metagRoot

F437284

General Info

Members	Datasets	Scaffolds	Average Seq Length
410	246	410	272

Family's Representative Sequence

Representative Sequence	3300028800\|Ga0265338_10008381\|Ga0265338_100083812
Length	287
Sequence	VLAFAAMSLELPRPQSFVHHGRQVAFREYGSGGRPIVLTHGLLMDGTMYAKLGRALAARGHRVLAVDMPGHGSSAQPHDMHAYSMTQFGRDVVALLDHLELPSAVVGGTSLGANVALEVAVAWPERVRALVLEMPVLEHGLAGAAALFVPLALALRVGGERVMAAISSVARRVPRLHFTADLLLDFVRRDPGASLAVLDGVTFGRVAPPREERMRLQHPALIIGHPKDPIHPFSDAEMLAGELPNARLVLAQSILEWRLRPKRLDAELTTFLDVVWSTPPGAALRPA

Samples

	Sample ID	Description	Type	Environment
1	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
2	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
3	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
4	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
5	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
6	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
7	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
8	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
9	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
10	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
11	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
12	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
13	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
14	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
15	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
16	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
17	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
18	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
19	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
20	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
21	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
22	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
23	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
24	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
25	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
26	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
27	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
28	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
29	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
30	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
31	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
32	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
33	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
34	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
35	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
36	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
37	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
38	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
39	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
40	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
41	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
42	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
43	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
44	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
45	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
46	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
47	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
48	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
49	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
50	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
51	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
52	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
53	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
54	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
55	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
56	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
57	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
58	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
59	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
60	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
61	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
62	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
63	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
64	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
65	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
66	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
67	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
68	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
69	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
70	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
71	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
72	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
73	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
74	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
75	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
76	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
77	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
78	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
79	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
80	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
130	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
131	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
132	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
133	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
134	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
135	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
136	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
137	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
138	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
139	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
140	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
141	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
142	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
143	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
144	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
145	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
146	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
147	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
148	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
149	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
150	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
151	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
152	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
153	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
154	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
155	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
156	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
157	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
158	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
159	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
160	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
161	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
162	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
163	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
164	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
165	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
166	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
167	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
168	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
169	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
170	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
171	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
172	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
173	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
174	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
175	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
176	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
177	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
178	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
179	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
180	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
181	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
182	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
183	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
184	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
185	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
186	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
187	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
188	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
189	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
190	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
191	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
192	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
193	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
194	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
195	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
196	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
197	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
198	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
199	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
200	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
201	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
202	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
203	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
204	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
205	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
206	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
207	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
208	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
209	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
210	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
211	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
212	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
213	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
214	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
215	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
216	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
217	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
218	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
219	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
220	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
221	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
222	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
223	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
224	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
225	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
226	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
227	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
228	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
229	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
230	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
231	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
232	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
233	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
234	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
235	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
236	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
237	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
238	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
239	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
240	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
241	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
242	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
243	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
244	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
245	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
246	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.76
Metatranscriptomes	0.24
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.22
Nodule	0
Rhizoplane	12.44
Rhizosphere	83.66
Stem	0
Stem Tuber	0
Unclassified	2.68

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1000190	3300001977	Bacteria	8210
2	rootL2_10331817	3300003322	Bacteria	1144
3	Ga0070683_100000787	3300005329	Bacteria	23394
4	Ga0070683_100002127	3300005329	Bacteria	15643
5	Ga0070683_100003772	3300005329	Bacteria	12376
6	Ga0070683_100004223	3300005329	Bacteria	11779
7	Ga0070690_100023176	3300005330	Unclassified	3806
8	Ga0070690_100080231	3300005330	Bacteria	2134
9	Ga0070670_100083943	3300005331	Bacteria	2737
10	Ga0070677_10000002	3300005333	Bacteria	87295
11	Ga0068869_100453606	3300005334	Bacteria	1063
12	Ga0070666_10045440	3300005335	Bacteria	2944
13	Ga0070680_100067468	3300005336	Bacteria	2934
14	Ga0070682_100000023	3300005337	Bacteria	206016
15	Ga0070682_100000026	3300005337	Bacteria	191388
16	Ga0068868_100000229	3300005338	Bacteria	38071
17	Ga0070689_100138241	3300005340	Bacteria	1957
18	Ga0070689_100155597	3300005340	Unclassified	1845
19	Ga0070691_10000027	3300005341	Bacteria	40642
20	Ga0070687_100088169	3300005343	Unclassified	1710
21	Ga0070661_100000004	3300005344	Bacteria	243876
22	Ga0070692_10116277	3300005345	Bacteria	1486
23	Ga0070668_100201153	3300005347	Bacteria	1635
24	Ga0070675_100000070	3300005354	Bacteria	59599
25	Ga0070674_100000004	3300005356	Bacteria	169446
26	Ga0070674_100000241	3300005356	Bacteria	27097
27	Ga0070673_100008185	3300005364	Bacteria	6940
28	Ga0070688_100001820	3300005365	Bacteria	10698
29	Ga0070659_100022172	3300005366	Bacteria	4845
30	Ga0070659_100036564	3300005366	Bacteria	3828
31	Ga0070667_100178167	3300005367	Bacteria	1879
32	Ga0070714_100183764	3300005435	Bacteria	1904
33	Ga0070713_100000005	3300005436	Bacteria	201526
34	Ga0070711_100004169	3300005439	Bacteria	8498
35	Ga0070700_100065868	3300005441	Bacteria	2298
36	Ga0070662_100000006	3300005457	Bacteria	169366
37	Ga0070681_10026414	3300005458	Bacteria	5835
38	Ga0068867_100000556	3300005459	Bacteria	24623
39	Ga0070685_10000027	3300005466	Bacteria	91882
40	Ga0070685_10000195	3300005466	Bacteria	40644
41	Ga0070679_100001506	3300005530	Bacteria	20713
42	Ga0070679_100185178	3300005530	Bacteria	2053
43	Ga0070684_100002649	3300005535	Bacteria	13208
44	Ga0070684_100024445	3300005535	Bacteria	5069
45	Ga0070684_100031452	3300005535	Bacteria	4518
46	Ga0070684_100281966	3300005535	Bacteria	1522
47	Ga0068853_100000104	3300005539	Bacteria	56511
48	Ga0070672_100000032	3300005543	Bacteria	62011
49	Ga0070686_100058500	3300005544	Bacteria	2480
50	Ga0070693_100002839	3300005547	Bacteria	7980
51	Ga0070665_100000308	3300005548	Bacteria	76310
52	Ga0070665_100000411	3300005548	Bacteria	62752
53	Ga0068854_100000196	3300005578	Bacteria	40793
54	Ga0068856_100001373	3300005614	Bacteria	25601
55	Ga0068856_100023471	3300005614	Bacteria	5997
56	Ga0068856_100024290	3300005614	Bacteria	5897
57	Ga0070702_100353311	3300005615	Unclassified	1036
58	Ga0070702_100387909	3300005615	Bacteria	995
59	Ga0068852_100099373	3300005616	Bacteria	2623
60	Ga0068864_100000262	3300005618	Bacteria	47006
61	Ga0068864_100401158	3300005618	Bacteria	1303
62	Ga0068866_10000004	3300005718	Bacteria	202810
63	Ga0068866_10000575	3300005718	Bacteria	16721
64	Ga0068866_10028904	3300005718	Bacteria	2645
65	Ga0068851_10000533	3300005834	Bacteria	16624
66	Ga0068863_100000986	3300005841	Bacteria	28601
67	Ga0068858_100000066	3300005842	Bacteria	108011
68	Ga0068860_100014961	3300005843	Bacteria	7583
69	Ga0081455_10053661	3300005937	Unclassified	3442
70	Ga0070715_10000014	3300006163	Bacteria	154272
71	Ga0070712_100002154	3300006175	Bacteria	12116
72	Ga0070712_100175975	3300006175	Bacteria	1664
73	Ga0097621_100593972	3300006237	Bacteria	1011
74	Ga0068871_100371038	3300006358	Bacteria	1269
75	Ga0075431_100139273	3300006847	Bacteria	2501
76	Ga0075429_100008963	3300006880	Bacteria	8691
77	Ga0068865_100000064	3300006881	Bacteria	55421
78	Ga0068865_100013987	3300006881	Bacteria	5092
79	Ga0105240_10686185	3300009093	Bacteria	1119
80	Ga0105245_10000023	3300009098	Bacteria	180844
81	Ga0105245_10000133	3300009098	Bacteria	71019
82	Ga0105245_10000335	3300009098	Bacteria	44336
83	Ga0105245_10000438	3300009098	Bacteria	38412
84	Ga0105245_10000606	3300009098	Bacteria	32464
85	Ga0105245_10032869	3300009098	Bacteria	4595
86	Ga0105247_10004845	3300009101	Bacteria	8558
87	Ga0105247_10131537	3300009101	Bacteria	1631
88	Ga0105243_10573459	3300009148	Bacteria	1082
89	Ga0105241_10341533	3300009174	Bacteria	1297
90	Ga0105242_10000051	3300009176	Bacteria	79661
91	Ga0105242_10000637	3300009176	Bacteria	27514
92	Ga0105242_10224275	3300009176	Bacteria	1681
93	Ga0105248_10000037	3300009177	Bacteria	180751
94	Ga0105238_10000033	3300009551	Bacteria	172981
95	Ga0105249_10000150	3300009553	Bacteria	88154
96	Ga0105249_10767226	3300009553	Bacteria	1027
97	Ga0105239_10586075	3300010375	Bacteria	1271
98	Ga0157371_10027259	3300013102	Bacteria	4146
99	Ga0157370_10375791	3300013104	Bacteria	1309
100	Ga0157369_10000051	3300013105	Bacteria	165672
101	Ga0157374_10002743	3300013296	Bacteria	14793
102	Ga0157374_10208471	3300013296	Bacteria	1916
103	Ga0157378_10025974	3300013297	Bacteria	5161
104	Ga0157378_10115608	3300013297	Bacteria	2466
105	Ga0157378_10283855	3300013297	Bacteria	1597
106	Ga0163162_10690707	3300013306	Bacteria	1143
107	Ga0157372_10033557	3300013307	Bacteria	5639
108	Ga0157375_10001210	3300013308	Bacteria	22261
109	Ga0157375_10390236	3300013308	Bacteria	1559
110	Ga0157375_10427452	3300013308	Bacteria	1490
111	Ga0157380_10000007	3300014326	Bacteria	157634
112	Ga0157380_10003179	3300014326	Bacteria	11209
113	Ga0157379_10030161	3300014968	Bacteria	4824
114	Ga0157379_10038815	3300014968	Bacteria	4248
115	Ga0157376_10127811	3300014969	Bacteria	2263
116	Ga0157376_10285820	3300014969	Bacteria	1555
117	Ga0157376_10923109	3300014969	Bacteria	892
118	Ga0163161_10000027	3300017792	Bacteria	197774
119	Ga0163161_10065677	3300017792	Bacteria	2648
120	Ga0224712_10054997	3300022467	Bacteria	1564
121	Ga0207656_10000173	3300025321	Bacteria	23402
122	Ga0207682_10000151	3300025893	Bacteria	31445
123	Ga0207642_10000005	3300025899	Bacteria	401934
124	Ga0207642_10000227	3300025899	Bacteria	16602
125	Ga0207642_10025510	3300025899	Bacteria	2393
126	Ga0207710_10000325	3300025900	Bacteria	36508
127	Ga0207710_10065472	3300025900	Bacteria	1657
128	Ga0207680_10024618	3300025903	Bacteria	3307
129	Ga0207685_10000046	3300025905	Bacteria	46018
130	Ga0207705_10060853	3300025909	Bacteria	2728
131	Ga0207654_10279093	3300025911	Bacteria	1129
132	Ga0207707_10008687	3300025912	Bacteria	8815
133	Ga0207695_10235604	3300025913	Bacteria	1733
134	Ga0207693_10002209	3300025915	Bacteria	16974
135	Ga0207663_10001187	3300025916	Bacteria	12021
136	Ga0207663_10043034	3300025916	Bacteria	2763
137	Ga0207660_10049146	3300025917	Bacteria	2988
138	Ga0207649_10000003	3300025920	Bacteria	388908
139	Ga0207652_10000408	3300025921	Bacteria	44642
140	Ga0207652_10040336	3300025921	Bacteria	3965
141	Ga0207694_10000012	3300025924	Bacteria	411218
142	Ga0207659_10000018	3300025926	Bacteria	156920
143	Ga0207687_10000015	3300025927	Bacteria	261701
144	Ga0207687_10000075	3300025927	Bacteria	71856
145	Ga0207687_10000078	3300025927	Bacteria	71055
146	Ga0207687_10000126	3300025927	Bacteria	51183
147	Ga0207687_10000142	3300025927	Bacteria	47994
148	Ga0207687_10096917	3300025927	Bacteria	2162
149	Ga0207700_10000003	3300025928	Bacteria	500797
150	Ga0207664_10057895	3300025929	Bacteria	3082
151	Ga0207690_10005572	3300025932	Bacteria	7438
152	Ga0207690_10023723	3300025932	Bacteria	3833
153	Ga0207706_10000017	3300025933	Bacteria	169589
154	Ga0207686_10000083	3300025934	Bacteria	79869
155	Ga0207686_10148265	3300025934	Bacteria	1630
156	Ga0207709_10187408	3300025935	Bacteria	1466
157	Ga0207670_10151180	3300025936	Unclassified	1723
158	Ga0207669_10000014	3300025937	Bacteria	129145
159	Ga0207669_10000021	3300025937	Bacteria	100327
160	Ga0207704_10000084	3300025938	Bacteria	55496
161	Ga0207665_10033373	3300025939	Bacteria	3411
162	Ga0207691_10000002	3300025940	Bacteria	189785
163	Ga0207711_10000011	3300025941	Bacteria	518817
164	Ga0207689_10331327	3300025942	Bacteria	1264
165	Ga0207661_10000239	3300025944	Bacteria	36056
166	Ga0207661_10000516	3300025944	Bacteria	24975
167	Ga0207661_10002969	3300025944	Bacteria	11730
168	Ga0207661_10064930	3300025944	Bacteria	2961
169	Ga0207651_10001129	3300025960	Bacteria	11900
170	Ga0207712_10000027	3300025961	Bacteria	263739
171	Ga0207668_10303067	3300025972	Bacteria	1319
172	Ga0207640_10000153	3300025981	Bacteria	50142
173	Ga0207658_10264082	3300025986	Bacteria	1468
174	Ga0207677_10000279	3300026023	Bacteria	38227
175	Ga0207703_10000054	3300026035	Bacteria	143734
176	Ga0207703_10648070	3300026035	Bacteria	1002
177	Ga0207639_10000471	3300026041	Bacteria	27796
178	Ga0207708_10085416	3300026075	Bacteria	2427
179	Ga0207702_10000337	3300026078	Bacteria	53931
180	Ga0207702_10000705	3300026078	Bacteria	35948
181	Ga0207702_10066746	3300026078	Bacteria	3085
182	Ga0207641_10000267	3300026088	Bacteria	66212
183	Ga0207641_10009987	3300026088	Bacteria	7812
184	Ga0207648_10001621	3300026089	Bacteria	24664
185	Ga0207648_10095989	3300026089	Bacteria	2594
186	Ga0207676_10000038	3300026095	Bacteria	171492
187	Ga0207676_10368122	3300026095	Bacteria	1334
188	Ga0207675_100400768	3300026118	Bacteria	1352
189	Ga0207698_10001646	3300026142	Bacteria	13027
190	Ga0207698_10304157	3300026142	Bacteria	1486
191	Ga0268266_10000099	3300028379	Bacteria	182294
192	Ga0268266_10001851	3300028379	Bacteria	23887
193	Ga0268264_10001213	3300028381	Bacteria	24789
194	Ga0265337_1000537	3300028556	Bacteria	20203
195	Ga0265326_10000025	3300028558	Bacteria	112357
196	Ga0265319_1000014	3300028563	Bacteria	177623
197	Ga0265322_10000004	3300028654	Bacteria	275155
198	Ga0265338_10000244	3300028800	Bacteria	100528
199	Ga0265338_10007752	3300028800	Bacteria	13211
200	Ga0265338_10008381	3300028800	Bacteria	12558
201	Ga0265324_10000315	3300029957	Bacteria	35483
202	Ga0265320_10000051	3300031240	Bacteria	114823
203	Ga0265339_10012663	3300031249	Bacteria	5137
204	Ga0265331_10001378	3300031250	Bacteria	17883
205	Ga0265327_10000226	3300031251	Bacteria	114821
206	Ga0307509_10062951	3300031507	Bacteria	3909
207	Ga0307509_10073159	3300031507	Unclassified	3569
208	Ga0307509_10077466	3300031507	Bacteria	3448
209	Ga0307509_10088895	3300031507	Bacteria	3170
210	Ga0307508_10017235	3300031616	Bacteria	6566
211	Ga0265314_10000146	3300031711	Bacteria	105474
212	Ga0265314_10098860	3300031711	Bacteria	1881
213	Ga0307416_100217405	3300032002	Bacteria	1829
214	Ga0307415_100316067	3300032126	Bacteria	1300
215	Ga0373949_0000002	3300035090	Bacteria	102187
216	Ga0373936_0000031	3300035113	Bacteria	114679
217	Ga0373941_0030090	3300035115	Unclassified	1607
218	Ga0373953_0131117	3300035117	Unclassified	1069
219	Ga0373956_0027324	3300035119	Unclassified	2477
220	Ga0373956_0086430	3300035119	Bacteria	1443
221	Ga0373961_0000069	3300035241	Bacteria	55652
222	Ga0373937_0057053	3300036401	Bacteria	3586
223	Ga0395899_0006542	3300037312	Bacteria	9030
224	Ga0395900_0119539	3300037418	Bacteria	2704
225	Ga0395898_0144052	3300037466	Bacteria	2281
226	Ga0395905_0072410	3300037471	Bacteria	3231
227	Ga0395905_0075564	3300037471	Bacteria	3158
228	Ga0451800_0801900	3300041459	Bacteria	1361
229	Ga0451853_0680681	3300041512	Bacteria	6754
230	Ga0451853_1980390	3300041512	Bacteria	2220
231	Ga0451853_2572827	3300041512	Bacteria	1989
232	Ga0466963_0000011	3300044694	Bacteria	65918
233	Ga0466963_0122268	3300044694	Bacteria	1792
234	Ga0466957_0003224	3300044842	Bacteria	8928
235	Ga0466957_0069600	3300044842	Bacteria	2174
236	Ga0466967_0000002	3300045976	Bacteria	219994
237	Ga0466967_0159643	3300045976	Bacteria	2115
238	Ga0495592_0000024	3300046454	Bacteria	136661
239	Ga0495592_0212094	3300046454	Unclassified	1300
240	Ga0495603_0000672	3300046455	Bacteria	19385
241	Ga0495603_0003448	3300046455	Bacteria	9404
242	Ga0495629_0000025	3300046459	Bacteria	135624
243	Ga0495629_0000509	3300046459	Bacteria	32652
244	Ga0495629_0410453	3300046459	Bacteria	920
245	Ga0495641_0000355	3300046461	Bacteria	37753
246	Ga0495651_0019243	3300046462	Bacteria	5292
247	Ga0495653_0016256	3300046463	Bacteria	6063
248	Ga0495582_0000003	3300046473	Bacteria	168880
249	Ga0495639_0014142	3300046475	Bacteria	3454
250	Ga0495662_0000002	3300046476	Bacteria	108237
251	Ga0495662_0002121	3300046476	Bacteria	9950
252	Ga0495606_0000017	3300046507	Bacteria	284549
253	Ga0495608_0000035	3300046511	Bacteria	133011
254	Ga0495608_0000122	3300046511	Bacteria	55708
255	Ga0495608_0040691	3300046511	Bacteria	3113
256	Ga0495610_0132720	3300046512	Bacteria	1079
257	Ga0495618_0000026	3300046514	Bacteria	113266
258	Ga0495620_0000041	3300046515	Bacteria	112605
259	Ga0495628_0000456	3300046516	Bacteria	37404
260	Ga0495628_0002836	3300046516	Bacteria	15528
261	Ga0495628_0024543	3300046516	Bacteria	4934
262	Ga0495628_0272680	3300046516	Bacteria	1258
263	Ga0495630_0000034	3300046517	Bacteria	126055
264	Ga0495630_0181902	3300046517	Bacteria	1603
265	Ga0495644_0005089	3300046523	Bacteria	5145
266	Ga0495652_0004742	3300046529	Bacteria	12943
267	Ga0495640_0038949	3300046533	Bacteria	3340
268	Ga0495586_0000294	3300046535	Bacteria	31690
269	Ga0495587_0032624	3300046536	Bacteria	3147
270	Ga0495598_0003685	3300046537	Bacteria	3274
271	Ga0495621_0016505	3300046539	Bacteria	2371
272	Ga0495645_0010389	3300046543	Bacteria	6524
273	Ga0495645_0158084	3300046543	Bacteria	1569
274	Ga0495622_0030190	3300046557	Bacteria	2533
275	Ga0495633_0030034	3300046558	Bacteria	2642
276	Ga0495667_0000038	3300046559	Bacteria	131349
277	Ga0495667_0108795	3300046559	Bacteria	1791
278	Ga0495634_0017927	3300046642	Bacteria	5046
279	Ga0495635_0000005	3300046663	Bacteria	302178
280	Ga0495635_0053113	3300046663	Bacteria	2792
281	Ga0495588_0000073	3300046674	Bacteria	219005
282	Ga0495657_0000026	3300046675	Bacteria	133011
283	Ga0495657_0045388	3300046675	Bacteria	2982
284	Ga0495647_0000004	3300046681	Bacteria	140700
285	Ga0495647_0002665	3300046681	Bacteria	5666
286	Ga0495647_0010837	3300046681	Bacteria	3113
287	Ga0495658_0000001	3300046683	Bacteria	385362
288	Ga0495658_0004359	3300046683	Bacteria	6969
289	Ga0495669_0000264	3300046684	Bacteria	30207
290	Ga0495613_0000021	3300046689	Bacteria	159188
291	Ga0495613_0000027	3300046689	Bacteria	146674
292	Ga0495624_0000007	3300046690	Bacteria	146202
293	Ga0495624_0000127	3300046690	Bacteria	53463
294	Ga0495624_0042779	3300046690	Unclassified	2894
295	Ga0495670_0010543	3300046691	Bacteria	4543
296	Ga0495649_0000320	3300046694	Bacteria	41735
297	Ga0495600_0013656	3300046809	Bacteria	5110
298	Ga0495600_0031659	3300046809	Unclassified	3428
299	Ga0495604_0000038	3300047317	Bacteria	123703
300	Ga0495604_0000058	3300047317	Bacteria	96955
301	Ga0495604_0009520	3300047317	Bacteria	7681
302	Ga0495604_0140992	3300047317	Bacteria	1722
303	Ga0495674_0126863	3300047319	Bacteria	2152
304	Ga0495676_0000204	3300047321	Bacteria	46818
305	Ga0495676_0033284	3300047321	Bacteria	4343
306	Ga0495680_0000007	3300047322	Bacteria	152053
307	Ga0495680_0002070	3300047322	Bacteria	20903
308	Ga0495680_0002370	3300047322	Bacteria	19306
309	Ga0495680_0243889	3300047322	Bacteria	1275
310	Ga0495675_0000015	3300047444	Bacteria	133004
311	Ga0495685_021646	3300047447	Bacteria	2213
312	Ga0495593_0072887	3300047673	Bacteria	1782
313	Ga0495593_0112071	3300047673	Bacteria	1392
314	Ga0495602_0000393	3300048088	Bacteria	40803
315	Ga0495602_0017733	3300048088	Bacteria	7130
316	Ga0495602_0019469	3300048088	Bacteria	6737
317	Ga0496100_0000005	3300048903	Bacteria	312112
318	Ga0496100_0000022	3300048903	Bacteria	122113
319	Ga0496101_0000067	3300048904	Bacteria	122113
320	Ga0496101_0000101	3300048904	Bacteria	89424
321	Ga0496102_0000115	3300048905	Bacteria	114224
322	Ga0496103_0000008	3300048906	Bacteria	340474
323	Ga0496104_0000004	3300048907	Bacteria	641830
324	Ga0496104_0000008	3300048907	Bacteria	516976
325	Ga0496104_0009579	3300048907	Bacteria	8622
326	Ga0496104_0183760	3300048907	Bacteria	2001
327	Ga0496105_0000001	3300048908	Bacteria	1328178
328	Ga0496105_0000003	3300048908	Bacteria	713251
329	Ga0496105_0002921	3300048908	Bacteria	12545
330	Ga0496106_0000082	3300048909	Bacteria	76282
331	Ga0496106_0000200	3300048909	Bacteria	42008
332	Ga0496106_0001085	3300048909	Bacteria	20088
333	Ga0496107_0000011	3300048910	Bacteria	201631
334	Ga0496107_0000024	3300048910	Bacteria	122113
335	Ga0496107_0034406	3300048910	Unclassified	3629
336	Ga0496108_0000005	3300048911	Bacteria	535059
337	Ga0496108_0000039	3300048911	Bacteria	149440
338	Ga0496108_0013306	3300048911	Bacteria	6708
339	Ga0496109_0000002	3300048912	Bacteria	443393
340	Ga0496109_0000038	3300048912	Bacteria	150745
341	Ga0496109_0000066	3300048912	Bacteria	112004
342	Ga0496109_0040257	3300048912	Bacteria	4233
343	Ga0496109_0139899	3300048912	Bacteria	2263
344	Ga0496109_0338006	3300048912	Bacteria	1422
345	Ga0496110_0000241	3300048913	Bacteria	35518
346	Ga0496110_0014949	3300048913	Bacteria	6453
347	Ga0496110_0026824	3300048913	Bacteria	4933
348	Ga0496110_0349399	3300048913	Bacteria	1347
349	Ga0496111_0000011	3300048914	Bacteria	88409
350	Ga0496111_0010265	3300048914	Bacteria	6274
351	Ga0496111_0101813	3300048914	Bacteria	2111
352	Ga0496111_0125035	3300048914	Bacteria	1901
353	Ga0496111_0259902	3300048914	Bacteria	1288
354	Ga0496112_0000003	3300048915	Bacteria	660147
355	Ga0496112_0000266	3300048915	Bacteria	33551
356	Ga0496112_0141381	3300048915	Bacteria	2376
357	Ga0496113_0000001	3300048916	Bacteria	224977
358	Ga0496113_0004458	3300048916	Bacteria	8615
359	Ga0496113_0028027	3300048916	Bacteria	4046
360	Ga0496113_0039707	3300048916	Bacteria	3466
361	Ga0496114_0000101	3300048917	Bacteria	61589
362	Ga0496114_0001768	3300048917	Bacteria	16412
363	Ga0496114_0190517	3300048917	Bacteria	1794
364	Ga0496114_0364560	3300048917	Unclassified	1278
365	Ga0496115_0000016	3300048918	Bacteria	187067
366	Ga0496115_0013461	3300048918	Bacteria	6188
367	Ga0496119_0028023	3300048922	Bacteria	3856
368	Ga0496120_0080342	3300048923	Bacteria	1768
369	Ga0501042_0114664	3300049578	Bacteria	1940
370	Ga0501042_0227524	3300049578	Bacteria	1345
371	Ga0501042_0233208	3300049578	Bacteria	1328
372	Ga0501047_0013753	3300049581	Bacteria	7685
373	Ga0501070_0049382	3300049586	Unclassified	3494
374	Ga0501070_0123439	3300049586	Unclassified	2140
375	Ga0501071_0349358	3300049587	Bacteria	1125
376	Ga0501073_0200609	3300049589	Unclassified	1380
377	Ga0501075_0013441	3300049591	Bacteria	5841
378	Ga0501076_0052282	3300049592	Bacteria	3236
379	Ga0501080_0441557	3300049742	Unclassified	1167
380	Ga0501081_0297692	3300049743	Bacteria	1183
381	Ga0501035_0185686	3300049822	Unclassified	1790
382	Ga0501044_0092481	3300049823	Bacteria	3050
383	nmdc:mga09592_8996_c1	3300050508	Bacteria	8119
384	nmdc:mga06r32_157041_c1	3300050510	Bacteria	2256
385	Ga0495601_0000017	3300053077	Bacteria	204209
386	Ga0495601_0000022	3300053077	Bacteria	148418
387	Ga0495601_0010864	3300053077	Bacteria	5433
388	Ga0495601_0019658	3300053077	Bacteria	4121
389	Ga0495612_0000236	3300053078	Bacteria	23250
390	Ga0495612_0000309	3300053078	Bacteria	19829
391	Ga0495612_0013522	3300053078	Bacteria	3287
392	Ga0495612_0082739	3300053078	Bacteria	1350
393	Ga0495655_0000001	3300053083	Bacteria	419518
394	Ga0495595_0000017	3300053084	Bacteria	133011
395	Ga0495595_0000072	3300053084	Bacteria	49973
396	Ga0495619_0000054	3300053085	Bacteria	97928
397	Ga0495619_0000101	3300053085	Bacteria	64377
398	Ga0495619_0000192	3300053085	Bacteria	45153
399	Ga0495619_0001760	3300053085	Bacteria	14403
400	Ga0495619_0012634	3300053085	Bacteria	5315
401	Ga0495619_0022200	3300053085	Bacteria	4059
402	Ga0495619_0100814	3300053085	Bacteria	1965
403	Ga0495619_0132453	3300053085	Unclassified	1714
404	Ga0495619_0135449	3300053085	Bacteria	1694
405	Ga0495619_0420616	3300053085	Bacteria	922
406	Ga0500566_0000915	3300053094	Bacteria	16865
407	Ga0500566_0176851	3300053094	Unclassified	1098
408	Ga0500614_000070	3300053123	Bacteria	22144
409	Ga0500628_000020	3300053129	Bacteria	81755
410	Ga0500603_011802	3300053150	Bacteria	1996

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005535	Ga0070684_100281966	Ga0070684_1002819661	240
2	3300049822	Ga0501035_0185686	Ga0501035_0185686_326_1063	240
3	3300005548	Ga0070665_100000308	Ga0070665_10000030869	260
4	3300005842	Ga0068858_100000066	Ga0068858_10000006617	260
5	3300026035	Ga0207703_10000054	Ga0207703_1000005416	260
6	3300028379	Ga0268266_10000099	Ga0268266_1000009917	260
7	3300009553	Ga0105249_10767226	Ga0105249_107672261	261
8	3300013306	Ga0163162_10690707	Ga0163162_106907071	261
9	3300013308	Ga0157375_10390236	Ga0157375_103902362	261
10	3300017792	Ga0163161_10065677	Ga0163161_100656772	261
11	3300041459	Ga0451800_0801900	Ga0451800_0801900_82_876	261
12	3300041512	Ga0451853_1980390	Ga0451853_1980390_378_1172	261
13	3300046455	Ga0495603_0003448	Ga0495603_0003448_3720_4505	261
14	3300046515	Ga0495620_0000041	Ga0495620_0000041_97660_98466	261
15	3300047447	Ga0495685_021646	Ga0495685_021646_1376_2161	261
16	3300048903	Ga0496100_0000022	Ga0496100_0000022_12537_13322	261
17	3300048904	Ga0496101_0000067	Ga0496101_0000067_12537_13322	261
18	3300048909	Ga0496106_0000082	Ga0496106_0000082_12537_13322	261
19	3300048910	Ga0496107_0000024	Ga0496107_0000024_108792_109577	261
20	3300049578	Ga0501042_0114664	Ga0501042_0114664_313_1107	261
21	3300005329	Ga0070683_100002127	Ga0070683_10000212714	262
22	3300005333	Ga0070677_10000002	Ga0070677_1000000280	262
23	3300005535	Ga0070684_100002649	Ga0070684_1000026499	262
24	3300005718	Ga0068866_10028904	Ga0068866_100289042	262
25	3300009093	Ga0105240_10686185	Ga0105240_106861851	262
26	3300009098	Ga0105245_10000438	Ga0105245_1000043811	262
27	3300009098	Ga0105245_10000606	Ga0105245_1000060617	262
28	3300009176	Ga0105242_10000051	Ga0105242_1000005189	262
29	3300014968	Ga0157379_10030161	Ga0157379_100301614	262
30	3300025893	Ga0207682_10000151	Ga0207682_1000015117	262
31	3300025899	Ga0207642_10025510	Ga0207642_100255102	262
32	3300025913	Ga0207695_10235604	Ga0207695_102356042	262
33	3300025927	Ga0207687_10000075	Ga0207687_1000007511	262
34	3300025927	Ga0207687_10000142	Ga0207687_1000014229	262
35	3300025934	Ga0207686_10000083	Ga0207686_100000832	262
36	3300025944	Ga0207661_10002969	Ga0207661_100029699	262
37	3300026088	Ga0207641_10009987	Ga0207641_100099872	262
38	3300028556	Ga0265337_1000537	Ga0265337_10005377	262
39	3300028558	Ga0265326_10000025	Ga0265326_1000002517	262
40	3300028654	Ga0265322_10000004	Ga0265322_10000004217	262
41	3300029957	Ga0265324_10000315	Ga0265324_1000031511	262
42	3300031240	Ga0265320_10000051	Ga0265320_1000005155	262
43	3300031249	Ga0265339_10012663	Ga0265339_100126635	262
44	3300031250	Ga0265331_10001378	Ga0265331_100013785	262
45	3300031251	Ga0265327_10000226	Ga0265327_1000022655	262
46	3300031711	Ga0265314_10000146	Ga0265314_1000014648	262
47	3300046454	Ga0495592_0212094	Ga0495592_0212094_13_801	262
48	3300046459	Ga0495629_0000509	Ga0495629_0000509_18912_19709	262
49	3300046461	Ga0495641_0000355	Ga0495641_0000355_5294_6082	262
50	3300046511	Ga0495608_0040691	Ga0495608_0040691_2169_2957	262
51	3300046516	Ga0495628_0024543	Ga0495628_0024543_259_1047	262
52	3300046517	Ga0495630_0181902	Ga0495630_0181902_617_1405	262
53	3300046543	Ga0495645_0158084	Ga0495645_0158084_536_1324	262
54	3300046559	Ga0495667_0000038	Ga0495667_0000038_123511_124374	262
55	3300046694	Ga0495649_0000320	Ga0495649_0000320_27467_28255	262
56	3300047321	Ga0495676_0033284	Ga0495676_0033284_1024_1818	262
57	3300047322	Ga0495680_0002070	Ga0495680_0002070_924_1712	262
58	3300047322	Ga0495680_0002370	Ga0495680_0002370_6976_7839	262
59	3300048903	Ga0496100_0000005	Ga0496100_0000005_242927_243745	262
60	3300048904	Ga0496101_0000101	Ga0496101_0000101_87309_88127	262
61	3300048905	Ga0496102_0000115	Ga0496102_0000115_83065_83859	262
62	3300048906	Ga0496103_0000008	Ga0496103_0000008_90090_90884	262
63	3300048907	Ga0496104_0000008	Ga0496104_0000008_21590_22378	262
64	3300048908	Ga0496105_0000003	Ga0496105_0000003_21590_22378	262
65	3300048909	Ga0496106_0001085	Ga0496106_0001085_1237_2055	262
66	3300048910	Ga0496107_0000011	Ga0496107_0000011_68138_68956	262
67	3300048911	Ga0496108_0000039	Ga0496108_0000039_21996_22784	262
68	3300048912	Ga0496109_0000038	Ga0496109_0000038_126886_127674	262
69	3300048913	Ga0496110_0014949	Ga0496110_0014949_2832_3620	262
70	3300048914	Ga0496111_0259902	Ga0496111_0259902_72_860	262
71	3300049587	Ga0501071_0349358	Ga0501071_0349358_123_911	262
72	3300053077	Ga0495601_0000022	Ga0495601_0000022_13879_14667	262
73	3300053078	Ga0495612_0000309	Ga0495612_0000309_13380_14168	262
74	3300053083	Ga0495655_0000001	Ga0495655_0000001_314563_315357	262
75	3300053094	Ga0500566_0000915	Ga0500566_0000915_4922_5716	262
76	3300053123	Ga0500614_000070	Ga0500614_000070_2295_3083	262
77	3300053129	Ga0500628_000020	Ga0500628_000020_73949_74743	262
78	3300001977	JGI24746J21847_1000190	JGI24746J21847_10001904	263
79	3300003322	rootL2_10331817	rootL2_103318172	263
80	3300005329	Ga0070683_100000787	Ga0070683_1000007872	263
81	3300005329	Ga0070683_100003772	Ga0070683_1000037726	263
82	3300005329	Ga0070683_100004223	Ga0070683_1000042232	263
83	3300005330	Ga0070690_100023176	Ga0070690_1000231762	263
84	3300005330	Ga0070690_100080231	Ga0070690_1000802312	263
85	3300005331	Ga0070670_100083943	Ga0070670_1000839432	263
86	3300005334	Ga0068869_100453606	Ga0068869_1004536061	263
87	3300005335	Ga0070666_10045440	Ga0070666_100454401	263
88	3300005336	Ga0070680_100067468	Ga0070680_1000674683	263
89	3300005337	Ga0070682_100000023	Ga0070682_10000002329	263
90	3300005337	Ga0070682_100000026	Ga0070682_10000002628	263
91	3300005338	Ga0068868_100000229	Ga0068868_10000022933	263
92	3300005340	Ga0070689_100138241	Ga0070689_1001382412	263
93	3300005340	Ga0070689_100155597	Ga0070689_1001555971	263
94	3300005341	Ga0070691_10000027	Ga0070691_1000002726	263
95	3300005343	Ga0070687_100088169	Ga0070687_1000881692	263
96	3300005344	Ga0070661_100000004	Ga0070661_100000004139	263
97	3300005345	Ga0070692_10116277	Ga0070692_101162772	263
98	3300005347	Ga0070668_100201153	Ga0070668_1002011532	263
99	3300005354	Ga0070675_100000070	Ga0070675_1000000703	263
100	3300005356	Ga0070674_100000004	Ga0070674_10000000427	263
101	3300005356	Ga0070674_100000241	Ga0070674_10000024120	263
102	3300005364	Ga0070673_100008185	Ga0070673_1000081856	263
103	3300005365	Ga0070688_100001820	Ga0070688_1000018202	263
104	3300005366	Ga0070659_100022172	Ga0070659_1000221722	263
105	3300005366	Ga0070659_100036564	Ga0070659_1000365644	263
106	3300005367	Ga0070667_100178167	Ga0070667_1001781673	263
107	3300005435	Ga0070714_100183764	Ga0070714_1001837642	263
108	3300005436	Ga0070713_100000005	Ga0070713_100000005101	263
109	3300005439	Ga0070711_100004169	Ga0070711_1000041695	263
110	3300005441	Ga0070700_100065868	Ga0070700_1000658682	263
111	3300005457	Ga0070662_100000006	Ga0070662_10000000632	263
112	3300005458	Ga0070681_10026414	Ga0070681_100264143	263
113	3300005459	Ga0068867_100000556	Ga0068867_10000055621	263
114	3300005466	Ga0070685_10000027	Ga0070685_100000277	263
115	3300005466	Ga0070685_10000195	Ga0070685_1000019529	263
116	3300005530	Ga0070679_100001506	Ga0070679_10000150615	263
117	3300005530	Ga0070679_100185178	Ga0070679_1001851782	263
118	3300005535	Ga0070684_100024445	Ga0070684_1000244455	263
119	3300005535	Ga0070684_100031452	Ga0070684_1000314522	263
120	3300005539	Ga0068853_100000104	Ga0068853_10000010464	263
121	3300005543	Ga0070672_100000032	Ga0070672_1000000327	263
122	3300005544	Ga0070686_100058500	Ga0070686_1000585003	263
123	3300005547	Ga0070693_100002839	Ga0070693_1000028396	263
124	3300005548	Ga0070665_100000411	Ga0070665_10000041151	263
125	3300005578	Ga0068854_100000196	Ga0068854_10000019644	263
126	3300005614	Ga0068856_100001373	Ga0068856_10000137327	263
127	3300005614	Ga0068856_100023471	Ga0068856_1000234713	263
128	3300005614	Ga0068856_100024290	Ga0068856_1000242903	263
129	3300005615	Ga0070702_100353311	Ga0070702_1003533112	263
130	3300005615	Ga0070702_100387909	Ga0070702_1003879091	263
131	3300005616	Ga0068852_100099373	Ga0068852_1000993732	263
132	3300005618	Ga0068864_100000262	Ga0068864_10000026237	263
133	3300005618	Ga0068864_100401158	Ga0068864_1004011582	263
134	3300005718	Ga0068866_10000004	Ga0068866_1000000464	263
135	3300005718	Ga0068866_10000575	Ga0068866_100005753	263
136	3300005834	Ga0068851_10000533	Ga0068851_100005336	263
137	3300005841	Ga0068863_100000986	Ga0068863_10000098619	263
138	3300005843	Ga0068860_100014961	Ga0068860_1000149613	263
139	3300005937	Ga0081455_10053661	Ga0081455_100536612	263
140	3300006163	Ga0070715_10000014	Ga0070715_1000001419	263
141	3300006175	Ga0070712_100002154	Ga0070712_1000021549	263
142	3300006175	Ga0070712_100175975	Ga0070712_1001759752	263
143	3300006237	Ga0097621_100593972	Ga0097621_1005939722	263
144	3300006358	Ga0068871_100371038	Ga0068871_1003710381	263
145	3300006847	Ga0075431_100139273	Ga0075431_1001392732	263
146	3300006880	Ga0075429_100008963	Ga0075429_1000089635	263
147	3300006881	Ga0068865_100000064	Ga0068865_10000006438	263
148	3300006881	Ga0068865_100013987	Ga0068865_1000139875	263
149	3300009098	Ga0105245_10000023	Ga0105245_10000023116	263
150	3300009098	Ga0105245_10000133	Ga0105245_1000013330	263
151	3300009098	Ga0105245_10000335	Ga0105245_1000033510	263
152	3300009098	Ga0105245_10032869	Ga0105245_100328693	263
153	3300009101	Ga0105247_10004845	Ga0105247_100048452	263
154	3300009101	Ga0105247_10131537	Ga0105247_101315372	263
155	3300009148	Ga0105243_10573459	Ga0105243_105734591	263
156	3300009174	Ga0105241_10341533	Ga0105241_103415332	263
157	3300009176	Ga0105242_10000637	Ga0105242_1000063729	263
158	3300009176	Ga0105242_10224275	Ga0105242_102242752	263
159	3300009177	Ga0105248_10000037	Ga0105248_1000003755	263
160	3300009551	Ga0105238_10000033	Ga0105238_1000003339	263
161	3300009553	Ga0105249_10000150	Ga0105249_1000015072	263
162	3300010375	Ga0105239_10586075	Ga0105239_105860752	263
163	3300013102	Ga0157371_10027259	Ga0157371_100272594	263
164	3300013104	Ga0157370_10375791	Ga0157370_103757912	263
165	3300013105	Ga0157369_10000051	Ga0157369_1000005138	263
166	3300013296	Ga0157374_10002743	Ga0157374_100027436	263
167	3300013296	Ga0157374_10208471	Ga0157374_102084711	263
168	3300013297	Ga0157378_10025974	Ga0157378_100259743	263
169	3300013297	Ga0157378_10115608	Ga0157378_101156082	263
170	3300013297	Ga0157378_10283855	Ga0157378_102838552	263
171	3300013307	Ga0157372_10033557	Ga0157372_100335573	263
172	3300013308	Ga0157375_10001210	Ga0157375_1000121020	263
173	3300013308	Ga0157375_10427452	Ga0157375_104274522	263
174	3300014326	Ga0157380_10000007	Ga0157380_10000007126	263
175	3300014326	Ga0157380_10003179	Ga0157380_100031793	263
176	3300014968	Ga0157379_10038815	Ga0157379_100388153	263
177	3300014969	Ga0157376_10127811	Ga0157376_101278112	263
178	3300014969	Ga0157376_10285820	Ga0157376_102858201	263
179	3300014969	Ga0157376_10923109	Ga0157376_109231091	263
180	3300017792	Ga0163161_10000027	Ga0163161_10000027109	263
181	3300022467	Ga0224712_10054997	Ga0224712_100549972	263
182	3300025321	Ga0207656_10000173	Ga0207656_1000017310	263
183	3300025899	Ga0207642_10000005	Ga0207642_10000005143	263
184	3300025899	Ga0207642_10000227	Ga0207642_100002273	263
185	3300025900	Ga0207710_10000325	Ga0207710_1000032524	263
186	3300025900	Ga0207710_10065472	Ga0207710_100654722	263
187	3300025903	Ga0207680_10024618	Ga0207680_100246183	263
188	3300025905	Ga0207685_10000046	Ga0207685_1000004618	263
189	3300025909	Ga0207705_10060853	Ga0207705_100608532	263
190	3300025911	Ga0207654_10279093	Ga0207654_102790932	263
191	3300025912	Ga0207707_10008687	Ga0207707_100086876	263
192	3300025915	Ga0207693_10002209	Ga0207693_100022099	263
193	3300025916	Ga0207663_10001187	Ga0207663_1000118710	263
194	3300025916	Ga0207663_10043034	Ga0207663_100430344	263
195	3300025917	Ga0207660_10049146	Ga0207660_100491463	263
196	3300025920	Ga0207649_10000003	Ga0207649_10000003120	263
197	3300025921	Ga0207652_10000408	Ga0207652_1000040841	263
198	3300025921	Ga0207652_10040336	Ga0207652_100403365	263
199	3300025924	Ga0207694_10000012	Ga0207694_1000001239	263
200	3300025926	Ga0207659_10000018	Ga0207659_1000001861	263
201	3300025927	Ga0207687_10000015	Ga0207687_1000001566	263
202	3300025927	Ga0207687_10000078	Ga0207687_1000007834	263
203	3300025927	Ga0207687_10000126	Ga0207687_1000012618	263
204	3300025927	Ga0207687_10096917	Ga0207687_100969172	263
205	3300025928	Ga0207700_10000003	Ga0207700_10000003291	263
206	3300025929	Ga0207664_10057895	Ga0207664_100578953	263
207	3300025932	Ga0207690_10005572	Ga0207690_100055722	263
208	3300025932	Ga0207690_10023723	Ga0207690_100237232	263
209	3300025933	Ga0207706_10000017	Ga0207706_1000001732	263
210	3300025934	Ga0207686_10148265	Ga0207686_101482652	263
211	3300025935	Ga0207709_10187408	Ga0207709_101874082	263
212	3300025936	Ga0207670_10151180	Ga0207670_101511801	263
213	3300025937	Ga0207669_10000014	Ga0207669_10000014113	263
214	3300025937	Ga0207669_10000021	Ga0207669_1000002184	263
215	3300025938	Ga0207704_10000084	Ga0207704_1000008410	263
216	3300025939	Ga0207665_10033373	Ga0207665_100333733	263
217	3300025940	Ga0207691_10000002	Ga0207691_1000000252	263
218	3300025941	Ga0207711_10000011	Ga0207711_10000011487	263
219	3300025942	Ga0207689_10331327	Ga0207689_103313272	263
220	3300025944	Ga0207661_10000239	Ga0207661_1000023936	263
221	3300025944	Ga0207661_10000516	Ga0207661_100005162	263
222	3300025944	Ga0207661_10064930	Ga0207661_100649302	263
223	3300025960	Ga0207651_10001129	Ga0207651_100011299	263
224	3300025961	Ga0207712_10000027	Ga0207712_1000002720	263
225	3300025972	Ga0207668_10303067	Ga0207668_103030672	263
226	3300025981	Ga0207640_10000153	Ga0207640_100001532	263
227	3300025986	Ga0207658_10264082	Ga0207658_102640822	263
228	3300026023	Ga0207677_10000279	Ga0207677_1000027933	263
229	3300026035	Ga0207703_10648070	Ga0207703_106480701	263
230	3300026041	Ga0207639_10000471	Ga0207639_1000047131	263
231	3300026075	Ga0207708_10085416	Ga0207708_100854162	263
232	3300026078	Ga0207702_10000337	Ga0207702_1000033745	263
233	3300026078	Ga0207702_10000705	Ga0207702_100007058	263
234	3300026078	Ga0207702_10066746	Ga0207702_100667463	263
235	3300026088	Ga0207641_10000267	Ga0207641_1000026719	263
236	3300026089	Ga0207648_10001621	Ga0207648_100016219	263
237	3300026089	Ga0207648_10095989	Ga0207648_100959892	263
238	3300026095	Ga0207676_10000038	Ga0207676_1000003837	263
239	3300026095	Ga0207676_10368122	Ga0207676_103681222	263
240	3300026118	Ga0207675_100400768	Ga0207675_1004007681	263
241	3300026142	Ga0207698_10001646	Ga0207698_100016465	263
242	3300026142	Ga0207698_10304157	Ga0207698_103041572	263
243	3300028379	Ga0268266_10001851	Ga0268266_1000185111	263
244	3300028381	Ga0268264_10001213	Ga0268264_1000121324	263
245	3300028563	Ga0265319_1000014	Ga0265319_1000014178	263
246	3300028800	Ga0265338_10000244	Ga0265338_1000024454	263
247	3300028800	Ga0265338_10007752	Ga0265338_100077524	263
248	3300028800	Ga0265338_10008381	Ga0265338_100083812	263
249	3300031507	Ga0307509_10062951	Ga0307509_100629512	263
250	3300031507	Ga0307509_10073159	Ga0307509_100731594	263
251	3300031507	Ga0307509_10077466	Ga0307509_100774664	263
252	3300031507	Ga0307509_10088895	Ga0307509_100888953	263
253	3300031616	Ga0307508_10017235	Ga0307508_100172352	263
254	3300031711	Ga0265314_10098860	Ga0265314_100988603	263
255	3300032002	Ga0307416_100217405	Ga0307416_1002174052	263
256	3300032126	Ga0307415_100316067	Ga0307415_1003160671	263
257	3300035090	Ga0373949_0000002	Ga0373949_0000002_94603_95442	263
258	3300035113	Ga0373936_0000031	Ga0373936_0000031_3752_4561	263
259	3300035115	Ga0373941_0030090	Ga0373941_0030090_54_863	263
260	3300035117	Ga0373953_0131117	Ga0373953_0131117_85_909	263
261	3300035119	Ga0373956_0027324	Ga0373956_0027324_420_1256	263
262	3300035119	Ga0373956_0086430	Ga0373956_0086430_235_1074	263
263	3300035241	Ga0373961_0000069	Ga0373961_0000069_51765_52574	263
264	3300036401	Ga0373937_0057053	Ga0373937_0057053_1364_2188	263
265	3300037312	Ga0395899_0006542	Ga0395899_0006542_5880_6698	263
266	3300037418	Ga0395900_0119539	Ga0395900_0119539_409_1227	263
267	3300037466	Ga0395898_0144052	Ga0395898_0144052_1118_1936	263
268	3300037471	Ga0395905_0072410	Ga0395905_0072410_195_1013	263
269	3300037471	Ga0395905_0075564	Ga0395905_0075564_804_1622	263
270	3300041512	Ga0451853_0680681	Ga0451853_0680681_1201_2010	263
271	3300041512	Ga0451853_2572827	Ga0451853_2572827_994_1806	263
272	3300044694	Ga0466963_0000011	Ga0466963_0000011_4149_4967	263
273	3300044694	Ga0466963_0122268	Ga0466963_0122268_137_946	263
274	3300044842	Ga0466957_0003224	Ga0466957_0003224_6031_6849	263
275	3300044842	Ga0466957_0069600	Ga0466957_0069600_336_1154	263
276	3300045976	Ga0466967_0000002	Ga0466967_0000002_186362_187180	263
277	3300045976	Ga0466967_0159643	Ga0466967_0159643_311_1168	263
278	3300046454	Ga0495592_0000024	Ga0495592_0000024_25560_26354	263
279	3300046455	Ga0495603_0000672	Ga0495603_0000672_324_1190	263
280	3300046459	Ga0495629_0000025	Ga0495629_0000025_93906_94730	263
281	3300046459	Ga0495629_0410453	Ga0495629_0410453_50_880	263
282	3300046462	Ga0495651_0019243	Ga0495651_0019243_1126_1956	263
283	3300046463	Ga0495653_0016256	Ga0495653_0016256_3272_4102	263
284	3300046473	Ga0495582_0000003	Ga0495582_0000003_79657_80448	263
285	3300046475	Ga0495639_0014142	Ga0495639_0014142_2511_3320	263
286	3300046476	Ga0495662_0000002	Ga0495662_0000002_39973_40767	263
287	3300046476	Ga0495662_0002121	Ga0495662_0002121_7194_8006	263
288	3300046507	Ga0495606_0000017	Ga0495606_0000017_157033_157857	263
289	3300046511	Ga0495608_0000035	Ga0495608_0000035_131409_132227	263
290	3300046511	Ga0495608_0000122	Ga0495608_0000122_43144_43995	263
291	3300046512	Ga0495610_0132720	Ga0495610_0132720_183_1007	263
292	3300046514	Ga0495618_0000026	Ga0495618_0000026_43102_43914	263
293	3300046516	Ga0495628_0000456	Ga0495628_0000456_10997_11794	263
294	3300046516	Ga0495628_0002836	Ga0495628_0002836_6661_7452	263
295	3300046516	Ga0495628_0272680	Ga0495628_0272680_222_1040	263
296	3300046517	Ga0495630_0000034	Ga0495630_0000034_76646_77464	263
297	3300046523	Ga0495644_0005089	Ga0495644_0005089_1347_2138	263
298	3300046529	Ga0495652_0004742	Ga0495652_0004742_2424_3254	263
299	3300046533	Ga0495640_0038949	Ga0495640_0038949_1323_2117	263
300	3300046535	Ga0495586_0000294	Ga0495586_0000294_28652_29488	263
301	3300046536	Ga0495587_0032624	Ga0495587_0032624_245_1081	263
302	3300046537	Ga0495598_0003685	Ga0495598_0003685_1457_2275	263
303	3300046539	Ga0495621_0016505	Ga0495621_0016505_317_1153	263
304	3300046543	Ga0495645_0010389	Ga0495645_0010389_4025_4879	263
305	3300046557	Ga0495622_0030190	Ga0495622_0030190_499_1503	263
306	3300046558	Ga0495633_0030034	Ga0495633_0030034_184_1008	263
307	3300046559	Ga0495667_0108795	Ga0495667_0108795_43_864	263
308	3300046642	Ga0495634_0017927	Ga0495634_0017927_441_1283	263
309	3300046663	Ga0495635_0000005	Ga0495635_0000005_137630_138448	263
310	3300046663	Ga0495635_0053113	Ga0495635_0053113_965_1807	263
311	3300046674	Ga0495588_0000073	Ga0495588_0000073_94215_95039	263
312	3300046675	Ga0495657_0000026	Ga0495657_0000026_785_1603	263
313	3300046675	Ga0495657_0045388	Ga0495657_0045388_679_1473	263
314	3300046681	Ga0495647_0000004	Ga0495647_0000004_118355_119164	263
315	3300046681	Ga0495647_0002665	Ga0495647_0002665_3791_4585	263
316	3300046681	Ga0495647_0010837	Ga0495647_0010837_663_1481	263
317	3300046683	Ga0495658_0000001	Ga0495658_0000001_91963_92754	263
318	3300046683	Ga0495658_0004359	Ga0495658_0004359_3774_4592	263
319	3300046684	Ga0495669_0000264	Ga0495669_0000264_27307_28125	263
320	3300046689	Ga0495613_0000021	Ga0495613_0000021_69889_70683	263
321	3300046689	Ga0495613_0000027	Ga0495613_0000027_21049_21867	263
322	3300046690	Ga0495624_0000007	Ga0495624_0000007_21941_22750	263
323	3300046690	Ga0495624_0000127	Ga0495624_0000127_17811_18629	263
324	3300046690	Ga0495624_0042779	Ga0495624_0042779_1370_2164	263
325	3300046691	Ga0495670_0010543	Ga0495670_0010543_2483_3307	263
326	3300046809	Ga0495600_0013656	Ga0495600_0013656_619_1437	263
327	3300046809	Ga0495600_0031659	Ga0495600_0031659_584_1396	263
328	3300047317	Ga0495604_0000038	Ga0495604_0000038_33359_34219	263
329	3300047317	Ga0495604_0000058	Ga0495604_0000058_22780_23598	263
330	3300047317	Ga0495604_0009520	Ga0495604_0009520_2459_3277	263
331	3300047317	Ga0495604_0140992	Ga0495604_0140992_288_1109	263
332	3300047319	Ga0495674_0126863	Ga0495674_0126863_1161_1982	263
333	3300047321	Ga0495676_0000204	Ga0495676_0000204_25032_25856	263
334	3300047322	Ga0495680_0000007	Ga0495680_0000007_32171_32983	263
335	3300047322	Ga0495680_0243889	Ga0495680_0243889_83_904	263
336	3300047444	Ga0495675_0000015	Ga0495675_0000015_778_1596	263
337	3300047673	Ga0495593_0072887	Ga0495593_0072887_571_1380	263
338	3300047673	Ga0495593_0112071	Ga0495593_0112071_407_1225	263
339	3300048088	Ga0495602_0000393	Ga0495602_0000393_13353_14171	263
340	3300048088	Ga0495602_0017733	Ga0495602_0017733_1753_2550	263
341	3300048088	Ga0495602_0019469	Ga0495602_0019469_5050_5883	263
342	3300048907	Ga0496104_0000004	Ga0496104_0000004_384610_385404	263
343	3300048907	Ga0496104_0009579	Ga0496104_0009579_7764_8579	263
344	3300048907	Ga0496104_0183760	Ga0496104_0183760_322_1140	263
345	3300048908	Ga0496105_0000001	Ga0496105_0000001_256427_257221	263
346	3300048908	Ga0496105_0002921	Ga0496105_0002921_9178_9993	263
347	3300048909	Ga0496106_0000200	Ga0496106_0000200_17738_18562	263
348	3300048910	Ga0496107_0034406	Ga0496107_0034406_1756_2580	263
349	3300048911	Ga0496108_0000005	Ga0496108_0000005_318370_319188	263
350	3300048911	Ga0496108_0013306	Ga0496108_0013306_2449_3264	263
351	3300048912	Ga0496109_0000002	Ga0496109_0000002_215904_216722	263
352	3300048912	Ga0496109_0000066	Ga0496109_0000066_75708_76523	263
353	3300048912	Ga0496109_0040257	Ga0496109_0040257_728_1549	263
354	3300048912	Ga0496109_0139899	Ga0496109_0139899_531_1397	263
355	3300048912	Ga0496109_0338006	Ga0496109_0338006_319_1134	263
356	3300048913	Ga0496110_0000241	Ga0496110_0000241_26770_27588	263
357	3300048913	Ga0496110_0026824	Ga0496110_0026824_3577_4398	263
358	3300048913	Ga0496110_0349399	Ga0496110_0349399_76_915	263
359	3300048914	Ga0496111_0000011	Ga0496111_0000011_26745_27563	263
360	3300048914	Ga0496111_0010265	Ga0496111_0010265_5311_6132	263
361	3300048914	Ga0496111_0101813	Ga0496111_0101813_384_1223	263
362	3300048914	Ga0496111_0125035	Ga0496111_0125035_447_1271	263
363	3300048915	Ga0496112_0000003	Ga0496112_0000003_299536_300384	263
364	3300048915	Ga0496112_0000266	Ga0496112_0000266_588_1406	263
365	3300048915	Ga0496112_0141381	Ga0496112_0141381_1275_2096	263
366	3300048916	Ga0496113_0000001	Ga0496113_0000001_136997_137815	263
367	3300048916	Ga0496113_0004458	Ga0496113_0004458_5706_6542	263
368	3300048916	Ga0496113_0028027	Ga0496113_0028027_1525_2391	263
369	3300048916	Ga0496113_0039707	Ga0496113_0039707_2515_3336	263
370	3300048917	Ga0496114_0000101	Ga0496114_0000101_57684_58478	263
371	3300048917	Ga0496114_0001768	Ga0496114_0001768_6631_7455	263
372	3300048917	Ga0496114_0190517	Ga0496114_0190517_525_1349	263
373	3300048917	Ga0496114_0364560	Ga0496114_0364560_194_1027	263
374	3300048918	Ga0496115_0000016	Ga0496115_0000016_76793_77626	263
375	3300048918	Ga0496115_0013461	Ga0496115_0013461_3467_4261	263
376	3300048922	Ga0496119_0028023	Ga0496119_0028023_2830_3624	263
377	3300048923	Ga0496120_0080342	Ga0496120_0080342_954_1748	263
378	3300049578	Ga0501042_0227524	Ga0501042_0227524_394_1215	263
379	3300049578	Ga0501042_0233208	Ga0501042_0233208_481_1308	263
380	3300049581	Ga0501047_0013753	Ga0501047_0013753_2008_2826	263
381	3300049586	Ga0501070_0049382	Ga0501070_0049382_978_1796	263
382	3300049586	Ga0501070_0123439	Ga0501070_0123439_546_1364	263
383	3300049589	Ga0501073_0200609	Ga0501073_0200609_17_835	263
384	3300049591	Ga0501075_0013441	Ga0501075_0013441_118_939	263
385	3300049592	Ga0501076_0052282	Ga0501076_0052282_666_1502	263
386	3300049742	Ga0501080_0441557	Ga0501080_0441557_44_862	263
387	3300049743	Ga0501081_0297692	Ga0501081_0297692_142_963	263
388	3300049823	Ga0501044_0092481	Ga0501044_0092481_1576_2394	263
389	3300050508	nmdc:mga09592_8996_c1	nmdc:mga09592_8996_c1_5043_5888	263
390	3300050510	nmdc:mga06r32_157041_c1	nmdc:mga06r32_157041_c1_323_1162	263
391	3300053077	Ga0495601_0000017	Ga0495601_0000017_112136_112954	263
392	3300053077	Ga0495601_0010864	Ga0495601_0010864_3805_4620	263
393	3300053077	Ga0495601_0019658	Ga0495601_0019658_2765_3559	263
394	3300053078	Ga0495612_0000236	Ga0495612_0000236_15251_16072	263
395	3300053078	Ga0495612_0013522	Ga0495612_0013522_2056_2880	263
396	3300053078	Ga0495612_0082739	Ga0495612_0082739_388_1212	263
397	3300053084	Ga0495595_0000017	Ga0495595_0000017_785_1603	263
398	3300053084	Ga0495595_0000072	Ga0495595_0000072_28935_29729	263
399	3300053085	Ga0495619_0000054	Ga0495619_0000054_27568_28422	263
400	3300053085	Ga0495619_0000101	Ga0495619_0000101_785_1603	263
401	3300053085	Ga0495619_0000192	Ga0495619_0000192_6737_7600	263
402	3300053085	Ga0495619_0001760	Ga0495619_0001760_13134_13976	263
403	3300053085	Ga0495619_0012634	Ga0495619_0012634_755_1576	263
404	3300053085	Ga0495619_0022200	Ga0495619_0022200_1383_2174	263
405	3300053085	Ga0495619_0100814	Ga0495619_0100814_258_1091	263
406	3300053085	Ga0495619_0132453	Ga0495619_0132453_160_981	263
407	3300053085	Ga0495619_0135449	Ga0495619_0135449_550_1392	263
408	3300053085	Ga0495619_0420616	Ga0495619_0420616_70_909	263
409	3300053094	Ga0500566_0176851	Ga0500566_0176851_51_860	263
410	3300053150	Ga0500603_011802	Ga0500603_011802_893_1702	263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

34

253

0.93 PF03096

Ndr

Ndr family

54

140

0.93 PF12146

Hydrolase_4

Serine aminopeptidase, S33

34

197

0.82 PF12697

Abhydrolase_6

Alpha/beta hydrolase family

36

268

0.66 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5ie5-assembly2.cif.gz_C-2	crystal structure of a lactonase double mutant in complex with substrate a	0.848	11	119
8b6p-assembly1.cif.gz_A	x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156)	0.838	2	119
8b6n-assembly1.cif.gz_A	x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta)	0.8357	2	119
8b6o-assembly1.cif.gz_A	x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13	0.8342	2	119
3bdi-assembly1.cif.gz_A	crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution	0.8305	2	260

ID	Description	Score	Start	End	Superfamily
af_A0A0R0KMM0_1_93_3.40.50.12270	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;	0.9322	2	88	3.40.50.12270
af_Q4CQ94_14_186_3.40.50.12270	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;	0.8971	9	122	3.40.50.12270
af_A0A0R0KMM0_1_93_3.40.50.12270	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;	0.8571	2	88	3.40.50.12270
af_A0A1D6K8I4_16_172_3.40.50.1820	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain	0.8404	2	122	3.40.50.1820
af_K7LW21_1_105_3.40.50.12270	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;	0.8399	2	112	3.40.50.12270

ID	Description	Score	Start	End	GO Terms
AF-A0A2T0QJH6-F1-model_v4	Alpha/beta hydrolase family protein	0.9561	2	119	GO:0016787
AF-A0A7J8NEI6-F1-model_v4	AB hydrolase-1 domain-containing protein	0.9528	2	119	GO:0003824
AF-A0A3D1ZK27-F1-model_v4	AB hydrolase-1 domain-containing protein	0.9493	3	119	GO:0003824
AF-A0A7J0CPU1-F1-model_v4	AB hydrolase-1 domain-containing protein	0.9491	2	119	GO:0003824
AF-A0A2D4PZP1-F1-model_v4	AB hydrolase-1 domain-containing protein	0.9449	9	119	GO:0004301

Feature Viewer

pLDDT	pTM	Quality
84	0.82	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F437284

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

34

253

0.93

PF03096

Ndr

Ndr family

54

140

0.93

PF12146

Hydrolase_4

Serine aminopeptidase, S33

34

197

0.82

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

36

268

0.66

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map