048918 Bacteria 1044
378 Ga0501068_0552736 3300049584 Bacteria 749
379 Ga0501069_0456910 3300049585 Bacteria 759
380 Ga0501077_0160142 3300049593 Bacteria 1429
381 nmdc:mga0n895_25551_c1 3300050512 Bacteria 5582
382 nmdc:mga0a205_95152_c1 3300050515 Bacteria 2877
383 Ga0495601_0000218 3300053077 Bacteria 30705
384 Ga0495601_0005907 3300053077 Bacteria 7136
385 Ga0495601_0053519 3300053077 Bacteria 2551
386 Ga0495601_0158768 3300053077 Unclassified 1477
387 Ga0495601_0203688 3300053077 Bacteria 1293
388 Ga0495601_0492409 3300053077 Bacteria 791
389 Ga0495612_0003098 3300053078 Bacteria 6890
390 Ga0495612_0016785 3300053078 Bacteria 2932
391 Ga0495612_0062708 3300053078 Bacteria 1541
392 Ga0495655_0004634 3300053083 Bacteria 2368
393 Ga0495655_0073844 3300053083 Unclassified 960
394 Ga0495595_0063170 3300053084 Bacteria 1738
395 Ga0495595_0198492 3300053084 Unclassified 998
396 Ga0495619_0001137 3300053085 Bacteria 17476
397 Ga0495619_0235244 3300053085 Unclassified 1269
398 Ga0495619_0355939 3300053085 Unclassified 1012
399 Ga0495619_0410843 3300053085 Bacteria 934
400 Ga0495619_0482150 3300053085 Bacteria 854
401 Ga0466962_0000096 3300061719 Bacteria 35253
402 Ga0466962_0020166 3300061719 Bacteria 3204
403 Ga0466962_0060040 3300061719 Bacteria 1815

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0201142 Ga0466970_0201142_307_840 156
2 iso_pu_bacteria 8056207758 8056211037 157
3 iso_pu_bacteria 2775506925 2776373704 158
4 iso_pu_bacteria 2863067949 2863070134 158
5 iso_pu_bacteria 2866552031 2866555756 158
6 iso_pu_bacteria 2558860280 2559428524 161
7 iso_pu_bacteria 2866552031 2866552130 161
8 3300009093 Ga0105240_10407593 Ga0105240_104075932 162
9 iso_pu_bacteria 8056207758 8056208182 163
10 3300005435 Ga0070714_100070280 Ga0070714_1000702802 166
11 3300005834 Ga0068851_10491877 Ga0068851_104918771 166
12 3300048907 Ga0496104_0441737 Ga0496104_0441737_258_803 166
13 3300048912 Ga0496109_1174499 Ga0496109_1174499_11_562 167
14 3300005434 Ga0070709_10045926 Ga0070709_100459263 168
15 3300005436 Ga0070713_100130919 Ga0070713_1001309192 168
16 3300005437 Ga0070710_10009232 Ga0070710_100092326 168
17 3300005439 Ga0070711_100047147 Ga0070711_1000471474 168
18 3300005535 Ga0070684_100064797 Ga0070684_1000647972 168
19 3300005563 Ga0068855_100294375 Ga0068855_1002943752 168
20 3300006028 Ga0070717_10236822 Ga0070717_102368223 168
21 3300006163 Ga0070715_10069226 Ga0070715_100692262 168
22 3300006175 Ga0070712_100016542 Ga0070712_1000165423 168
23 3300007788 Ga0099795_10082408 Ga0099795_100824083 168
24 3300009093 Ga0105240_10902481 Ga0105240_109024812 168
25 3300025898 Ga0207692_10005324 Ga0207692_100053243 168
26 3300025905 Ga0207685_10067479 Ga0207685_100674792 168
27 3300025906 Ga0207699_10017684 Ga0207699_100176845 168
28 3300025915 Ga0207693_10000282 Ga0207693_1000028224 168
29 3300025928 Ga0207700_10079100 Ga0207700_100791003 168
30 3300025929 Ga0207664_10035721 Ga0207664_100357213 168
31 3300025939 Ga0207665_10050605 Ga0207665_100506053 168
32 3300035120 Ga0373957_0301356 Ga0373957_0301356_28_573 168
33 3300046459 Ga0495629_0091126 Ga0495629_0091126_125_664 168
34 3300046459 Ga0495629_0107223 Ga0495629_0107223_1094_1633 168
35 3300046461 Ga0495641_0029085 Ga0495641_0029085_1984_2523 168
36 3300046476 Ga0495662_0127326 Ga0495662_0127326_388_927 168
37 3300046511 Ga0495608_0081771 Ga0495608_0081771_1090_1629 168
38 3300046517 Ga0495630_0221223 Ga0495630_0221223_549_1088 168
39 3300046533 Ga0495640_0213372 Ga0495640_0213372_365_904 168
40 3300046535 Ga0495586_0033309 Ga0495586_0033309_1742_2281 168
41 3300046642 Ga0495634_0068329 Ga0495634_0068329_1160_1699 168
42 3300046689 Ga0495613_0005595 Ga0495613_0005595_464_1003 168
43 3300046690 Ga0495624_0052653 Ga0495624_0052653_49_588 168
44 3300047315 Ga0495581_0236512 Ga0495581_0236512_76_615 168
45 3300047319 Ga0495674_0013316 Ga0495674_0013316_6785_7324 168
46 3300047321 Ga0495676_0211460 Ga0495676_0211460_25_564 168
47 3300048904 Ga0496101_0108366 Ga0496101_0108366_14_553 168
48 3300048907 Ga0496104_0014672 Ga0496104_0014672_776_1315 168
49 3300048908 Ga0496105_0017378 Ga0496105_0017378_4892_5431 168
50 3300048910 Ga0496107_0323184 Ga0496107_0323184_485_1018 168
51 3300048912 Ga0496109_0148123 Ga0496109_0148123_353_892 168
52 3300048917 Ga0496114_0017907 Ga0496114_0017907_4643_5182 168
53 3300048918 Ga0496115_0118095 Ga0496115_0118095_542_1081 168
54 3300053077 Ga0495601_0203688 Ga0495601_0203688_486_1025 168
55 3300053085 Ga0495619_0235244 Ga0495619_0235244_401_940 168
56 3300032133 Ga0316583_10057266 Ga0316583_100572661 169
57 3300005435 Ga0070714_100008658 Ga0070714_1000086584 170
58 3300006028 Ga0070717_10007800 Ga0070717_1000780010 170
59 3300009177 Ga0105248_10088356 Ga0105248_100883562 170
60 3300025929 Ga0207664_10190897 Ga0207664_101908973 170
61 3300028800 Ga0265338_10116893 Ga0265338_101168933 170
62 3300029957 Ga0265324_10021117 Ga0265324_100211172 170
63 3300031251 Ga0265327_10048038 Ga0265327_100480383 170
64 3300039450 Ga0436363_1276431 Ga0436363_1276431_228_767 170
65 3300044694 Ga0466963_0038174 Ga0466963_0038174_1229_1777 170
66 3300044842 Ga0466957_0400897 Ga0466957_0400897_11_559 170
67 3300045836 Ga0466958_0023638 Ga0466958_0023638_1001_1549 170
68 3300046455 Ga0495603_0094958 Ga0495603_0094958_1121_1660 170
69 3300046461 Ga0495641_0031545 Ga0495641_0031545_35_574 170
70 3300046514 Ga0495618_0113005 Ga0495618_0113005_691_1230 170
71 3300046533 Ga0495640_0203567 Ga0495640_0203567_81_620 170
72 3300049584 Ga0501068_0552736 Ga0501068_0552736_169_708 170
73 3300053085 Ga0495619_0482150 Ga0495619_0482150_110_649 170
74 3300005435 Ga0070714_100033947 Ga0070714_1000339476 171
75 3300028800 Ga0265338_10000924 Ga0265338_1000092432 171
76 3300031595 Ga0265313_10113507 Ga0265313_101135071 171
77 3300035117 Ga0373953_0261626 Ga0373953_0261626_66_608 171
78 3300035119 Ga0373956_0110362 Ga0373956_0110362_241_783 171
79 3300035724 Ga0373933_0050680 Ga0373933_0050680_359_901 171
80 3300036401 Ga0373937_0000725 Ga0373937_0000725_4298_4840 171
81 3300044683 Ga0466965_0257070 Ga0466965_0257070_101_649 171
82 3300044693 Ga0466961_0118620 Ga0466961_0118620_680_1228 171
83 3300044694 Ga0466963_0005276 Ga0466963_0005276_1649_2191 171
84 3300044694 Ga0466963_0019443 Ga0466963_0019443_3486_4028 171
85 3300044706 Ga0466964_0003428 Ga0466964_0003428_642_1184 171
86 3300044706 Ga0466964_0006069 Ga0466964_0006069_3498_4046 171
87 3300044706 Ga0466964_0017967 Ga0466964_0017967_1735_2283 171
88 3300044719 Ga0466971_0063321 Ga0466971_0063321_249_797 171
89 3300044719 Ga0466971_0081435 Ga0466971_0081435_477_1025 171
90 3300044765 Ga0466970_0038292 Ga0466970_0038292_1541_2089 171
91 3300044842 Ga0466957_0012050 Ga0466957_0012050_1343_1891 171
92 3300044842 Ga0466957_0609987 Ga0466957_0609987_143_685 171
93 3300044842 Ga0466957_0647849 Ga0466957_0647849_126_668 171
94 3300044901 Ga0466960_0061333 Ga0466960_0061333_985_1533 171
95 3300045049 Ga0466959_0387019 Ga0466959_0387019_263_811 171
96 3300045836 Ga0466958_0010780 Ga0466958_0010780_477_1025 171
97 3300045836 Ga0466958_0106069 Ga0466958_0106069_856_1398 171
98 3300045836 Ga0466958_0198218 Ga0466958_0198218_451_999 171
99 3300045976 Ga0466967_0011615 Ga0466967_0011615_292_840 171
100 3300045976 Ga0466967_0039568 Ga0466967_0039568_3340_3882 171
101 3300045976 Ga0466967_0076521 Ga0466967_0076521_832_1380 171
102 3300045976 Ga0466967_0101536 Ga0466967_0101536_1750_2298 171
103 3300045976 Ga0466967_0122027 Ga0466967_0122027_1726_2268 171
104 3300045976 Ga0466967_0347276 Ga0466967_0347276_279_821 171
105 3300046454 Ga0495592_0000050 Ga0495592_0000050_45146_45688 171
106 3300046462 Ga0495651_0000028 Ga0495651_0000028_52464_53006 171
107 3300046462 Ga0495651_0106647 Ga0495651_0106647_1459_2001 171
108 3300046463 Ga0495653_0001289 Ga0495653_0001289_17344_17886 171
109 3300046463 Ga0495653_0039159 Ga0495653_0039159_528_1070 171
110 3300046511 Ga0495608_0002062 Ga0495608_0002062_3069_3611 171
111 3300046511 Ga0495608_0167776 Ga0495608_0167776_809_1351 171
112 3300046511 Ga0495608_0456216 Ga0495608_0456216_71_613 171
113 3300046514 Ga0495618_0001024 Ga0495618_0001024_1397_1939 171
114 3300046514 Ga0495618_0232721 Ga0495618_0232721_344_886 171
115 3300046516 Ga0495628_0000060 Ga0495628_0000060_44708_45250 171
116 3300046516 Ga0495628_0008128 Ga0495628_0008128_1586_2128 171
117 3300046529 Ga0495652_0000969 Ga0495652_0000969_23690_24232 171
118 3300046529 Ga0495652_0010648 Ga0495652_0010648_4625_5167 171
119 3300046536 Ga0495587_0000062 Ga0495587_0000062_38854_39396 171
120 3300046543 Ga0495645_0000207 Ga0495645_0000207_23463_24005 171
121 3300046543 Ga0495645_0004423 Ga0495645_0004423_5186_5728 171
122 3300046559 Ga0495667_0256554 Ga0495667_0256554_303_845 171
123 3300046663 Ga0495635_0074020 Ga0495635_0074020_1767_2309 171
124 3300046675 Ga0495657_0014967 Ga0495657_0014967_560_1102 171
125 3300046678 Ga0495599_0000202 Ga0495599_0000202_8101_8643 171
126 3300046679 Ga0495623_0000230 Ga0495623_0000230_25091_25633 171
127 3300046680 Ga0495646_0013664 Ga0495646_0013664_4457_4999 171
128 3300046680 Ga0495646_0017844 Ga0495646_0017844_3457_3999 171
129 3300046809 Ga0495600_0008576 Ga0495600_0008576_4775_5317 171
130 3300046809 Ga0495600_0247676 Ga0495600_0247676_558_1100 171
131 3300047317 Ga0495604_0000262 Ga0495604_0000262_1511_2053 171
132 3300047317 Ga0495604_0045005 Ga0495604_0045005_1532_2074 171
133 3300047322 Ga0495680_0109560 Ga0495680_0109560_182_724 171
134 3300047444 Ga0495675_0000020 Ga0495675_0000020_66293_66835 171
135 3300047444 Ga0495675_0045314 Ga0495675_0045314_2124_2666 171
136 3300048088 Ga0495602_0000222 Ga0495602_0000222_12799_13341 171
137 3300048088 Ga0495602_0039532 Ga0495602_0039532_568_1110 171
138 3300048918 Ga0496115_0079276 Ga0496115_0079276_1519_2061 171
139 3300049585 Ga0501069_0456910 Ga0501069_0456910_44_592 171
140 3300053077 Ga0495601_0000218 Ga0495601_0000218_2812_3354 171
141 3300053077 Ga0495601_0053519 Ga0495601_0053519_445_987 171
142 3300053078 Ga0495612_0003098 Ga0495612_0003098_4841_5383 171
143 3300053084 Ga0495595_0063170 Ga0495595_0063170_709_1251 171
144 3300053085 Ga0495619_0001137 Ga0495619_0001137_11870_12412 171
145 3300061719 Ga0466962_0020166 Ga0466962_0020166_2123_2671 171
146 3300061719 Ga0466962_0060040 Ga0466962_0060040_225_773 171
147 3300005329 Ga0070683_100129799 Ga0070683_1001297993 172
148 3300005336 Ga0070680_100037484 Ga0070680_1000374845 172
149 3300005337 Ga0070682_100418294 Ga0070682_1004182942 172
150 3300005337 Ga0070682_100484767 Ga0070682_1004847672 172
151 3300005338 Ga0068868_100317308 Ga0068868_1003173082 172
152 3300005338 Ga0068868_100470010 Ga0068868_1004700102 172
153 3300005339 Ga0070660_100051424 Ga0070660_1000514243 172
154 3300005355 Ga0070671_100481918 Ga0070671_1004819182 172
155 3300005366 Ga0070659_100032341 Ga0070659_1000323415 172
156 3300005406 Ga0070703_10193187 Ga0070703_101931871 172
157 3300005435 Ga0070714_100024330 Ga0070714_1000243303 172
158 3300005435 Ga0070714_100037311 Ga0070714_1000373115 172
159 3300005435 Ga0070714_101452819 Ga0070714_1014528191 172
160 3300005436 Ga0070713_100041466 Ga0070713_1000414665 172
161 3300005437 Ga0070710_10003439 Ga0070710_100034393 172
162 3300005439 Ga0070711_100027039 Ga0070711_1000270393 172
163 3300005444 Ga0070694_100089405 Ga0070694_1000894053 172
164 3300005458 Ga0070681_10051474 Ga0070681_100514743 172
165 3300005458 Ga0070681_10079821 Ga0070681_100798213 172
166 3300005467 Ga0070706_100336286 Ga0070706_1003362863 172
167 3300005468 Ga0070707_100001986 Ga0070707_10000198619 172
168 3300005468 Ga0070707_100440146 Ga0070707_1004401463 172
169 3300005471 Ga0070698_100219347 Ga0070698_1002193473 172
170 3300005518 Ga0070699_100607965 Ga0070699_1006079652 172
171 3300005530 Ga0070679_100072110 Ga0070679_1000721103 172
172 3300005530 Ga0070679_100078303 Ga0070679_1000783033 172
173 3300005530 Ga0070679_100089487 Ga0070679_1000894871 172
174 3300005535 Ga0070684_100201828 Ga0070684_1002018282 172
175 3300005535 Ga0070684_100995624 Ga0070684_1009956241 172
176 3300005545 Ga0070695_100000814 Ga0070695_10000081410 172
177 3300005546 Ga0070696_100297114 Ga0070696_1002971142 172
178 3300005549 Ga0070704_100064573 Ga0070704_1000645733 172
179 3300005563 Ga0068855_100248344 Ga0068855_1002483443 172
180 3300005564 Ga0070664_100174483 Ga0070664_1001744832 172
181 3300005578 Ga0068854_100289205 Ga0068854_1002892052 172
182 3300005614 Ga0068856_100145685 Ga0068856_1001456853 172
183 3300005616 Ga0068852_100097658 Ga0068852_1000976583 172
184 3300005841 Ga0068863_100412618 Ga0068863_1004126182 172
185 3300005842 Ga0068858_101400072 Ga0068858_1014000722 172
186 3300006028 Ga0070717_10056185 Ga0070717_100561853 172
187 3300006028 Ga0070717_10088713 Ga0070717_100887134 172
188 3300006163 Ga0070715_10021489 Ga0070715_100214892 172
189 3300006173 Ga0070716_100019365 Ga0070716_1000193653 172
190 3300006175 Ga0070712_100206280 Ga0070712_1002062804 172
191 3300006175 Ga0070712_100543346 Ga0070712_1005433461 172
192 3300006237 Ga0097621_100857940 Ga0097621_1008579401 172
193 3300006871 Ga0075434_100157187 Ga0075434_1001571872 172
194 3300009011 Ga0105251_10123382 Ga0105251_101233822 172
195 3300009093 Ga0105240_10040071 Ga0105240_100400712 172
196 3300009094 Ga0111539_10259034 Ga0111539_102590343 172
197 3300009098 Ga0105245_10521741 Ga0105245_105217412 172
198 3300009101 Ga0105247_10048396 Ga0105247_100483965 172
199 3300009147 Ga0114129_10313509 Ga0114129_103135092 172
200 3300009545 Ga0105237_10011717 Ga0105237_100117178 172
201 3300009551 Ga0105238_11399165 Ga0105238_113991651 172
202 3300010375 Ga0105239_10658587 Ga0105239_106585872 172
203 3300013105 Ga0157369_10915916 Ga0157369_109159162 172
204 3300013296 Ga0157374_10053595 Ga0157374_100535955 172
205 3300013306 Ga0163162_11484963 Ga0163162_114849632 172
206 3300013307 Ga0157372_10018568 Ga0157372_100185681 172
207 3300014497 Ga0182008_10068894 Ga0182008_100688943 172
208 3300014969 Ga0157376_10036784 Ga0157376_100367841 172
209 3300020070 Ga0206356_10989153 Ga0206356_109891533 172
210 3300020082 Ga0206353_11954450 Ga0206353_119544503 172
211 3300025898 Ga0207692_10028126 Ga0207692_100281262 172
212 3300025898 Ga0207692_10068332 Ga0207692_100683323 172
213 3300025909 Ga0207705_10079078 Ga0207705_100790783 172
214 3300025912 Ga0207707_10085947 Ga0207707_100859475 172
215 3300025913 Ga0207695_10252136 Ga0207695_102521363 172
216 3300025914 Ga0207671_10027756 Ga0207671_100277563 172
217 3300025917 Ga0207660_10319830 Ga0207660_103198302 172
218 3300025919 Ga0207657_10000988 Ga0207657_100009887 172
219 3300025921 Ga0207652_10447624 Ga0207652_104476241 172
220 3300025922 Ga0207646_10001768 Ga0207646_100017682 172
221 3300025928 Ga0207700_10045424 Ga0207700_100454244 172
222 3300025929 Ga0207664_10007295 Ga0207664_100072956 172
223 3300025929 Ga0207664_10044965 Ga0207664_100449652 172
224 3300025934 Ga0207686_10306195 Ga0207686_103061952 172
225 3300025939 Ga0207665_10001074 Ga0207665_1000107410 172
226 3300025941 Ga0207711_10408641 Ga0207711_104086412 172
227 3300025944 Ga0207661_10074555 Ga0207661_100745553 172
228 3300025944 Ga0207661_10395142 Ga0207661_103951422 172
229 3300025949 Ga0207667_10541194 Ga0207667_105411942 172
230 3300026023 Ga0207677_10250380 Ga0207677_102503802 172
231 3300026023 Ga0207677_11026924 Ga0207677_110269241 172
232 3300026078 Ga0207702_10116059 Ga0207702_101160593 172
233 3300026088 Ga0207641_10659413 Ga0207641_106594132 172
234 3300026142 Ga0207698_10207099 Ga0207698_102070993 172
235 3300035083 Ga0373926_0024316 Ga0373926_0024316_1305_1856 172
236 3300035113 Ga0373936_0093672 Ga0373936_0093672_121_672 172
237 3300035170 Ga0373943_0004768 Ga0373943_0004768_5124_5675 172
238 3300035410 Ga0373924_0111082 Ga0373924_0111082_38_589 172
239 3300035725 Ga0373947_0000371 Ga0373947_0000371_16545_17096 172
240 3300037068 Ga0373925_0001462 Ga0373925_0001462_10490_11041 172
241 3300037312 Ga0395899_0045692 Ga0395899_0045692_1036_1581 172
242 3300037418 Ga0395900_0253268 Ga0395900_0253268_273_818 172
243 3300037466 Ga0395898_0109506 Ga0395898_0109506_841_1386 172
244 3300037471 Ga0395905_0308059 Ga0395905_0308059_25_570 172
245 3300038443 Ga0395901_0459363 Ga0395901_0459363_626_1171 172
246 3300044683 Ga0466965_0024499 Ga0466965_0024499_1459_2010 172
247 3300044683 Ga0466965_0539877 Ga0466965_0539877_74_628 172
248 3300044684 Ga0466966_0059424 Ga0466966_0059424_1329_1883 172
249 3300044693 Ga0466961_0008333 Ga0466961_0008333_2101_2655 172
250 3300044693 Ga0466961_0014252 Ga0466961_0014252_471_1025 172
251 3300044693 Ga0466961_0030814 Ga0466961_0030814_1888_2439 172
252 3300044694 Ga0466963_0000102 Ga0466963_0000102_16191_16742 172
253 3300044694 Ga0466963_0003617 Ga0466963_0003617_2926_3477 172
254 3300044694 Ga0466963_0012870 Ga0466963_0012870_4034_4579 172
255 3300044694 Ga0466963_0016078 Ga0466963_0016078_1568_2119 172
256 3300044694 Ga0466963_0035681 Ga0466963_0035681_1063_1614 172
257 3300044706 Ga0466964_0068165 Ga0466964_0068165_509_1060 172
258 3300044706 Ga0466964_0122918 Ga0466964_0122918_426_977 172
259 3300044719 Ga0466971_0015053 Ga0466971_0015053_1353_1907 172
260 3300044735 Ga0466968_0001167 Ga0466968_0001167_2669_3223 172
261 3300044735 Ga0466968_0091919 Ga0466968_0091919_690_1241 172
262 3300044765 Ga0466970_0009132 Ga0466970_0009132_12_566 172
263 3300044842 Ga0466957_0005782 Ga0466957_0005782_3012_3566 172
264 3300044842 Ga0466957_0008474 Ga0466957_0008474_3580_4131 172
265 3300044842 Ga0466957_0010928 Ga0466957_0010928_655_1206 172
266 3300044842 Ga0466957_0188909 Ga0466957_0188909_428_979 172
267 3300044842 Ga0466957_0325143 Ga0466957_0325143_472_1023 172
268 3300044842 Ga0466957_0512068 Ga0466957_0512068_225_776 172
269 3300044901 Ga0466960_0018742 Ga0466960_0018742_494_1039 172
270 3300045049 Ga0466959_0024990 Ga0466959_0024990_3549_4100 172
271 3300045049 Ga0466959_0082093 Ga0466959_0082093_917_1471 172
272 3300045836 Ga0466958_0005167 Ga0466958_0005167_436_987 172
273 3300045836 Ga0466958_0005361 Ga0466958_0005361_3041_3595 172
274 3300045836 Ga0466958_0019589 Ga0466958_0019589_1795_2346 172
275 3300045836 Ga0466958_0023292 Ga0466958_0023292_2116_2667 172
276 3300045976 Ga0466967_0000094 Ga0466967_0000094_8057_8608 172
277 3300045976 Ga0466967_0014799 Ga0466967_0014799_5026_5577 172
278 3300045976 Ga0466967_0023089 Ga0466967_0023089_4361_4912 172
279 3300045976 Ga0466967_0053118 Ga0466967_0053118_1086_1637 172
280 3300045976 Ga0466967_0275727 Ga0466967_0275727_215_766 172
281 3300045976 Ga0466967_0588715 Ga0466967_0588715_299_853 172
282 3300046454 Ga0495592_0140719 Ga0495592_0140719_327_878 172
283 3300046454 Ga0495592_0204476 Ga0495592_0204476_405_962 172
284 3300046454 Ga0495592_0336732 Ga0495592_0336732_62_607 172
285 3300046459 Ga0495629_0006824 Ga0495629_0006824_379_930 172
286 3300046461 Ga0495641_0005829 Ga0495641_0005829_7237_7788 172
287 3300046462 Ga0495651_0556150 Ga0495651_0556150_59_610 172
288 3300046463 Ga0495653_0005665 Ga0495653_0005665_3022_3573 172
289 3300046463 Ga0495653_0447260 Ga0495653_0447260_127_678 172
290 3300046472 Ga0495580_0004702 Ga0495580_0004702_1219_1770 172
291 3300046473 Ga0495582_0003512 Ga0495582_0003512_492_1043 172
292 3300046473 Ga0495582_0152107 Ga0495582_0152107_757_1302 172
293 3300046475 Ga0495639_0000481 Ga0495639_0000481_10518_11069 172
294 3300046476 Ga0495662_0000359 Ga0495662_0000359_14752_15303 172
295 3300046477 Ga0495664_0006065 Ga0495664_0006065_4478_5029 172
296 3300046477 Ga0495664_0164078 Ga0495664_0164078_121_678 172
297 3300046477 Ga0495664_0248175 Ga0495664_0248175_16_567 172
298 3300046491 Ga0495584_0019684 Ga0495584_0019684_713_1258 172
299 3300046492 Ga0495585_0178492 Ga0495585_0178492_407_952 172
300 3300046501 Ga0495607_0053355 Ga0495607_0053355_1251_1796 172
301 3300046511 Ga0495608_0048015 Ga0495608_0048015_1750_2301 172
302 3300046514 Ga0495618_0051562 Ga0495618_0051562_472_1023 172
303 3300046514 Ga0495618_0130561 Ga0495618_0130561_570_1121 172
304 3300046514 Ga0495618_0244664 Ga0495618_0244664_327_878 172
305 3300046516 Ga0495628_0177947 Ga0495628_0177947_436_993 172
306 3300046517 Ga0495630_0000995 Ga0495630_0000995_8903_9454 172
307 3300046517 Ga0495630_0104039 Ga0495630_0104039_13_570 172
308 3300046523 Ga0495644_0157446 Ga0495644_0157446_99_644 172
309 3300046526 Ga0495666_0000688 Ga0495666_0000688_1178_1729 172
310 3300046529 Ga0495652_0008136 Ga0495652_0008136_4492_5043 172
311 3300046531 Ga0495665_0004703 Ga0495665_0004703_1178_1729 172
312 3300046533 Ga0495640_0014224 Ga0495640_0014224_5229_5780 172
313 3300046533 Ga0495640_0123159 Ga0495640_0123159_30_581 172
314 3300046535 Ga0495586_0067682 Ga0495586_0067682_1146_1697 172
315 3300046536 Ga0495587_0086090 Ga0495587_0086090_1065_1622 172
316 3300046543 Ga0495645_0055416 Ga0495645_0055416_566_1123 172
317 3300046543 Ga0495645_0379763 Ga0495645_0379763_13_564 172
318 3300046559 Ga0495667_0009415 Ga0495667_0009415_5981_6532 172
319 3300046559 Ga0495667_0190482 Ga0495667_0190482_726_1277 172
320 3300046615 Ga0495656_0017577 Ga0495656_0017577_1651_2196 172
321 3300046642 Ga0495634_0024255 Ga0495634_0024255_3230_3781 172
322 3300046648 Ga0495611_0025819 Ga0495611_0025819_1049_1594 172
323 3300046663 Ga0495635_0009343 Ga0495635_0009343_2617_3168 172
324 3300046663 Ga0495635_0191008 Ga0495635_0191008_348_899 172
325 3300046665 Ga0495661_0179833 Ga0495661_0179833_207_752 172
326 3300046675 Ga0495657_0136625 Ga0495657_0136625_435_986 172
327 3300046678 Ga0495599_0180866 Ga0495599_0180866_369_920 172
328 3300046680 Ga0495646_0019601 Ga0495646_0019601_2814_3371 172
329 3300046681 Ga0495647_0000670 Ga0495647_0000670_1689_2240 172
330 3300046683 Ga0495658_0023169 Ga0495658_0023169_2492_3043 172
331 3300046689 Ga0495613_0028992 Ga0495613_0028992_515_1066 172
332 3300046689 Ga0495613_0183245 Ga0495613_0183245_179_736 172
333 3300046690 Ga0495624_0027518 Ga0495624_0027518_2921_3472 172
334 3300046690 Ga0495624_0067971 Ga0495624_0067971_346_903 172
335 3300046691 Ga0495670_0054914 Ga0495670_0054914_443_988 172
336 3300046809 Ga0495600_0053048 Ga0495600_0053048_56_607 172
337 3300046809 Ga0495600_0763222 Ga0495600_0763222_15_566 172
338 3300047315 Ga0495581_0017948 Ga0495581_0017948_3102_3653 172
339 3300047317 Ga0495604_0078218 Ga0495604_0078218_337_894 172
340 3300047318 Ga0495636_0052271 Ga0495636_0052271_934_1479 172
341 3300047319 Ga0495674_0354643 Ga0495674_0354643_430_987 172
342 3300047319 Ga0495674_0682323 Ga0495674_0682323_85_636 172
343 3300047321 Ga0495676_0019630 Ga0495676_0019630_4079_4630 172
344 3300047321 Ga0495676_0032491 Ga0495676_0032491_2360_2905 172
345 3300047321 Ga0495676_0722340 Ga0495676_0722340_32_577 172
346 3300047322 Ga0495680_0020304 Ga0495680_0020304_4394_4945 172
347 3300047322 Ga0495680_0034009 Ga0495680_0034009_901_1452 172
348 3300047445 Ga0495677_0049076 Ga0495677_0049076_574_1119 172
349 3300047471 Ga0495684_0012195 Ga0495684_0012195_4279_4830 172
350 3300047471 Ga0495684_0016556 Ga0495684_0016556_582_1133 172
351 3300047471 Ga0495684_0039015 Ga0495684_0039015_2314_2865 172
352 3300047673 Ga0495593_0001863 Ga0495593_0001863_470_1021 172
353 3300048089 Ga0495614_0001717 Ga0495614_0001717_2941_3492 172
354 3300048903 Ga0496100_0041479 Ga0496100_0041479_2102_2647 172
355 3300048903 Ga0496100_0206156 Ga0496100_0206156_711_1256 172
356 3300048904 Ga0496101_0011809 Ga0496101_0011809_2784_3329 172
357 3300048905 Ga0496102_0021075 Ga0496102_0021075_4787_5338 172
358 3300048905 Ga0496102_0082856 Ga0496102_0082856_1712_2257 172
359 3300048906 Ga0496103_0014385 Ga0496103_0014385_138_683 172
360 3300048906 Ga0496103_0018723 Ga0496103_0018723_1231_1782 172
361 3300048907 Ga0496104_0015903 Ga0496104_0015903_1023_1574 172
362 3300048907 Ga0496104_0230125 Ga0496104_0230125_259_804 172
363 3300048908 Ga0496105_0019886 Ga0496105_0019886_1211_1756 172
364 3300048908 Ga0496105_0029719 Ga0496105_0029719_59_610 172
365 3300048909 Ga0496106_0115368 Ga0496106_0115368_1306_1851 172
366 3300048909 Ga0496106_0259759 Ga0496106_0259759_200_754 172
367 3300048910 Ga0496107_0009770 Ga0496107_0009770_2509_3054 172
368 3300048910 Ga0496107_0031675 Ga0496107_0031675_32_586 172
369 3300048911 Ga0496108_0009079 Ga0496108_0009079_5305_5856 172
370 3300048911 Ga0496108_0034402 Ga0496108_0034402_1678_2223 172
371 3300048911 Ga0496108_0071809 Ga0496108_0071809_2269_2814 172
372 3300048911 Ga0496108_0397947 Ga0496108_0397947_527_1078 172
373 3300048912 Ga0496109_0010667 Ga0496109_0010667_3475_4020 172
374 3300048912 Ga0496109_0026642 Ga0496109_0026642_4464_5015 172
375 3300048912 Ga0496109_0329022 Ga0496109_0329022_488_1039 172
376 3300048913 Ga0496110_1021754 Ga0496110_1021754_99_644 172
377 3300048914 Ga0496111_0036366 Ga0496111_0036366_2481_3032 172
378 3300048914 Ga0496111_0046870 Ga0496111_0046870_767_1312 172
379 3300048915 Ga0496112_0098299 Ga0496112_0098299_83_628 172
380 3300048915 Ga0496112_0106028 Ga0496112_0106028_1368_1922 172
381 3300048915 Ga0496112_0793866 Ga0496112_0793866_211_762 172
382 3300048916 Ga0496113_0029330 Ga0496113_0029330_1775_2320 172
383 3300048916 Ga0496113_0131356 Ga0496113_0131356_1368_1922 172
384 3300048916 Ga0496113_0644251 Ga0496113_0644251_280_825 172
385 3300048917 Ga0496114_0052601 Ga0496114_0052601_801_1346 172
386 3300048917 Ga0496114_0066011 Ga0496114_0066011_2124_2675 172
387 3300048917 Ga0496114_0382330 Ga0496114_0382330_184_729 172
388 3300048918 Ga0496115_0020647 Ga0496115_0020647_147_692 172
389 3300048918 Ga0496115_0048713 Ga0496115_0048713_1996_2541 172
390 3300048918 Ga0496115_0061199 Ga0496115_0061199_844_1395 172
391 3300048918 Ga0496115_0209041 Ga0496115_0209041_649_1194 172
392 3300048918 Ga0496115_0447098 Ga0496115_0447098_94_645 172
393 3300050512 nmdc:mga0n895_25551_c1 nmdc:mga0n895_25551_c1_2186_2731 172
394 3300050515 nmdc:mga0a205_95152_c1 nmdc:mga0a205_95152_c1_917_1462 172
395 3300053077 Ga0495601_0005907 Ga0495601_0005907_950_1501 172
396 3300053077 Ga0495601_0158768 Ga0495601_0158768_479_1030 172
397 3300053077 Ga0495601_0492409 Ga0495601_0492409_209_769 172
398 3300053078 Ga0495612_0016785 Ga0495612_0016785_739_1290 172
399 3300053078 Ga0495612_0062708 Ga0495612_0062708_84_644 172
400 3300053083 Ga0495655_0004634 Ga0495655_0004634_1294_1845 172
401 3300053083 Ga0495655_0073844 Ga0495655_0073844_209_754 172
402 3300053084 Ga0495595_0198492 Ga0495595_0198492_158_709 172
403 3300053085 Ga0495619_0355939 Ga0495619_0355939_426_977 172
404 3300053085 Ga0495619_0410843 Ga0495619_0410843_174_731 172
405 3300061719 Ga0466962_0000096 Ga0466962_0000096_29544_30095 172
406 3300046476 Ga0495662_0000184 Ga0495662_0000184_17880_18440 173
407 3300049593 Ga0501077_0160142 Ga0501077_0160142_538_1089 173
408 3300005327 Ga0070658_10028586 Ga0070658_100285863 177
409 3300009093 Ga0105240_10153851 Ga0105240_101538514 177
410 3300025913 Ga0207695_10251802 Ga0207695_102518023 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11706

zf-CGNR

CGNR zinc finger

163

206

0.99

PF07336

ABATE

Putative stress-induced transcription regulator

37

159

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h0n-assembly1.cif.gz_A-2 crystal structure of a duf1470 family protein (jann_2411) from jannaschia sp. ccs1 at 1.45 a resolution 0.6104 1 172
3h0n-assembly1.cif.gz_A-2 crystal structure of a duf1470 family protein (jann_2411) from jannaschia sp. ccs1 at 1.45 a resolution 0.5944 1 172
4wqr-assembly2.cif.gz_59 complex of 70s ribosome with trna-phe and mrna with c-a mismatch in the first position in the a-site. 0.4303 91 137
7dgw-assembly1.cif.gz_A de novo designed protein h4a2s 0.4197 5 124
6awb-assembly1.cif.gz_R structure of 30s ribosomal subunit and rna polymerase complex in non-rotated state 0.3692 4 88
ID Description Score Start End Superfamily
3h0nA00 Mainly Alpha;Orthogonal Bundle;Jann2411-like fold;Jann2411-like domain 0.6207 9 172 1.10.3300.10
3h0nA00 Mainly Alpha;Orthogonal Bundle;Jann2411-like fold;Jann2411-like domain 0.5822 9 172 1.10.3300.10
af_P43337_8_187_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.4568 86 120 3.90.79.10
af_A0A0R4IKJ1_281_358_1.20.1270.10 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.4541 10 124 1.20.1270.10
af_P40527_568_743_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.44 89 134 3.40.1110.10
ID Description Score Start End GO Terms
AF-A0A855X4R7-F1-model_v4 Zinc finger CGNR domain-containing protein 0.8959 8 176
AF-A0A2S6GT42-F1-model_v4 Putative RNA-binding Zn ribbon-like protein 0.8908 4 176
AF-A0A535EJH2-F1-model_v4 Zinc finger CGNR domain-containing protein 0.8847 47 175
AF-A0A316ISY2-F1-model_v4 Putative RNA-binding Zn ribbon-like protein 0.8833 10 173
AF-A0A838SPJ3-F1-model_v4 CGNR zinc finger domain-containing protein 0.8826 4 175

Feature Viewer

pLDDT pTM Quality
85.88 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map