F437287

General Info

Members Datasets Scaffolds Average Seq Length
410 216 370 294

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10018318|Ga0265327_100183183
Length 294
Sequence MQTLNGNAVAKTLKEKIKLDVDQLKAEGKKVPHLAAILVGSVGASMTYVAAKEKDCHEVGFDSTVLRFPETITEAELLNEVEKINNNVDIDGLIVQLPLPKHISEKKVTETISWKKDVDGFHPMNVGLMFKGLPCFLPATPYGIIKLLEHYKVETTGKHCVIIGRSDIVGKPMSALMLQKNCTVTVCHSKTKDIDSFIRQADIVIAALGKPEFLKASMIKEGAIVIDVGITRVDDATNPKGYVLKGDVDYNDVAPKSSFITPVPGGVGPMTRIGLLLNTIDAVKRNTNVKVANN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
5 2738541283 Pedobacter sp. OK701 Isolate Unclassified
6 2738541284 Pedobacter sp. YR016 Isolate Unclassified
7 2738541302 Pedobacter sp. CF074 Isolate Unclassified
8 2738543023 Pedobacter sp. OK628 Isolate Unclassified
9 2739367651 Pedobacter sp. OK291 Isolate Unclassified
10 2739367656 Pedobacter sp. CF523 Isolate Unclassified
11 2739367663 Pedobacter sp. YR510 Isolate Unclassified
12 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
13 2818991437 Pedobacter terrae 518 Isolate Unclassified
14 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
15 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
16 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
17 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
18 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
19 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
20 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
21 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
22 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
23 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
24 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
25 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
26 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
27 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
28 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
29 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
30 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
31 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
32 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
33 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
34 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
35 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
36 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
37 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
38 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
39 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
40 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
41 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
42 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
43 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
44 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
45 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
46 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
47 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
48 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
49 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
50 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
51 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
52 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
53 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
54 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
55 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
56 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
57 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
58 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
59 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
63 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
64 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
65 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
66 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
67 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
107 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
108 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
109 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
141 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
142 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
181 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
201 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
202 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
208 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
209 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
210 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
211 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
214 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
215 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
216 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.27
Metatranscriptomes 0.73
Isolates 10

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.02
Nodule 0
Rhizoplane 0.49
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 10.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1762462 2162886007 Bacteria 256265
2 SwRhRL2b_contig_2513460 2162886007 Bacteria 7126
3 JGI24736J21556_1011425 3300001904 Bacteria 1445
4 JGI24740J21852_10004599 3300001979 Bacteria 5932
5 JGI24739J22299_10000727 3300001989 Bacteria 11938
6 JGI24739J22299_10004833 3300001989 Bacteria 5135
7 JGI24737J22298_10001479 3300001990 Bacteria 8368
8 JGI24737J22298_10007867 3300001990 Bacteria 3590
9 JGI24737J22298_10057413 3300001990 Bacteria 1175
10 JGI24735J21928_10000012 3300002067 Bacteria 208921
11 JGI25162J39368_1000062 3300002737 Bacteria 135587
12 JGI25162J39368_1002467 3300002737 Bacteria 7152
13 JGI25164J39214_1001275 3300002772 Bacteria 6498
14 JGI25152J39213_1000305 3300002773 Bacteria 31834
15 JGI25150J39212_1000009 3300002774 Bacteria 249509
16 JGI25151J46595_10000017 3300003187 Bacteria 249509
17 JGI25165J46597_1000378 3300003214 Bacteria 48769
18 JGI25153J46596_10000023 3300003215 Bacteria 249509
19 rootH1_10007370 3300003316 Bacteria 11288
20 rootH1_10007370 3300003323 Bacteria 63699
21 rootH2_10005719 3300003320 Bacteria 108734
22 rootH2_10010950 3300003320 Bacteria 23207
23 rootH2_10218944 3300003320 Bacteria 3147
24 rootH2_10252965 3300003320 Bacteria 4031
25 rootH1_10012846 3300003323 Bacteria 47357
26 rootH1_10203933 3300003323 Bacteria 2509
27 rootH1_10212159 3300003323 Bacteria 1783
28 Ga0055536_1000011 3300003781 Bacteria 275969
29 Ga0055530_10003662 3300003791 Bacteria 8597
30 Ga0058863_11910999 3300004799 Bacteria 2061
31 Ga0058861_11784620 3300004800 Bacteria 1815
32 Ga0058862_12768823 3300004803 Bacteria 2328
33 Ga0065714_10003657 3300005288 Bacteria 30790
34 Ga0065714_10010842 3300005288 Bacteria 2510
35 Ga0065714_10064476 3300005288 Bacteria 57050
36 Ga0065714_10064664 3300005288 Bacteria 25064
37 Ga0065714_10064897 3300005288 Bacteria 15960
38 Ga0065714_10078069 3300005288 Bacteria 2632
39 Ga0065714_10090265 3300005288 Bacteria 1950
40 Ga0065714_10092029 3300005288 Bacteria 1832
41 Ga0065704_10000193 3300005289 Bacteria 203271
42 Ga0065704_10076570 3300005289 Bacteria 5074
43 Ga0070658_10000026 3300005327 Bacteria 171716
44 Ga0070658_10077256 3300005327 Bacteria 2731
45 Ga0070658_10113242 3300005327 Bacteria 2249
46 Ga0070658_10162978 3300005327 Bacteria 1871
47 Ga0070676_10003219 3300005328 Bacteria 8462
48 Ga0070683_100009979 3300005329 Bacteria 8142
49 Ga0070691_10211073 3300005341 Bacteria 1024
50 Ga0070671_100020069 3300005355 Bacteria 5445
51 Ga0070659_100001374 3300005366 Bacteria 17526
52 Ga0070659_100004503 3300005366 Bacteria 9953
53 Ga0070659_100041745 3300005366 Bacteria 3587
54 Ga0070663_100041975 3300005455 Bacteria 3212
55 Ga0070662_100000019 3300005457 Bacteria 101983
56 Ga0070679_100200313 3300005530 Bacteria 1963
57 Ga0070679_100284276 3300005530 Bacteria 1606
58 Ga0068853_100211422 3300005539 Bacteria 1768
59 Ga0070665_100000003 3300005548 Bacteria 811857
60 Ga0068855_100000073 3300005563 Bacteria 121126
61 Ga0068855_100000134 3300005563 Bacteria 94864
62 Ga0068855_100030360 3300005563 Bacteria 6465
63 Ga0068855_100055159 3300005563 Bacteria 4669
64 Ga0068855_100164599 3300005563 Bacteria 2515
65 Ga0068855_100298588 3300005563 Bacteria 1784
66 Ga0068855_100452135 3300005563 Bacteria 1401
67 Ga0068857_100085880 3300005577 Bacteria 2813
68 Ga0068856_100000078 3300005614 Bacteria 93041
69 Ga0068856_100002592 3300005614 Bacteria 18616
70 Ga0068856_100053977 3300005614 Bacteria 3963
71 Ga0068856_100226785 3300005614 Bacteria 1884
72 Ga0068852_100024720 3300005616 Bacteria 4859
73 Ga0068870_10209113 3300005840 Bacteria 1187
74 Ga0075366_10000928 3300006195 Bacteria 14229
75 Ga0075366_10002537 3300006195 Bacteria 9384
76 Ga0097621_100000507 3300006237 Bacteria 27254
77 Ga0068871_100066989 3300006358 Bacteria 2944
78 Ga0105240_10000040 3300009093 Bacteria 264634
79 Ga0105240_10000221 3300009093 Bacteria 114656
80 Ga0105240_10006461 3300009093 Bacteria 17226
81 Ga0105240_10010194 3300009093 Bacteria 13226
82 Ga0105240_10113807 3300009093 Bacteria 3269
83 Ga0105240_10395632 3300009093 Bacteria 1557
84 Ga0105240_10473241 3300009093 Bacteria 1398
85 Ga0105240_10751100 3300009093 Bacteria 1060
86 Ga0105245_10044779 3300009098 Bacteria 3951
87 Ga0105245_10493167 3300009098 Bacteria 1240
88 Ga0105243_10000006 3300009148 Bacteria 465541
89 Ga0105243_10086634 3300009148 Bacteria 2569
90 Ga0105241_10000812 3300009174 Bacteria 23715
91 Ga0105241_10013149 3300009174 Bacteria 6071
92 Ga0105241_10034170 3300009174 Bacteria 3819
93 Ga0105241_10114393 3300009174 Bacteria 2164
94 Ga0105248_10793456 3300009177 Bacteria 1069
95 Ga0105237_10000689 3300009545 Bacteria 46773
96 Ga0105237_10002671 3300009545 Bacteria 21891
97 Ga0105237_10003562 3300009545 Bacteria 18457
98 Ga0105237_10006737 3300009545 Bacteria 12689
99 Ga0105237_10038298 3300009545 Bacteria 4842
100 Ga0105237_10057165 3300009545 Bacteria 3904
101 Ga0105237_10068929 3300009545 Bacteria 3532
102 Ga0105237_10070137 3300009545 Bacteria 3500
103 Ga0105237_10150038 3300009545 Bacteria 2327
104 Ga0105239_10000002 3300010375 Bacteria 610298
105 Ga0105239_10000133 3300010375 Bacteria 105033
106 Ga0105239_10000255 3300010375 Bacteria 79421
107 Ga0105239_10004813 3300010375 Bacteria 16009
108 Ga0105239_10009996 3300010375 Bacteria 10645
109 Ga0105239_10035892 3300010375 Bacteria 5443
110 Ga0105239_10039238 3300010375 Bacteria 5188
111 Ga0157373_10000136 3300013100 Bacteria 57912
112 Ga0157373_10000265 3300013100 Bacteria 42223
113 Ga0157373_10005191 3300013100 Bacteria 9787
114 Ga0157373_10030207 3300013100 Bacteria 3899
115 Ga0157371_10000688 3300013102 Bacteria 39888
116 Ga0157371_10002673 3300013102 Bacteria 16868
117 Ga0157371_10004644 3300013102 Bacteria 11899
118 Ga0157371_10005582 3300013102 Bacteria 10570
119 Ga0157371_10007420 3300013102 Bacteria 8881
120 Ga0157371_10027602 3300013102 Bacteria 4117
121 Ga0157370_10008391 3300013104 Bacteria 11143
122 Ga0157370_10021959 3300013104 Bacteria 6356
123 Ga0157370_10103553 3300013104 Bacteria 2664
124 Ga0157370_10106218 3300013104 Bacteria 2628
125 Ga0157370_10120877 3300013104 Bacteria 2445
126 Ga0157370_10464410 3300013104 Bacteria 1163
127 Ga0157370_10565955 3300013104 Bacteria 1041
128 Ga0157369_10000006 3300013105 Bacteria 412230
129 Ga0157369_10000805 3300013105 Bacteria 40099
130 Ga0157369_10065196 3300013105 Bacteria 3921
131 Ga0157369_10087821 3300013105 Bacteria 3320
132 Ga0157374_10001037 3300013296 Bacteria 24098
133 Ga0157378_10030032 3300013297 Bacteria 4801
134 Ga0157378_10032302 3300013297 Bacteria 4625
135 Ga0157378_10071751 3300013297 Bacteria 3110
136 Ga0157378_10081725 3300013297 Bacteria 2920
137 Ga0157378_10179154 3300013297 Bacteria 1993
138 Ga0163162_10000930 3300013306 Bacteria 27181
139 Ga0163162_10008205 3300013306 Bacteria 10191
140 Ga0163162_10008828 3300013306 Bacteria 9801
141 Ga0157372_10000001 3300013307 Bacteria 791349
142 Ga0157372_10000118 3300013307 Bacteria 84096
143 Ga0157372_10002637 3300013307 Bacteria 19415
144 Ga0157372_10008206 3300013307 Bacteria 11099
145 Ga0157372_10009254 3300013307 Bacteria 10477
146 Ga0157372_10013033 3300013307 Bacteria 8868
147 Ga0157372_10066806 3300013307 Bacteria 4040
148 Ga0157375_10029409 3300013308 Bacteria 5166
149 Ga0157375_10171445 3300013308 Bacteria 2318
150 Ga0157380_10000103 3300014326 Bacteria 47312
151 Ga0182008_10000018 3300014497 Bacteria 230609
152 Ga0182008_10000432 3300014497 Bacteria 32241
153 Ga0182008_10000524 3300014497 Bacteria 28770
154 Ga0182008_10047317 3300014497 Bacteria 2137
155 Ga0182008_10057461 3300014497 Bacteria 1921
156 Ga0182008_10105151 3300014497 Bacteria 1396
157 Ga0182006_1000115 3300015261 Bacteria 86290
158 Ga0182006_1000382 3300015261 Bacteria 36661
159 Ga0182006_1002221 3300015261 Bacteria 10751
160 Ga0182007_10000001 3300015262 Bacteria 1127301
161 Ga0182007_10020064 3300015262 Bacteria 2395
162 Ga0183373_1006 3300015682 Bacteria 328276
163 Ga0163161_10000153 3300017792 Bacteria 63614
164 Ga0163161_10001740 3300017792 Bacteria 15937
165 Ga0163161_10002015 3300017792 Bacteria 14700
166 Ga0163161_10006269 3300017792 Bacteria 8233
167 Ga0163161_10324979 3300017792 Bacteria 1217
168 Ga0207427_100217 3300025231 Bacteria 50153
169 Ga0209437_100052 3300025233 Bacteria 380548
170 Ga0209437_100177 3300025233 Bacteria 135759
171 Ga0207425_1000007 3300025245 Bacteria 777411
172 Ga0209026_1000552 3300025250 Bacteria 25752
173 Ga0209026_1003671 3300025250 Bacteria 4919
174 Ga0209026_1009767 3300025250 Bacteria 1853
175 Ga0209129_1000006 3300025258 Bacteria 777761
176 Ga0209129_1006370 3300025258 Bacteria 3839
177 Ga0209233_1000067 3300025261 Bacteria 380554
178 Ga0209233_1001976 3300025261 Bacteria 7783
179 Ga0209676_1000001 3300025292 Bacteria 1852142
180 Ga0209025_1000025 3300025294 Bacteria 524454
181 Ga0209758_1000016 3300025297 Bacteria 778557
182 Ga0209050_1000016 3300025298 Bacteria 729149
183 Ga0207647_10000042 3300025904 Bacteria 91917
184 Ga0207647_10000296 3300025904 Bacteria 40915
185 Ga0207645_10007029 3300025907 Bacteria 8014
186 Ga0207643_10203882 3300025908 Bacteria 1205
187 Ga0207705_10000040 3300025909 Bacteria 185735
188 Ga0207654_10002044 3300025911 Bacteria 10355
189 Ga0207654_10003470 3300025911 Bacteria 7972
190 Ga0207695_10000041 3300025913 Bacteria 450902
191 Ga0207695_10000189 3300025913 Bacteria 177142
192 Ga0207695_10020814 3300025913 Bacteria 7501
193 Ga0207695_10033065 3300025913 Bacteria 5649
194 Ga0207695_10057391 3300025913 Bacteria 4044
195 Ga0207695_10064491 3300025913 Bacteria 3771
196 Ga0207695_10172737 3300025913 Bacteria 2086
197 Ga0207695_10510927 3300025913 Bacteria 1083
198 Ga0207671_10002083 3300025914 Bacteria 21886
199 Ga0207671_10005781 3300025914 Bacteria 11263
200 Ga0207671_10008482 3300025914 Bacteria 8709
201 Ga0207671_10012299 3300025914 Bacteria 6889
202 Ga0207671_10019403 3300025914 Bacteria 5198
203 Ga0207671_10091753 3300025914 Bacteria 2289
204 Ga0207671_10419326 3300025914 Bacteria 1065
205 Ga0207652_10067309 3300025921 Bacteria 3105
206 Ga0207687_10121453 3300025927 Unclassified 1954
207 Ga0207687_10306558 3300025927 Bacteria 1280
208 Ga0207644_10015002 3300025931 Bacteria 5196
209 Ga0207690_10013269 3300025932 Bacteria 4948
210 Ga0207690_10057099 3300025932 Bacteria 2636
211 Ga0207706_10000058 3300025933 Bacteria 112367
212 Ga0207709_10000007 3300025935 Bacteria 752025
213 Ga0207709_10175236 3300025935 Bacteria 1509
214 Ga0207704_10000081 3300025938 Bacteria 57180
215 Ga0207667_10000009 3300025949 Bacteria 603135
216 Ga0207667_10036205 3300025949 Bacteria 5291
217 Ga0207667_10197620 3300025949 Bacteria 2063
218 Ga0207639_10172573 3300026041 Bacteria 1833
219 Ga0207639_10262390 3300026041 Bacteria 1511
220 Ga0207702_10004045 3300026078 Bacteria 13165
221 Ga0207702_10005005 3300026078 Bacteria 11639
222 Ga0207702_10038772 3300026078 Bacteria 3991
223 Ga0207648_10001742 3300026089 Bacteria 23812
224 Ga0207674_10091100 3300026116 Bacteria 3040
225 Ga0207674_10331829 3300026116 Bacteria 1471
226 Ga0207698_10106306 3300026142 Bacteria 2340
227 Ga0268266_10000018 3300028379 Bacteria 569141
228 Ga0268266_10007077 3300028379 Bacteria 10186
229 Ga0265323_10000365 3300028653 Bacteria 26035
230 Ga0307517_10028463 3300028786 Bacteria 6658
231 Ga0307515_10000223 3300028794 Bacteria 140434
232 Ga0307515_10001312 3300028794 Bacteria 56474
233 Ga0307515_10143627 3300028794 Bacteria 2543
234 Ga0265338_10003003 3300028800 Bacteria 24413
235 Ga0265338_10089219 3300028800 Bacteria 2556
236 Ga0316176_1196368 3300030732 Bacteria 8090
237 Ga0316183_1118483 3300030742 Bacteria 38677
238 Ga0316181_1040473 3300030744 Bacteria 7846
239 Ga0265327_10000010 3300031251 Bacteria 566817
240 Ga0265327_10000692 3300031251 Bacteria 53756
241 Ga0265327_10018318 3300031251 Bacteria 4349
242 Ga0265327_10038039 3300031251 Bacteria 2629
243 Ga0265316_10001810 3300031344 Bacteria 22497
244 Ga0307408_100000608 3300031548 Bacteria 30646
245 Ga0307408_100000629 3300031548 Bacteria 29827
246 Ga0307408_100000729 3300031548 Bacteria 26641
247 Ga0265314_10081982 3300031711 Bacteria 2123
248 Ga0265342_10119525 3300031712 Bacteria 1485
249 Ga0307405_10000010 3300031731 Bacteria 250978
250 Ga0307412_10000077 3300031911 Bacteria 96375
251 Ga0307412_10003271 3300031911 Bacteria 8995
252 Ga0307412_10039882 3300031911 Bacteria 3035
253 Ga0307412_10208257 3300031911 Bacteria 1490
254 Ga0307416_100000019 3300032002 Bacteria 199706
255 Ga0307414_10003957 3300032004 Bacteria 7987
256 Ga0307414_10010061 3300032004 Bacteria 5465
257 Ga0307414_10051278 3300032004 Bacteria 2863
258 Ga0307414_10055217 3300032004 Bacteria 2780
259 Ga0307414_10127865 3300032004 Bacteria 1966
260 Ga0307414_10176845 3300032004 Bacteria 1712
261 Ga0307411_10183265 3300032005 Bacteria 1591
262 Ga0307507_10000170 3300033179 Bacteria 116878
263 Ga0307510_10036368 3300033180 Bacteria 5480
264 Ga0395899_0000001 3300037312 Bacteria 1750322
265 Ga0395899_0000232 3300037312 Bacteria 75259
266 Ga0395899_0001028 3300037312 Bacteria 25443
267 Ga0395899_0006889 3300037312 Bacteria 8803
268 Ga0395900_0001746 3300037418 Bacteria 25003
269 Ga0395900_0002099 3300037418 Bacteria 22311
270 Ga0395900_0003255 3300037418 Bacteria 17585
271 Ga0395900_0195121 3300037418 Bacteria 2052
272 Ga0395898_0013319 3300037466 Bacteria 8469
273 Ga0395898_0229578 3300037466 Bacteria 1770
274 Ga0395905_0001641 3300037471 Bacteria 26503
275 Ga0395905_0152145 3300037471 Bacteria 2176
276 Ga0395901_0000794 3300038443 Bacteria 35129
277 Ga0395901_0004908 3300038443 Bacteria 13498
278 Ga0400483_096702 3300039062 Bacteria 1955
279 Ga0436361_1086342 3300039447 Bacteria 3464
280 Ga0439448_0001802 3300042005 Bacteria 5669
281 Ga0451577_0107671 3300042876 Bacteria 2492
282 Ga0451577_0123654 3300042876 Bacteria 2318
283 Ga0451577_0164765 3300042876 Bacteria 1997
284 Ga0451577_0202478 3300042876 Bacteria 1792
285 Ga0453683_0046148 3300044673 Unclassified 2732
286 Ga0453684_0002871 3300044712 Bacteria 40426
287 Ga0453684_0002943 3300044712 Bacteria 39941
288 Ga0453684_0005368 3300044712 Bacteria 25485
289 Ga0453684_0024118 3300044712 Bacteria 8910
290 Ga0453684_0248672 3300044712 Bacteria 2043
291 Ga0466970_0013164 3300044765 Bacteria 4240
292 Ga0495650_0000013 3300046471 Bacteria 611135
293 Ga0495585_0000651 3300046492 Bacteria 31896
294 Ga0495585_0001040 3300046492 Bacteria 22999
295 Ga0495606_0000002 3300046507 Bacteria 554637
296 Ga0495606_0076888 3300046507 Bacteria 2085
297 Ga0495606_0082819 3300046507 Bacteria 1991
298 Ga0495606_0122980 3300046507 Bacteria 1551
299 Ga0495610_0001760 3300046512 Bacteria 18954
300 Ga0495610_0001986 3300046512 Bacteria 17459
301 Ga0495610_0003107 3300046512 Bacteria 13229
302 Ga0495648_0002141 3300046524 Bacteria 18596
303 Ga0495652_0223677 3300046529 Bacteria 1413
304 Ga0495609_0009319 3300046538 Bacteria 4755
305 Ga0495609_0025786 3300046538 Bacteria 2693
306 Ga0495633_0000014 3300046558 Bacteria 261742
307 Ga0495633_0007130 3300046558 Bacteria 6489
308 Ga0495668_0000003 3300046616 Bacteria 695023
309 Ga0495668_0000097 3300046616 Bacteria 139246
310 Ga0495625_0000030 3300046660 Bacteria 241164
311 Ga0495625_0001288 3300046660 Bacteria 31494
312 Ga0495625_0004675 3300046660 Bacteria 12858
313 Ga0495625_0025600 3300046660 Bacteria 4473
314 Ga0495625_0071344 3300046660 Bacteria 2437
315 Ga0495625_0082802 3300046660 Bacteria 2231
316 Ga0495661_0001572 3300046665 Bacteria 18804
317 Ga0495661_0002192 3300046665 Bacteria 15261
318 Ga0495661_0072756 3300046665 Bacteria 2005
319 Ga0495649_0000041 3300046694 Bacteria 125049
320 Ga0495660_0009137 3300046810 Bacteria 5788
321 Ga0495687_003937 3300047443 Bacteria 10395
322 Ga0495687_004442 3300047443 Bacteria 9466
323 Ga0495673_0110939 3300047469 Bacteria 1097
324 Ga0495686_0000261 3300047472 Bacteria 94540
325 Ga0495686_0000693 3300047472 Bacteria 45522
326 Ga0495686_0032986 3300047472 Bacteria 3346
327 Ga0495686_0038892 3300047472 Bacteria 3041
328 Ga0496110_0244838 3300048913 Bacteria 1632
329 Ga0496116_0003340 3300048919 Bacteria 15929
330 Ga0496117_0003154 3300048920 Bacteria 19642
331 Ga0496118_0046513 3300048921 Bacteria 3375
332 Ga0496122_0000746 3300048925 Bacteria 63466
333 Ga0496122_0016284 3300048925 Bacteria 7051
334 Ga0496123_0023476 3300048926 Bacteria 4719
335 Ga0496123_0139437 3300048926 Bacteria 1328
336 Ga0496124_0149018 3300048927 Bacteria 1838
337 Ga0495678_018374 3300049459 Bacteria 3146
338 Ga0501031_0000027 3300049568 Bacteria 82829
339 Ga0501032_0011557 3300049569 Bacteria 6335
340 Ga0501032_0197255 3300049569 Bacteria 1314
341 Ga0501033_0001059 3300049570 Bacteria 25159
342 Ga0501034_0000478 3300049571 Bacteria 65873
343 Ga0501034_0107554 3300049571 Bacteria 2781
344 Ga0501036_0016588 3300049572 Bacteria 6151
345 Ga0501037_0012194 3300049573 Bacteria 6326
346 Ga0501038_0006275 3300049574 Bacteria 10991
347 Ga0501038_0033317 3300049574 Bacteria 4539
348 Ga0501039_0003216 3300049575 Bacteria 12220
349 Ga0501043_0006853 3300049579 Bacteria 9095
350 Ga0501223_000301 3300049663 Bacteria 12355
351 Ga0501241_001567 3300049758 Bacteria 4592
352 Ga0501269_001859 3300049766 Bacteria 2676
353 Ga0501269_011479 3300049766 Bacteria 1079
354 Ga0501035_0002061 3300049822 Bacteria 20002
355 Ga0501035_0037779 3300049822 Bacteria 4371
356 Ga0501044_0000474 3300049823 Bacteria 48955
357 Ga0501045_0004131 3300049824 Bacteria 10031
358 nmdc:mga0k408_108042_c1 3300050493 Bacteria 1643
359 nmdc:mga0k408_472_c2 3300050493 Bacteria 13941
360 nmdc:mga0k408_839_c1 3300050493 Bacteria 16953
361 Ga0500635_0021893 3300053080 Bacteria 1975
362 Ga0500651_0000127 3300053093 Bacteria 47010
363 Ga0500556_0024363 3300053104 Bacteria 1987
364 Ga0500608_009485 3300053122 Bacteria 4137
365 Ga0500618_000001 3300053125 Bacteria 538477
366 Ga0500618_015245 3300053125 Bacteria 1945
367 Ga0500616_0039719 3300053153 Unclassified 2535
368 Ga0500622_0002413 3300053156 Bacteria 13503
369 Ga0500624_000420 3300053157 Bacteria 12986
370 Ga0500645_036976 3300053730 Bacteria 1451

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025927 Ga0207687_10121453 Ga0207687_101214533 270
2 3300003320 rootH2_10005719 rootH2_1000571923 286
3 3300031251 Ga0265327_10018318 Ga0265327_100183183 286
4 iso_pu_bacteria 2599185184 2599478020 286
5 iso_pu_bacteria 2721755487 2722730332 286
6 iso_pu_bacteria 2738541283 2738755045 286
7 iso_pu_bacteria 2738541284 2738760988 286
8 iso_pu_bacteria 2738541302 2738853754 286
9 iso_pu_bacteria 2738543023 2739301199 286
10 iso_pu_bacteria 2739367651 2739588597 286
11 iso_pu_bacteria 2739367656 2739615905 286
12 iso_pu_bacteria 2775506987 2776613174 286
13 iso_pu_bacteria 2818991437 2819549819 286
14 iso_pu_bacteria 2842722452 2842723736 286
15 iso_pu_bacteria 2842903701 2842906524 286
16 iso_pu_bacteria 2842909656 2842910242 286
17 iso_pu_bacteria 2849281842 2849285266 286
18 iso_pu_bacteria 2852623160 2852623576 286
19 iso_pu_bacteria 2852627209 2852631324 286
20 iso_pu_bacteria 2857627736 2857628938 286
21 iso_pu_bacteria 2884933994 2884937522 286
22 iso_pu_bacteria 2890737413 2890738646 286
23 iso_pu_bacteria 2896317667 2896319888 286
24 iso_pu_bacteria 2896344016 2896345092 286
25 iso_pu_bacteria 2898713307 2898715708 286
26 iso_pu_bacteria 2902048731 2902048819 286
27 iso_pu_bacteria 2904445276 2904445878 286
28 iso_pu_bacteria 2904780799 2904783960 286
29 iso_pu_bacteria 2911138879 2911142170 286
30 iso_pu_bacteria 2919177583 2919181898 286
31 iso_pu_bacteria 2919186247 2919187237 286
32 iso_pu_bacteria 2919437846 2919440969 286
33 iso_pu_bacteria 2928078545 2928079981 286
34 iso_pu_bacteria 2928147474 2928147562 286
35 iso_pu_bacteria 2932082852 2932083894 286
36 iso_pu_bacteria 2939664404 2939665494 286
37 iso_pu_bacteria 2954016120 2954017474 286
38 iso_pu_bacteria 2977232053 2977232697 286
39 iso_pu_bacteria 3003233435 3003233613 286
40 iso_pu_bacteria 8055588893 8055589356 286
41 iso_pu_bacteria 2910245624 2910248722 288
42 3300005563 Ga0068855_100000073 Ga0068855_10000007328 289
43 3300009093 Ga0105240_10395632 Ga0105240_103956322 289
44 3300025949 Ga0207667_10000009 Ga0207667_10000009170 289
45 3300046558 Ga0495633_0007130 Ga0495633_0007130_4749_5627 289
46 3300049568 Ga0501031_0000027 Ga0501031_0000027_34990_35877 289
47 3300049569 Ga0501032_0011557 Ga0501032_0011557_2798_3685 289
48 3300049569 Ga0501032_0197255 Ga0501032_0197255_132_1019 289
49 3300049570 Ga0501033_0001059 Ga0501033_0001059_19569_20456 289
50 3300049571 Ga0501034_0000478 Ga0501034_0000478_22337_23224 289
51 3300049571 Ga0501034_0107554 Ga0501034_0107554_1154_2035 289
52 3300049572 Ga0501036_0016588 Ga0501036_0016588_3864_4751 289
53 3300049573 Ga0501037_0012194 Ga0501037_0012194_4547_5434 289
54 3300049574 Ga0501038_0006275 Ga0501038_0006275_5319_6206 289
55 3300049574 Ga0501038_0033317 Ga0501038_0033317_43_924 289
56 3300049575 Ga0501039_0003216 Ga0501039_0003216_8925_9812 289
57 3300049579 Ga0501043_0006853 Ga0501043_0006853_4747_5634 289
58 3300049822 Ga0501035_0002061 Ga0501035_0002061_4686_5573 289
59 3300049823 Ga0501044_0000474 Ga0501044_0000474_46292_47179 289
60 3300049824 Ga0501045_0004131 Ga0501045_0004131_1898_2785 289
61 2162886007 SwRhRL2b_contig_1762462 SwRhRL2b_0592.00003890 290
62 2162886007 SwRhRL2b_contig_2513460 SwRhRL2b_0966.00006330 290
63 3300001904 JGI24736J21556_1011425 JGI24736J21556_10114252 290
64 3300001979 JGI24740J21852_10004599 JGI24740J21852_100045994 290
65 3300001989 JGI24739J22299_10000727 JGI24739J22299_100007278 290
66 3300001989 JGI24739J22299_10004833 JGI24739J22299_100048336 290
67 3300001990 JGI24737J22298_10001479 JGI24737J22298_100014797 290
68 3300001990 JGI24737J22298_10007867 JGI24737J22298_100078673 290
69 3300001990 JGI24737J22298_10057413 JGI24737J22298_100574131 290
70 3300002067 JGI24735J21928_10000012 JGI24735J21928_1000001210 290
71 3300002737 JGI25162J39368_1000062 JGI25162J39368_1000062117 290
72 3300002737 JGI25162J39368_1002467 JGI25162J39368_10024677 290
73 3300002772 JGI25164J39214_1001275 JGI25164J39214_10012754 290
74 3300002773 JGI25152J39213_1000305 JGI25152J39213_100030530 290
75 3300002774 JGI25150J39212_1000009 JGI25150J39212_1000009220 290
76 3300003187 JGI25151J46595_10000017 JGI25151J46595_10000017220 290
77 3300003214 JGI25165J46597_1000378 JGI25165J46597_100037824 290
78 3300003215 JGI25153J46596_10000023 JGI25153J46596_1000002319 290
79 3300003316 rootH1_10007370 rootH1_100073708 290
80 3300003320 rootH2_10010950 rootH2_100109503 290
81 3300003320 rootH2_10218944 rootH2_102189442 290
82 3300003320 rootH2_10252965 rootH2_102529652 290
83 3300003323 rootH1_10012846 rootH1_1001284637 290
84 3300003323 rootH1_10203933 rootH1_102039332 290
85 3300003323 rootH1_10212159 rootH1_102121591 290
86 3300003781 Ga0055536_1000011 Ga0055536_1000011162 290
87 3300003791 Ga0055530_10003662 Ga0055530_100036623 290
88 3300004799 Ga0058863_11910999 Ga0058863_119109992 290
89 3300004800 Ga0058861_11784620 Ga0058861_117846201 290
90 3300004803 Ga0058862_12768823 Ga0058862_127688232 290
91 3300005288 Ga0065714_10003657 Ga0065714_1000365719 290
92 3300005288 Ga0065714_10010842 Ga0065714_100108422 290
93 3300005288 Ga0065714_10064476 Ga0065714_1006447613 290
94 3300005288 Ga0065714_10064664 Ga0065714_100646646 290
95 3300005288 Ga0065714_10064897 Ga0065714_1006489712 290
96 3300005288 Ga0065714_10078069 Ga0065714_100780692 290
97 3300005288 Ga0065714_10090265 Ga0065714_100902652 290
98 3300005288 Ga0065714_10092029 Ga0065714_100920292 290
99 3300005289 Ga0065704_10000193 Ga0065704_1000019354 290
100 3300005289 Ga0065704_10076570 Ga0065704_100765702 290
101 3300005327 Ga0070658_10000026 Ga0070658_1000002624 290
102 3300005327 Ga0070658_10077256 Ga0070658_100772562 290
103 3300005327 Ga0070658_10113242 Ga0070658_101132422 290
104 3300005327 Ga0070658_10162978 Ga0070658_101629782 290
105 3300005328 Ga0070676_10003219 Ga0070676_100032196 290
106 3300005329 Ga0070683_100009979 Ga0070683_1000099796 290
107 3300005341 Ga0070691_10211073 Ga0070691_102110731 290
108 3300005355 Ga0070671_100020069 Ga0070671_1000200693 290
109 3300005366 Ga0070659_100001374 Ga0070659_10000137414 290
110 3300005366 Ga0070659_100004503 Ga0070659_1000045035 290
111 3300005366 Ga0070659_100041745 Ga0070659_1000417453 290
112 3300005455 Ga0070663_100041975 Ga0070663_1000419754 290
113 3300005457 Ga0070662_100000019 Ga0070662_10000001952 290
114 3300005530 Ga0070679_100200313 Ga0070679_1002003132 290
115 3300005530 Ga0070679_100284276 Ga0070679_1002842761 290
116 3300005539 Ga0068853_100211422 Ga0068853_1002114223 290
117 3300005548 Ga0070665_100000003 Ga0070665_100000003751 290
118 3300005563 Ga0068855_100000134 Ga0068855_10000013415 290
119 3300005563 Ga0068855_100030360 Ga0068855_1000303602 290
120 3300005563 Ga0068855_100055159 Ga0068855_1000551592 290
121 3300005563 Ga0068855_100164599 Ga0068855_1001645991 290
122 3300005563 Ga0068855_100298588 Ga0068855_1002985883 290
123 3300005563 Ga0068855_100452135 Ga0068855_1004521352 290
124 3300005577 Ga0068857_100085880 Ga0068857_1000858802 290
125 3300005614 Ga0068856_100000078 Ga0068856_1000000783 290
126 3300005614 Ga0068856_100002592 Ga0068856_1000025927 290
127 3300005614 Ga0068856_100053977 Ga0068856_1000539776 290
128 3300005614 Ga0068856_100226785 Ga0068856_1002267851 290
129 3300005616 Ga0068852_100024720 Ga0068852_1000247202 290
130 3300005840 Ga0068870_10209113 Ga0068870_102091131 290
131 3300006195 Ga0075366_10000928 Ga0075366_1000092811 290
132 3300006195 Ga0075366_10002537 Ga0075366_100025375 290
133 3300006237 Ga0097621_100000507 Ga0097621_10000050721 290
134 3300006358 Ga0068871_100066989 Ga0068871_1000669892 290
135 3300009093 Ga0105240_10000040 Ga0105240_1000004062 290
136 3300009093 Ga0105240_10000221 Ga0105240_100002213 290
137 3300009093 Ga0105240_10006461 Ga0105240_1000646110 290
138 3300009093 Ga0105240_10010194 Ga0105240_100101949 290
139 3300009093 Ga0105240_10113807 Ga0105240_101138072 290
140 3300009093 Ga0105240_10473241 Ga0105240_104732411 290
141 3300009093 Ga0105240_10751100 Ga0105240_107511001 290
142 3300009098 Ga0105245_10044779 Ga0105245_100447792 290
143 3300009098 Ga0105245_10493167 Ga0105245_104931672 290
144 3300009148 Ga0105243_10000006 Ga0105243_100000067 290
145 3300009148 Ga0105243_10086634 Ga0105243_100866344 290
146 3300009174 Ga0105241_10000812 Ga0105241_100008126 290
147 3300009174 Ga0105241_10013149 Ga0105241_100131495 290
148 3300009174 Ga0105241_10034170 Ga0105241_100341702 290
149 3300009174 Ga0105241_10114393 Ga0105241_101143932 290
150 3300009177 Ga0105248_10793456 Ga0105248_107934561 290
151 3300009545 Ga0105237_10000689 Ga0105237_100006898 290
152 3300009545 Ga0105237_10002671 Ga0105237_100026713 290
153 3300009545 Ga0105237_10003562 Ga0105237_1000356214 290
154 3300009545 Ga0105237_10006737 Ga0105237_1000673710 290
155 3300009545 Ga0105237_10038298 Ga0105237_100382984 290
156 3300009545 Ga0105237_10057165 Ga0105237_100571652 290
157 3300009545 Ga0105237_10068929 Ga0105237_100689292 290
158 3300009545 Ga0105237_10070137 Ga0105237_100701373 290
159 3300009545 Ga0105237_10150038 Ga0105237_101500382 290
160 3300010375 Ga0105239_10000002 Ga0105239_10000002409 290
161 3300010375 Ga0105239_10000133 Ga0105239_1000013337 290
162 3300010375 Ga0105239_10000255 Ga0105239_100002552 290
163 3300010375 Ga0105239_10004813 Ga0105239_100048136 290
164 3300010375 Ga0105239_10009996 Ga0105239_100099963 290
165 3300010375 Ga0105239_10035892 Ga0105239_100358924 290
166 3300010375 Ga0105239_10039238 Ga0105239_100392381 290
167 3300013100 Ga0157373_10000136 Ga0157373_100001366 290
168 3300013100 Ga0157373_10000265 Ga0157373_1000026521 290
169 3300013100 Ga0157373_10005191 Ga0157373_100051918 290
170 3300013100 Ga0157373_10030207 Ga0157373_100302071 290
171 3300013102 Ga0157371_10000688 Ga0157371_1000068812 290
172 3300013102 Ga0157371_10002673 Ga0157371_1000267314 290
173 3300013102 Ga0157371_10004644 Ga0157371_100046446 290
174 3300013102 Ga0157371_10005582 Ga0157371_1000558211 290
175 3300013102 Ga0157371_10007420 Ga0157371_100074206 290
176 3300013102 Ga0157371_10027602 Ga0157371_100276023 290
177 3300013104 Ga0157370_10008391 Ga0157370_100083914 290
178 3300013104 Ga0157370_10021959 Ga0157370_100219594 290
179 3300013104 Ga0157370_10103553 Ga0157370_101035532 290
180 3300013104 Ga0157370_10106218 Ga0157370_101062182 290
181 3300013104 Ga0157370_10120877 Ga0157370_101208772 290
182 3300013104 Ga0157370_10464410 Ga0157370_104644102 290
183 3300013104 Ga0157370_10565955 Ga0157370_105659552 290
184 3300013105 Ga0157369_10000006 Ga0157369_10000006347 290
185 3300013105 Ga0157369_10000805 Ga0157369_1000080517 290
186 3300013105 Ga0157369_10065196 Ga0157369_100651964 290
187 3300013105 Ga0157369_10087821 Ga0157369_100878212 290
188 3300013296 Ga0157374_10001037 Ga0157374_100010376 290
189 3300013297 Ga0157378_10030032 Ga0157378_100300324 290
190 3300013297 Ga0157378_10032302 Ga0157378_100323022 290
191 3300013297 Ga0157378_10071751 Ga0157378_100717512 290
192 3300013297 Ga0157378_10081725 Ga0157378_100817252 290
193 3300013297 Ga0157378_10179154 Ga0157378_101791542 290
194 3300013306 Ga0163162_10000930 Ga0163162_1000093015 290
195 3300013306 Ga0163162_10008205 Ga0163162_100082054 290
196 3300013306 Ga0163162_10008828 Ga0163162_100088282 290
197 3300013307 Ga0157372_10000001 Ga0157372_10000001142 290
198 3300013307 Ga0157372_10000118 Ga0157372_1000011870 290
199 3300013307 Ga0157372_10002637 Ga0157372_100026372 290
200 3300013307 Ga0157372_10008206 Ga0157372_100082068 290
201 3300013307 Ga0157372_10009254 Ga0157372_1000925412 290
202 3300013307 Ga0157372_10013033 Ga0157372_100130333 290
203 3300013307 Ga0157372_10066806 Ga0157372_100668064 290
204 3300013308 Ga0157375_10029409 Ga0157375_100294092 290
205 3300013308 Ga0157375_10171445 Ga0157375_101714452 290
206 3300014326 Ga0157380_10000103 Ga0157380_1000010328 290
207 3300014497 Ga0182008_10000018 Ga0182008_10000018147 290
208 3300014497 Ga0182008_10000432 Ga0182008_1000043216 290
209 3300014497 Ga0182008_10000524 Ga0182008_100005243 290
210 3300014497 Ga0182008_10047317 Ga0182008_100473172 290
211 3300014497 Ga0182008_10057461 Ga0182008_100574613 290
212 3300014497 Ga0182008_10105151 Ga0182008_101051512 290
213 3300015261 Ga0182006_1000115 Ga0182006_100011566 290
214 3300015261 Ga0182006_1000382 Ga0182006_100038222 290
215 3300015261 Ga0182006_1002221 Ga0182006_10022218 290
216 3300015262 Ga0182007_10000001 Ga0182007_10000001296 290
217 3300015262 Ga0182007_10020064 Ga0182007_100200642 290
218 3300015682 Ga0183373_1006 Ga0183373_1006206 290
219 3300017792 Ga0163161_10000153 Ga0163161_1000015353 290
220 3300017792 Ga0163161_10001740 Ga0163161_100017408 290
221 3300017792 Ga0163161_10002015 Ga0163161_100020158 290
222 3300017792 Ga0163161_10006269 Ga0163161_100062692 290
223 3300017792 Ga0163161_10324979 Ga0163161_103249791 290
224 3300025231 Ga0207427_100217 Ga0207427_10021726 290
225 3300025233 Ga0209437_100052 Ga0209437_100052290 290
226 3300025233 Ga0209437_100177 Ga0209437_100177116 290
227 3300025245 Ga0207425_1000007 Ga0207425_1000007336 290
228 3300025250 Ga0209026_1000552 Ga0209026_10005526 290
229 3300025250 Ga0209026_1003671 Ga0209026_10036712 290
230 3300025250 Ga0209026_1009767 Ga0209026_10097672 290
231 3300025258 Ga0209129_1000006 Ga0209129_1000006336 290
232 3300025258 Ga0209129_1006370 Ga0209129_10063702 290
233 3300025261 Ga0209233_1000067 Ga0209233_1000067290 290
234 3300025261 Ga0209233_1001976 Ga0209233_10019767 290
235 3300025292 Ga0209676_1000001 Ga0209676_1000001791 290
236 3300025294 Ga0209025_1000025 Ga0209025_1000025166 290
237 3300025297 Ga0209758_1000016 Ga0209758_1000016336 290
238 3300025298 Ga0209050_1000016 Ga0209050_1000016457 290
239 3300025904 Ga0207647_10000042 Ga0207647_1000004228 290
240 3300025904 Ga0207647_10000296 Ga0207647_1000029625 290
241 3300025907 Ga0207645_10007029 Ga0207645_100070295 290
242 3300025908 Ga0207643_10203882 Ga0207643_102038821 290
243 3300025909 Ga0207705_10000040 Ga0207705_10000040114 290
244 3300025911 Ga0207654_10002044 Ga0207654_100020446 290
245 3300025911 Ga0207654_10003470 Ga0207654_100034706 290
246 3300025913 Ga0207695_10000041 Ga0207695_10000041177 290
247 3300025913 Ga0207695_10000189 Ga0207695_10000189108 290
248 3300025913 Ga0207695_10020814 Ga0207695_100208143 290
249 3300025913 Ga0207695_10033065 Ga0207695_100330653 290
250 3300025913 Ga0207695_10057391 Ga0207695_100573912 290
251 3300025913 Ga0207695_10064491 Ga0207695_100644912 290
252 3300025913 Ga0207695_10172737 Ga0207695_101727372 290
253 3300025913 Ga0207695_10510927 Ga0207695_105109271 290
254 3300025914 Ga0207671_10002083 Ga0207671_1000208324 290
255 3300025914 Ga0207671_10005781 Ga0207671_100057816 290
256 3300025914 Ga0207671_10008482 Ga0207671_100084823 290
257 3300025914 Ga0207671_10012299 Ga0207671_100122996 290
258 3300025914 Ga0207671_10019403 Ga0207671_100194035 290
259 3300025914 Ga0207671_10091753 Ga0207671_100917532 290
260 3300025914 Ga0207671_10419326 Ga0207671_104193261 290
261 3300025921 Ga0207652_10067309 Ga0207652_100673092 290
262 3300025927 Ga0207687_10306558 Ga0207687_103065582 290
263 3300025931 Ga0207644_10015002 Ga0207644_100150023 290
264 3300025932 Ga0207690_10013269 Ga0207690_100132694 290
265 3300025932 Ga0207690_10057099 Ga0207690_100570992 290
266 3300025933 Ga0207706_10000058 Ga0207706_1000005852 290
267 3300025935 Ga0207709_10000007 Ga0207709_10000007248 290
268 3300025935 Ga0207709_10175236 Ga0207709_101752362 290
269 3300025938 Ga0207704_10000081 Ga0207704_1000008111 290
270 3300025949 Ga0207667_10036205 Ga0207667_100362052 290
271 3300025949 Ga0207667_10197620 Ga0207667_101976203 290
272 3300026041 Ga0207639_10172573 Ga0207639_101725733 290
273 3300026041 Ga0207639_10262390 Ga0207639_102623902 290
274 3300026078 Ga0207702_10004045 Ga0207702_100040459 290
275 3300026078 Ga0207702_10005005 Ga0207702_100050059 290
276 3300026078 Ga0207702_10038772 Ga0207702_100387722 290
277 3300026089 Ga0207648_10001742 Ga0207648_1000174213 290
278 3300026116 Ga0207674_10091100 Ga0207674_100911002 290
279 3300026116 Ga0207674_10331829 Ga0207674_103318292 290
280 3300026142 Ga0207698_10106306 Ga0207698_101063061 290
281 3300028379 Ga0268266_10000018 Ga0268266_1000001871 290
282 3300028379 Ga0268266_10007077 Ga0268266_100070777 290
283 3300028653 Ga0265323_10000365 Ga0265323_1000036521 290
284 3300028786 Ga0307517_10028463 Ga0307517_100284632 290
285 3300028794 Ga0307515_10000223 Ga0307515_1000022346 290
286 3300028794 Ga0307515_10001312 Ga0307515_1000131228 290
287 3300028794 Ga0307515_10143627 Ga0307515_101436272 290
288 3300028800 Ga0265338_10003003 Ga0265338_100030039 290
289 3300028800 Ga0265338_10089219 Ga0265338_100892192 290
290 3300030732 Ga0316176_1196368 Ga0316176_11963686 290
291 3300030742 Ga0316183_1118483 Ga0316183_111848318 290
292 3300030744 Ga0316181_1040473 Ga0316181_10404734 290
293 3300031251 Ga0265327_10000010 Ga0265327_10000010369 290
294 3300031251 Ga0265327_10000692 Ga0265327_1000069219 290
295 3300031251 Ga0265327_10038039 Ga0265327_100380392 290
296 3300031344 Ga0265316_10001810 Ga0265316_100018103 290
297 3300031548 Ga0307408_100000608 Ga0307408_10000060817 290
298 3300031548 Ga0307408_100000629 Ga0307408_10000062919 290
299 3300031548 Ga0307408_100000729 Ga0307408_10000072912 290
300 3300031711 Ga0265314_10081982 Ga0265314_100819821 290
301 3300031712 Ga0265342_10119525 Ga0265342_101195252 290
302 3300031731 Ga0307405_10000010 Ga0307405_1000001052 290
303 3300031911 Ga0307412_10000077 Ga0307412_1000007735 290
304 3300031911 Ga0307412_10003271 Ga0307412_100032713 290
305 3300031911 Ga0307412_10039882 Ga0307412_100398822 290
306 3300031911 Ga0307412_10208257 Ga0307412_102082573 290
307 3300032002 Ga0307416_100000019 Ga0307416_10000001920 290
308 3300032004 Ga0307414_10003957 Ga0307414_1000395711 290
309 3300032004 Ga0307414_10010061 Ga0307414_100100616 290
310 3300032004 Ga0307414_10051278 Ga0307414_100512782 290
311 3300032004 Ga0307414_10055217 Ga0307414_100552173 290
312 3300032004 Ga0307414_10127865 Ga0307414_101278652 290
313 3300032004 Ga0307414_10176845 Ga0307414_101768452 290
314 3300032005 Ga0307411_10183265 Ga0307411_101832652 290
315 3300033179 Ga0307507_10000170 Ga0307507_1000017038 290
316 3300033180 Ga0307510_10036368 Ga0307510_100363686 290
317 3300037312 Ga0395899_0000001 Ga0395899_0000001_1569139_1570020 290
318 3300037312 Ga0395899_0000232 Ga0395899_0000232_24380_25264 290
319 3300037312 Ga0395899_0001028 Ga0395899_0001028_11067_11951 290
320 3300037312 Ga0395899_0006889 Ga0395899_0006889_4672_5553 290
321 3300037418 Ga0395900_0001746 Ga0395900_0001746_10630_11514 290
322 3300037418 Ga0395900_0002099 Ga0395900_0002099_9648_10529 290
323 3300037418 Ga0395900_0003255 Ga0395900_0003255_6366_7247 290
324 3300037418 Ga0395900_0195121 Ga0395900_0195121_136_1017 290
325 3300037466 Ga0395898_0013319 Ga0395898_0013319_919_1803 290
326 3300037466 Ga0395898_0229578 Ga0395898_0229578_671_1552 290
327 3300037471 Ga0395905_0001641 Ga0395905_0001641_7298_8179 290
328 3300037471 Ga0395905_0152145 Ga0395905_0152145_51_935 290
329 3300038443 Ga0395901_0000794 Ga0395901_0000794_8053_8937 290
330 3300038443 Ga0395901_0004908 Ga0395901_0004908_2607_3488 290
331 3300039062 Ga0400483_096702 Ga0400483_096702_625_1497 290
332 3300039447 Ga0436361_1086342 Ga0436361_1086342_109_990 290
333 3300042005 Ga0439448_0001802 Ga0439448_0001802_3772_4653 290
334 3300042876 Ga0451577_0107671 Ga0451577_0107671_1468_2349 290
335 3300042876 Ga0451577_0123654 Ga0451577_0123654_525_1472 290
336 3300042876 Ga0451577_0164765 Ga0451577_0164765_602_1522 290
337 3300042876 Ga0451577_0202478 Ga0451577_0202478_858_1736 290
338 3300044673 Ga0453683_0046148 Ga0453683_0046148_542_1417 290
339 3300044712 Ga0453684_0002871 Ga0453684_0002871_605_1486 290
340 3300044712 Ga0453684_0002943 Ga0453684_0002943_3165_4046 290
341 3300044712 Ga0453684_0005368 Ga0453684_0005368_3393_4274 290
342 3300044712 Ga0453684_0024118 Ga0453684_0024118_1873_2766 290
343 3300044712 Ga0453684_0248672 Ga0453684_0248672_810_1700 290
344 3300044765 Ga0466970_0013164 Ga0466970_0013164_1872_2744 290
345 3300046471 Ga0495650_0000013 Ga0495650_0000013_530661_531542 290
346 3300046492 Ga0495585_0000651 Ga0495585_0000651_4227_5108 290
347 3300046492 Ga0495585_0001040 Ga0495585_0001040_61_942 290
348 3300046507 Ga0495606_0000002 Ga0495606_0000002_89196_90077 290
349 3300046507 Ga0495606_0076888 Ga0495606_0076888_965_1846 290
350 3300046507 Ga0495606_0082819 Ga0495606_0082819_427_1308 290
351 3300046507 Ga0495606_0122980 Ga0495606_0122980_628_1509 290
352 3300046512 Ga0495610_0001760 Ga0495610_0001760_7289_8170 290
353 3300046512 Ga0495610_0001986 Ga0495610_0001986_14892_15773 290
354 3300046512 Ga0495610_0003107 Ga0495610_0003107_8290_9171 290
355 3300046524 Ga0495648_0002141 Ga0495648_0002141_17055_17936 290
356 3300046529 Ga0495652_0223677 Ga0495652_0223677_156_1037 290
357 3300046538 Ga0495609_0009319 Ga0495609_0009319_74_955 290
358 3300046538 Ga0495609_0025786 Ga0495609_0025786_1755_2636 290
359 3300046558 Ga0495633_0000014 Ga0495633_0000014_131423_132304 290
360 3300046616 Ga0495668_0000003 Ga0495668_0000003_518880_519761 290
361 3300046616 Ga0495668_0000097 Ga0495668_0000097_68763_69635 290
362 3300046660 Ga0495625_0000030 Ga0495625_0000030_160276_161157 290
363 3300046660 Ga0495625_0001288 Ga0495625_0001288_7017_7898 290
364 3300046660 Ga0495625_0004675 Ga0495625_0004675_8018_8899 290
365 3300046660 Ga0495625_0025600 Ga0495625_0025600_609_1490 290
366 3300046660 Ga0495625_0071344 Ga0495625_0071344_1546_2427 290
367 3300046660 Ga0495625_0082802 Ga0495625_0082802_229_1110 290
368 3300046665 Ga0495661_0001572 Ga0495661_0001572_5178_6059 290
369 3300046665 Ga0495661_0002192 Ga0495661_0002192_9856_10737 290
370 3300046665 Ga0495661_0072756 Ga0495661_0072756_656_1540 290
371 3300046694 Ga0495649_0000041 Ga0495649_0000041_80037_80918 290
372 3300046810 Ga0495660_0009137 Ga0495660_0009137_1760_2641 290
373 3300047443 Ga0495687_003937 Ga0495687_003937_1325_2206 290
374 3300047443 Ga0495687_004442 Ga0495687_004442_5292_6173 290
375 3300047469 Ga0495673_0110939 Ga0495673_0110939_31_912 290
376 3300047472 Ga0495686_0000261 Ga0495686_0000261_76582_77454 290
377 3300047472 Ga0495686_0000693 Ga0495686_0000693_20761_21642 290
378 3300047472 Ga0495686_0032986 Ga0495686_0032986_230_1111 290
379 3300047472 Ga0495686_0038892 Ga0495686_0038892_1495_2376 290
380 3300048913 Ga0496110_0244838 Ga0496110_0244838_685_1563 290
381 3300048919 Ga0496116_0003340 Ga0496116_0003340_9855_10742 290
382 3300048920 Ga0496117_0003154 Ga0496117_0003154_10934_11821 290
383 3300048921 Ga0496118_0046513 Ga0496118_0046513_1763_2650 290
384 3300048925 Ga0496122_0000746 Ga0496122_0000746_8829_9710 290
385 3300048925 Ga0496122_0016284 Ga0496122_0016284_4568_5455 290
386 3300048926 Ga0496123_0023476 Ga0496123_0023476_3800_4687 290
387 3300048926 Ga0496123_0139437 Ga0496123_0139437_130_1011 290
388 3300048927 Ga0496124_0149018 Ga0496124_0149018_495_1382 290
389 3300049459 Ga0495678_018374 Ga0495678_018374_638_1519 290
390 3300049663 Ga0501223_000301 Ga0501223_000301_7361_8242 290
391 3300049758 Ga0501241_001567 Ga0501241_001567_1752_2630 290
392 3300049766 Ga0501269_001859 Ga0501269_001859_399_1271 290
393 3300049766 Ga0501269_011479 Ga0501269_011479_197_1069 290
394 3300049822 Ga0501035_0037779 Ga0501035_0037779_2148_3035 290
395 3300050493 nmdc:mga0k408_108042_c1 nmdc:mga0k408_108042_c1_671_1552 290
396 3300050493 nmdc:mga0k408_472_c2 nmdc:mga0k408_472_c2_615_1496 290
397 3300050493 nmdc:mga0k408_839_c1 nmdc:mga0k408_839_c1_2879_3760 290
398 3300053080 Ga0500635_0021893 Ga0500635_0021893_916_1797 290
399 3300053093 Ga0500651_0000127 Ga0500651_0000127_39564_40445 290
400 3300053104 Ga0500556_0024363 Ga0500556_0024363_181_1053 290
401 3300053122 Ga0500608_009485 Ga0500608_009485_1431_2312 290
402 3300053125 Ga0500618_000001 Ga0500618_000001_218422_219303 290
403 3300053125 Ga0500618_015245 Ga0500618_015245_1015_1896 290
404 3300053153 Ga0500616_0039719 Ga0500616_0039719_543_1415 290
405 3300053156 Ga0500622_0002413 Ga0500622_0002413_529_1410 290
406 3300053157 Ga0500624_000420 Ga0500624_000420_5875_6756 290
407 3300053730 Ga0500645_036976 Ga0500645_036976_296_1177 290
408 iso_pu_bacteria 2585427687 2586207406 290
409 iso_pu_bacteria 2739367663 2739644996 290
410 iso_pu_bacteria 2945997725 2946000416 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00763

THF_DHG_CYH

Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain

4

119

0.98

PF02882

THF_DHG_CYH_C

Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

122

287

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v6y-assembly1.cif.gz_A-2 crystal structure of t. thermophilus methylenetetrahydrofolate dehydrogenase (mthfd) 0.9702 2 288
6de8-assembly1.cif.gz_A crystal structure of bifunctional enzyme fold-methylenetetrahydrofolate dehydrogenase/cyclohydrolase from campylobacter jejuni 0.9659 1 288
3l07-assembly1.cif.gz_A methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. 0.9638 1 288
6s4f-assembly1.cif.gz_B structure of human mthfd2 in complex with th9619 0.962 2 288
6ape-assembly1.cif.gz_A crystal structure of bifunctional protein fold from helicobacter pylori 0.9598 3 288
ID Description Score Start End Superfamily
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9936 32 112 3.40.50.10860
3l07A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9895 31 113 3.40.50.10860
af_K7KYI8_1_78_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9878 30 101 3.40.50.720
af_Q04448_12_107_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.986 5 100 3.30.420.40
af_A0A0R0F3H3_60_174_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9835 12 123 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A351V733-F1-model_v4 methylenetetrahydrofolate dehydrogenase (NADP(+)) (EC 1.5.1.5) 0.9955 45 154 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A1G9S0E9-F1-model_v4 Bifunctional protein FolD [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] 0.9952 1 288 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A2A5FPY2-F1-model_v4 Bifunctional protein FolD [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] 0.9947 2 288 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-R7HNX3-F1-model_v4 Bifunctional protein FolD [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] 0.9945 1 288 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-F9D1E8-F1-model_v4 Bifunctional protein FolD [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] 0.9943 2 288 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999

Feature Viewer

pLDDT pTM Quality
95.73 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map