F437337

General Info

Members Datasets Scaffolds Average Seq Length
410 238 820 395

Family's Representative Sequence

Representative Sequence 3300046476|Ga0495662_0039154|Ga0495662_0039154_680_1924
Length 414
Sequence MSVATRSRRARPESFSVKPGIAERLSLPYMDAALFLAAAALVALSVFVLSQTTRHDVPGDPGYYSNRQTIYAVLGIVGMYLLARVDYSRFRELRVGIYTFLCVSISLVFVFGFAARGSRRAFDLPFFSFQPSELGKLLLVLALAGFVIDGARRGSPRQRTVRYLCLGLAPAALVFLQPDLGTALVFGAITLAVMYVGGVPWTHFAVIGVALAALVALILVVAPAAHMPLLKSYQQERLTSFLNPSADPSDAGYQQNQAKTAIGAGEFSGRGDRATQTRLDFVPERHTDFIFAVIGERYGFMGAALVLSLYALLIWRALRIVTLSKNSYGMLVAGGIAAMLLFQVFVNVGMNLGIMPITGIPLPLMSYGGSSVLATFLAVGVLQSVHVQARLSQKGRLAWSPRTRPGDAYLTELS

Samples

Sample ID Description Type Environment
1 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
111 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
112 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
113 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
114 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
129 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
130 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
131 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
132 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
232 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
236 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
237 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
238 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.93
Nodule 0
Rhizoplane 12.44
Rhizosphere 80.49
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495662_0039154 3300046476 Bacteria 2290
2 JGI24746J21847_1000324 3300001977 Bacteria 6853
3 JGI24740J21852_10003899 3300001979 Bacteria 6475
4 JGI24034J26672_10000321 3300002239 Bacteria 6179
5 JGI25404J52841_10000379 3300003659 Bacteria 6074
6 Ga0070683_100016420 3300005329 Bacteria 6531
7 Ga0070683_100043999 3300005329 Bacteria 4117
8 Ga0070683_100088535 3300005329 Bacteria 2905
9 Ga0070683_100165254 3300005329 Bacteria 2100
10 Ga0070677_10000322 3300005333 Bacteria 16716
11 Ga0068869_100243350 3300005334 Bacteria 1434
12 Ga0070682_100000011 3300005337 Bacteria 266253
13 Ga0070682_100000030 3300005337 Bacteria 182768
14 Ga0070682_100049311 3300005337 Bacteria 2625
15 Ga0068868_100000445 3300005338 Bacteria 27750
16 Ga0068868_100002347 3300005338 Bacteria 13098
17 Ga0070691_10000270 3300005341 Bacteria 18137
18 Ga0070691_10008904 3300005341 Bacteria 4595
19 Ga0070675_100000028 3300005354 Bacteria 103914
20 Ga0070674_100000002 3300005356 Bacteria 271088
21 Ga0070674_100000004 3300005356 Bacteria 169446
22 Ga0070673_100004080 3300005364 Bacteria 9197
23 Ga0070688_100000251 3300005365 Bacteria 28262
24 Ga0070688_100000368 3300005365 Bacteria 22900
25 Ga0070667_100013105 3300005367 Bacteria 6853
26 Ga0070667_100075761 3300005367 Bacteria 2872
27 Ga0070667_100135683 3300005367 Bacteria 2151
28 Ga0070714_100035345 3300005435 Bacteria 4188
29 Ga0070663_100000065 3300005455 Bacteria 45157
30 Ga0070678_100168254 3300005456 Bacteria 1782
31 Ga0070662_100000006 3300005457 Bacteria 169366
32 Ga0070681_10004368 3300005458 Bacteria 13449
33 Ga0070681_10062304 3300005458 Bacteria 3703
34 Ga0068867_100008063 3300005459 Bacteria 7442
35 Ga0070685_10000053 3300005466 Bacteria 70868
36 Ga0070685_10000301 3300005466 Bacteria 31302
37 Ga0070685_10052845 3300005466 Bacteria 2352
38 Ga0070679_100000461 3300005530 Bacteria 34593
39 Ga0070679_100020836 3300005530 Bacteria 6395
40 Ga0070684_100048504 3300005535 Bacteria 3685
41 Ga0070684_100118311 3300005535 Bacteria 2381
42 Ga0070684_100186689 3300005535 Bacteria 1885
43 Ga0068853_100010340 3300005539 Bacteria 7548
44 Ga0070672_100000049 3300005543 Bacteria 52233
45 Ga0070693_100009223 3300005547 Bacteria 4902
46 Ga0070665_100000040 3300005548 Bacteria 305480
47 Ga0070665_100162333 3300005548 Bacteria 2236
48 Ga0070704_100049578 3300005549 Bacteria 2947
49 Ga0068855_100374582 3300005563 Bacteria 1564
50 Ga0070664_100072547 3300005564 Bacteria 2953
51 Ga0070664_100100239 3300005564 Bacteria 2518
52 Ga0068854_100025675 3300005578 Bacteria 4043
53 Ga0068854_100055889 3300005578 Bacteria 2844
54 Ga0068856_100000377 3300005614 Bacteria 48877
55 Ga0068856_100006911 3300005614 Bacteria 11099
56 Ga0068856_100016576 3300005614 Bacteria 7132
57 Ga0068852_100000539 3300005616 Bacteria 24879
58 Ga0068852_100129237 3300005616 Bacteria 2324
59 Ga0068852_100309271 3300005616 Bacteria 1532
60 Ga0068864_100000053 3300005618 Bacteria 133049
61 Ga0068866_10000004 3300005718 Bacteria 202810
62 Ga0068866_10000036 3300005718 Bacteria 51111
63 Ga0068851_10004698 3300005834 Bacteria 6176
64 Ga0068863_100000432 3300005841 Bacteria 42297
65 Ga0068863_100022480 3300005841 Bacteria 6022
66 Ga0068858_100000526 3300005842 Bacteria 40242
67 Ga0068858_100002599 3300005842 Bacteria 18181
68 Ga0068860_100001579 3300005843 Bacteria 24553
69 Ga0068860_100318189 3300005843 Bacteria 1527
70 Ga0068862_100013486 3300005844 Bacteria 6767
71 Ga0081540_1000129 3300005983 Bacteria 80446
72 Ga0081539_10002112 3300005985 Bacteria 29436
73 Ga0081539_10053708 3300005985 Bacteria 2254
74 Ga0075363_100057095 3300006048 Bacteria 2094
75 Ga0075364_10049918 3300006051 Bacteria 2729
76 Ga0075364_10063096 3300006051 Bacteria 2432
77 Ga0070715_10000014 3300006163 Bacteria 154272
78 Ga0070716_100014183 3300006173 Bacteria 4078
79 Ga0075433_10000051 3300006852 Bacteria 49800
80 Ga0075433_10004054 3300006852 Bacteria 11346
81 Ga0068865_100000042 3300006881 Bacteria 71057
82 Ga0105240_10464644 3300009093 Bacteria 1413
83 Ga0105245_10000104 3300009098 Bacteria 80951
84 Ga0105245_10000143 3300009098 Bacteria 67618
85 Ga0105245_10000917 3300009098 Bacteria 26795
86 Ga0105245_10003306 3300009098 Bacteria 14474
87 Ga0105245_10266227 3300009098 Bacteria 1670
88 Ga0105247_10000249 3300009101 Bacteria 50022
89 Ga0105247_10115254 3300009101 Bacteria 1734
90 Ga0105243_10004539 3300009148 Bacteria 10970
91 Ga0105242_10000034 3300009176 Bacteria 95536
92 Ga0105242_10001234 3300009176 Bacteria 20158
93 Ga0105242_10077200 3300009176 Bacteria 2778
94 Ga0105242_10175768 3300009176 Bacteria 1885
95 Ga0105248_10000175 3300009177 Bacteria 74795
96 Ga0105237_10473507 3300009545 Bacteria 1258
97 Ga0105238_10000009 3300009551 Bacteria 288729
98 Ga0105249_10000070 3300009553 Bacteria 147277
99 Ga0105249_10009609 3300009553 Bacteria 8475
100 Ga0105249_10092553 3300009553 Bacteria 2831
101 Ga0105239_10095374 3300010375 Bacteria 3286
102 Ga0105246_10065860 3300011119 Bacteria 2534
103 Ga0157371_10003743 3300013102 Bacteria 13616
104 Ga0157370_10003852 3300013104 Bacteria 17496
105 Ga0157369_10000014 3300013105 Bacteria 266411
106 Ga0157374_10111318 3300013296 Bacteria 2634
107 Ga0157372_10000210 3300013307 Bacteria 65290
108 Ga0157372_10355228 3300013307 Bacteria 1708
109 Ga0157375_10000137 3300013308 Bacteria 72720
110 Ga0157375_10010523 3300013308 Bacteria 8143
111 Ga0157375_10139391 3300013308 Bacteria 2551
112 Ga0157380_10000323 3300014326 Bacteria 28968
113 Ga0157380_10019228 3300014326 Bacteria 5088
114 Ga0157379_10179232 3300014968 Bacteria 1914
115 Ga0157376_10019340 3300014969 Bacteria 5247
116 Ga0157376_10050533 3300014969 Bacteria 3450
117 Ga0163161_10000027 3300017792 Bacteria 197774
118 Ga0163161_10008256 3300017792 Bacteria 7204
119 Ga0207656_10000518 3300025321 Bacteria 12760
120 Ga0207682_10000581 3300025893 Bacteria 16931
121 Ga0207642_10000005 3300025899 Bacteria 401934
122 Ga0207642_10000060 3300025899 Bacteria 32182
123 Ga0207710_10000307 3300025900 Bacteria 38735
124 Ga0207680_10013881 3300025903 Bacteria 4151
125 Ga0207685_10000025 3300025905 Bacteria 110358
126 Ga0207707_10007406 3300025912 Bacteria 9560
127 Ga0207649_10000003 3300025920 Bacteria 388908
128 Ga0207652_10003198 3300025921 Bacteria 13608
129 Ga0207652_10036566 3300025921 Bacteria 4151
130 Ga0207694_10000004 3300025924 Bacteria 967075
131 Ga0207650_10164838 3300025925 Bacteria 1758
132 Ga0207659_10000018 3300025926 Bacteria 156920
133 Ga0207687_10000015 3300025927 Bacteria 261701
134 Ga0207687_10000020 3300025927 Bacteria 228407
135 Ga0207687_10001054 3300025927 Bacteria 18684
136 Ga0207687_10003325 3300025927 Bacteria 10858
137 Ga0207706_10000017 3300025933 Bacteria 169589
138 Ga0207686_10001224 3300025934 Bacteria 14908
139 Ga0207686_10008569 3300025934 Bacteria 5525
140 Ga0207686_10154594 3300025934 Bacteria 1601
141 Ga0207669_10000003 3300025937 Bacteria 252239
142 Ga0207669_10000056 3300025937 Bacteria 56304
143 Ga0207704_10000026 3300025938 Bacteria 123892
144 Ga0207665_10035261 3300025939 Bacteria 3320
145 Ga0207691_10000002 3300025940 Bacteria 189785
146 Ga0207711_10000006 3300025941 Bacteria 792692
147 Ga0207689_10266257 3300025942 Bacteria 1418
148 Ga0207661_10000774 3300025944 Bacteria 20762
149 Ga0207661_10010255 3300025944 Bacteria 6739
150 Ga0207661_10026415 3300025944 Bacteria 4424
151 Ga0207661_10029292 3300025944 Bacteria 4227
152 Ga0207661_10044501 3300025944 Bacteria 3509
153 Ga0207651_10001711 3300025960 Bacteria 10131
154 Ga0207712_10000019 3300025961 Bacteria 317060
155 Ga0207712_10117232 3300025961 Bacteria 2008
156 Ga0207640_10001278 3300025981 Bacteria 13673
157 Ga0207640_10013621 3300025981 Bacteria 4666
158 Ga0207658_10110083 3300025986 Bacteria 2175
159 Ga0207677_10000299 3300026023 Bacteria 37042
160 Ga0207677_10000361 3300026023 Bacteria 31898
161 Ga0207703_10000169 3300026035 Bacteria 76131
162 Ga0207703_10000170 3300026035 Bacteria 75814
163 Ga0207703_10137740 3300026035 Bacteria 2115
164 Ga0207678_10000253 3300026067 Bacteria 48388
165 Ga0207678_10166896 3300026067 Bacteria 1880
166 Ga0207702_10000085 3300026078 Bacteria 106728
167 Ga0207702_10003690 3300026078 Bacteria 13856
168 Ga0207641_10000077 3300026088 Bacteria 144978
169 Ga0207641_10003646 3300026088 Bacteria 13583
170 Ga0207648_10013946 3300026089 Bacteria 7450
171 Ga0207676_10000094 3300026095 Bacteria 80575
172 Ga0207683_10006424 3300026121 Bacteria 10067
173 Ga0207683_10116451 3300026121 Bacteria 2396
174 Ga0207698_10000004 3300026142 Bacteria 313614
175 Ga0268266_10000045 3300028379 Bacteria 312955
176 Ga0268266_10000537 3300028379 Bacteria 52878
177 Ga0268266_10149941 3300028379 Bacteria 2101
178 Ga0268265_10027175 3300028380 Bacteria 4080
179 Ga0268264_10001292 3300028381 Bacteria 23636
180 Ga0265337_1000223 3300028556 Bacteria 30346
181 Ga0265326_10000079 3300028558 Bacteria 51707
182 Ga0265319_1000035 3300028563 Bacteria 117269
183 Ga0265322_10000004 3300028654 Bacteria 275155
184 Ga0265336_10008788 3300028666 Bacteria 3522
185 Ga0265338_10000171 3300028800 Bacteria 120054
186 Ga0265324_10001122 3300029957 Bacteria 16059
187 Ga0265328_10006864 3300031239 Bacteria 4782
188 Ga0265320_10000029 3300031240 Bacteria 159627
189 Ga0265325_10010611 3300031241 Bacteria 5325
190 Ga0265331_10005798 3300031250 Bacteria 7401
191 Ga0265327_10000723 3300031251 Bacteria 51798
192 Ga0265314_10000484 3300031711 Bacteria 52007
193 Ga0265342_10017549 3300031712 Bacteria 4652
194 Ga0316576_10003584 3300031727 Bacteria 9148
195 Ga0307415_100017652 3300032126 Bacteria 4283
196 Ga0316574_0000563 3300035398 Bacteria 15371
197 Ga0316574_0035716 3300035398 Bacteria 3039
198 Ga0373937_0028334 3300036401 Bacteria 5067
199 Ga0316584_0031011 3300036712 Bacteria 3952
200 Ga0451807_0659185 3300041486 Bacteria 2454
201 Ga0451833_0471626 3300041491 Bacteria 2384
202 Ga0451839_1641430 3300041496 Bacteria 1235
203 Ga0451849_0021162 3300041505 Bacteria 1415
204 Ga0451853_1364708 3300041512 Bacteria 2160
205 Ga0466967_0000006 3300045976 Bacteria 144065
206 Ga0466967_0007717 3300045976 Bacteria 7800
207 Ga0495592_0008902 3300046454 Bacteria 7539
208 Ga0495592_0026085 3300046454 Bacteria 4433
209 Ga0495592_0076522 3300046454 Bacteria 2428
210 Ga0495603_0000938 3300046455 Bacteria 16778
211 Ga0495603_0001338 3300046455 Bacteria 14315
212 Ga0495629_0013175 3300046459 Bacteria 5970
213 Ga0495638_0019755 3300046460 Bacteria 4454
214 Ga0495641_0000014 3300046461 Bacteria 140908
215 Ga0495641_0019172 3300046461 Bacteria 3509
216 Ga0495641_0039946 3300046461 Bacteria 2184
217 Ga0495653_0011392 3300046463 Bacteria 7266
218 Ga0495653_0099573 3300046463 Bacteria 2109
219 Ga0495653_0187054 3300046463 Bacteria 1416
220 Ga0495582_0000003 3300046473 Bacteria 168880
221 Ga0495662_0005830 3300046476 Bacteria 6164
222 Ga0495662_0032277 3300046476 Bacteria 2529
223 Ga0495594_0000006 3300046499 Bacteria 167901
224 Ga0495608_0007193 3300046511 Bacteria 7872
225 Ga0495608_0009408 3300046511 Bacteria 6832
226 Ga0495618_0000144 3300046514 Bacteria 50904
227 Ga0495620_0000352 3300046515 Bacteria 31894
228 Ga0495628_0000437 3300046516 Bacteria 37922
229 Ga0495628_0014714 3300046516 Bacteria 6551
230 Ga0495630_0000034 3300046517 Bacteria 126055
231 Ga0495630_0002693 3300046517 Bacteria 12329
232 Ga0495630_0043899 3300046517 Bacteria 3340
233 Ga0495630_0087916 3300046517 Bacteria 2347
234 Ga0495630_0187275 3300046517 Bacteria 1579
235 Ga0495644_0001542 3300046523 Bacteria 9397
236 Ga0495652_0000010 3300046529 Bacteria 261584
237 Ga0495652_0010402 3300046529 Bacteria 8433
238 Ga0495652_0193971 3300046529 Bacteria 1548
239 Ga0495640_0034849 3300046533 Bacteria 3564
240 Ga0495586_0001281 3300046535 Bacteria 14059
241 Ga0495587_0006085 3300046536 Bacteria 7873
242 Ga0495587_0057515 3300046536 Bacteria 2286
243 Ga0495621_0004433 3300046539 Bacteria 3946
244 Ga0495645_0002432 3300046543 Bacteria 12646
245 Ga0495622_0000132 3300046557 Bacteria 63863
246 Ga0495633_0067696 3300046558 Bacteria 1667
247 Ga0495667_0000505 3300046559 Bacteria 24881
248 Ga0495667_0075099 3300046559 Bacteria 2200
249 Ga0495667_0093886 3300046559 Bacteria 1943
250 Ga0495634_0000002 3300046642 Bacteria 247842
251 Ga0495634_0000638 3300046642 Bacteria 34084
252 Ga0495634_0002399 3300046642 Bacteria 15606
253 Ga0495625_0000032 3300046660 Bacteria 233135
254 Ga0495625_0154627 3300046660 Bacteria 1540
255 Ga0495635_0000005 3300046663 Bacteria 302178
256 Ga0495635_0101221 3300046663 Bacteria 1969
257 Ga0495657_0031168 3300046675 Bacteria 3729
258 Ga0495599_0096203 3300046678 Bacteria 1846
259 Ga0495647_0000009 3300046681 Bacteria 94874
260 Ga0495647_0000049 3300046681 Bacteria 34446
261 Ga0495647_0006384 3300046681 Bacteria 3901
262 Ga0495658_0000001 3300046683 Bacteria 385362
263 Ga0495658_0003950 3300046683 Bacteria 7317
264 Ga0495669_0000121 3300046684 Bacteria 50495
265 Ga0495669_0010118 3300046684 Bacteria 3983
266 Ga0495613_0001352 3300046689 Bacteria 18688
267 Ga0495613_0077064 3300046689 Unclassified 2426
268 Ga0495613_0206400 3300046689 Bacteria 1383
269 Ga0495624_0001301 3300046690 Bacteria 19637
270 Ga0495624_0029354 3300046690 Bacteria 3588
271 Ga0495624_0091625 3300046690 Bacteria 1875
272 Ga0495670_0010128 3300046691 Bacteria 4639
273 Ga0495600_0002554 3300046809 Bacteria 10488
274 Ga0495600_0148041 3300046809 Bacteria 1521
275 Ga0495604_0000089 3300047317 Bacteria 77741
276 Ga0495674_0000010 3300047319 Bacteria 285794
277 Ga0495674_0017685 3300047319 Bacteria 6638
278 Ga0495676_0000136 3300047321 Bacteria 55706
279 Ga0495676_0000346 3300047321 Bacteria 37821
280 Ga0495676_0123030 3300047321 Bacteria 1884
281 Ga0495680_0000856 3300047322 Bacteria 33820
282 Ga0495680_0010286 3300047322 Bacteria 8345
283 Ga0495680_0023946 3300047322 Bacteria 5072
284 Ga0495675_0089752 3300047444 Bacteria 1929
285 Ga0495679_004872 3300047446 Bacteria 6061
286 Ga0495684_0213203 3300047471 Bacteria 1419
287 Ga0495593_0081916 3300047673 Bacteria 1668
288 Ga0495602_0004094 3300048088 Bacteria 15176
289 Ga0496100_0000001 3300048903 Bacteria 530179
290 Ga0496100_0000014 3300048903 Bacteria 174991
291 Ga0496101_0000028 3300048904 Bacteria 198664
292 Ga0496101_0000036 3300048904 Bacteria 175595
293 Ga0496101_0219864 3300048904 Bacteria 1474
294 Ga0496102_0000561 3300048905 Bacteria 39545
295 Ga0496103_0000057 3300048906 Bacteria 142223
296 Ga0496103_0076788 3300048906 Bacteria 2097
297 Ga0496104_0000010 3300048907 Bacteria 475255
298 Ga0496104_0000024 3300048907 Bacteria 229913
299 Ga0496104_0000213 3300048907 Bacteria 51219
300 Ga0496105_0000005 3300048908 Bacteria 475797
301 Ga0496105_0000013 3300048908 Bacteria 229894
302 Ga0496105_0002964 3300048908 Bacteria 12459
303 Ga0496105_0015185 3300048908 Bacteria 6132
304 Ga0496105_0324190 3300048908 Bacteria 1234
305 Ga0496106_0000055 3300048909 Bacteria 91570
306 Ga0496106_0000111 3300048909 Bacteria 63431
307 Ga0496106_0000475 3300048909 Bacteria 28606
308 Ga0496106_0099358 3300048909 Unclassified 2256
309 Ga0496107_0000002 3300048910 Bacteria 320871
310 Ga0496107_0000022 3300048910 Bacteria 128991
311 Ga0496107_0057106 3300048910 Bacteria 2821
312 Ga0496108_0000006 3300048911 Bacteria 469473
313 Ga0496108_0000120 3300048911 Bacteria 77596
314 Ga0496108_0081368 3300048911 Bacteria 2744
315 Ga0496109_0000004 3300048912 Bacteria 404818
316 Ga0496109_0000044 3300048912 Bacteria 133779
317 Ga0496109_0066530 3300048912 Bacteria 3300
318 Ga0496109_0126637 3300048912 Bacteria 2382
319 Ga0496109_0281112 3300048912 Bacteria 1568
320 Ga0496110_0001628 3300048913 Bacteria 16468
321 Ga0496110_0011973 3300048913 Bacteria 7124
322 Ga0496110_0114365 3300048913 Bacteria 2428
323 Ga0496110_0115596 3300048913 Bacteria 2415
324 Ga0496111_0000117 3300048914 Bacteria 34553
325 Ga0496111_0005401 3300048914 Bacteria 8184
326 Ga0496111_0043096 3300048914 Bacteria 3243
327 Ga0496112_0000013 3300048915 Bacteria 237194
328 Ga0496112_0003359 3300048915 Bacteria 13208
329 Ga0496112_0284802 3300048915 Unclassified 1599
330 Ga0496113_0000001 3300048916 Bacteria 224977
331 Ga0496113_0012131 3300048916 Bacteria 5782
332 Ga0496113_0014085 3300048916 Bacteria 5444
333 Ga0496113_0029881 3300048916 Bacteria 3940
334 Ga0496114_0000003 3300048917 Bacteria 630981
335 Ga0496114_0002941 3300048917 Bacteria 13063
336 Ga0496115_0000016 3300048918 Bacteria 187067
337 Ga0496115_0000031 3300048918 Bacteria 138258
338 Ga0496115_0004971 3300048918 Bacteria 9656
339 Ga0496116_0000257 3300048919 Bacteria 93214
340 Ga0496119_0009468 3300048922 Bacteria 8352
341 Ga0496119_0013765 3300048922 Bacteria 6405
342 Ga0496119_0015137 3300048922 Bacteria 5970
343 Ga0496119_0020085 3300048922 Bacteria 4886
344 Ga0496120_0001948 3300048923 Bacteria 22617
345 Ga0496120_0019904 3300048923 Bacteria 4280
346 Ga0496121_0011390 3300048924 Bacteria 9884
347 Ga0496121_0031400 3300048924 Bacteria 4853
348 Ga0496121_0075941 3300048924 Bacteria 2682
349 Ga0496124_0045846 3300048927 Bacteria 3747
350 Ga0496125_0050954 3300048928 Bacteria 3420
351 Ga0496126_0026312 3300048929 Bacteria 5580
352 Ga0501031_0002912 3300049568 Bacteria 10943
353 Ga0501032_0005064 3300049569 Bacteria 9845
354 Ga0501033_0000283 3300049570 Bacteria 48801
355 Ga0501034_0066118 3300049571 Bacteria 3628
356 Ga0501034_0214744 3300049571 Unclassified 1878
357 Ga0501036_0004416 3300049572 Bacteria 11353
358 Ga0501036_0277483 3300049572 Bacteria 1403
359 Ga0501037_0007698 3300049573 Bacteria 7884
360 Ga0501037_0152875 3300049573 Bacteria 1649
361 Ga0501038_0001500 3300049574 Bacteria 21463
362 Ga0501039_0037581 3300049575 Bacteria 3738
363 Ga0501042_0018761 3300049578 Bacteria 4794
364 Ga0501043_0000291 3300049579 Bacteria 45276
365 Ga0501046_0000313 3300049580 Bacteria 48865
366 Ga0501047_0000313 3300049581 Bacteria 55964
367 Ga0501047_0007896 3300049581 Bacteria 10033
368 Ga0501047_0125180 3300049581 Bacteria 2451
369 Ga0501048_0004263 3300049582 Bacteria 10896
370 Ga0501068_0022157 3300049584 Bacteria 3712
371 Ga0501070_0000308 3300049586 Bacteria 44689
372 Ga0501070_0008194 3300049586 Bacteria 8837
373 Ga0501073_0004201 3300049589 Bacteria 10798
374 Ga0501075_0034640 3300049591 Bacteria 3760
375 Ga0501079_0068352 3300049741 Bacteria 2742
376 Ga0501080_0012300 3300049742 Bacteria 7841
377 Ga0501081_0096977 3300049743 Bacteria 2080
378 Ga0501083_0006480 3300049744 Bacteria 8304
379 Ga0501035_0000405 3300049822 Bacteria 48987
380 Ga0501035_0220104 3300049822 Bacteria 1621
381 Ga0501044_0000211 3300049823 Bacteria 73920
382 Ga0501044_0216624 3300049823 Bacteria 1867
383 Ga0501045_0130945 3300049824 Bacteria 1865
384 Ga0501045_0148559 3300049824 Bacteria 1743
385 nmdc:mga03n38_25058_c1 3300050490 Bacteria 2445
386 nmdc:mga00v17_56311_c1 3300050491 Unclassified 2403
387 nmdc:mga00v17_68492_c1 3300050491 Bacteria 2194
388 nmdc:mga0yw44_115860_c1 3300050492 Bacteria 1722
389 nmdc:mga0yw44_257787_c1 3300050492 Unclassified 1162
390 nmdc:mga0a205_1185_c1 3300050515 Bacteria 21788
391 nmdc:mga0a205_94_c1 3300050515 Bacteria 50261
392 Ga0495601_0000330 3300053077 Bacteria 25170
393 Ga0495601_0009240 3300053077 Bacteria 5827
394 Ga0495601_0031969 3300053077 Bacteria 3273
395 Ga0495612_0000031 3300053078 Bacteria 80955
396 Ga0495612_0004069 3300053078 Bacteria 6057
397 Ga0495612_0076281 3300053078 Bacteria 1404
398 Ga0495655_0000005 3300053083 Bacteria 257472
399 Ga0495595_0003902 3300053084 Bacteria 5950
400 Ga0495619_0000010 3300053085 Bacteria 302390
401 Ga0495619_0000144 3300053085 Bacteria 52554
402 Ga0495619_0000146 3300053085 Bacteria 52136
403 Ga0495619_0000412 3300053085 Bacteria 29043
404 Ga0495619_0001825 3300053085 Bacteria 14157
405 Ga0495619_0016018 3300053085 Bacteria 4745
406 Ga0495619_0040172 3300053085 Bacteria 3057
407 Ga0500566_0012661 3300053094 Bacteria 4962
408 Ga0500641_0001087 3300053096 Bacteria 9671
409 Ga0500614_000632 3300053123 Bacteria 8960
410 Ga0500628_000025 3300053129 Bacteria 62808
411 Ga0495662_0039154
412 JGI24746J21847_1000324
413 JGI24740J21852_10003899
414 JGI24034J26672_10000321
415 JGI25404J52841_10000379
416 Ga0070683_100016420
417 Ga0070683_100043999
418 Ga0070683_100088535
419 Ga0070683_100165254
420 Ga0070677_10000322
421 Ga0068869_100243350
422 Ga0070682_100000011
423 Ga0070682_100000030
424 Ga0070682_100049311
425 Ga0068868_100000445
426 Ga0068868_100002347
427 Ga0070691_10000270
428 Ga0070691_10008904
429 Ga0070675_100000028
430 Ga0070674_100000002
431 Ga0070674_100000004
432 Ga0070673_100004080
433 Ga0070688_100000251
434 Ga0070688_100000368
435 Ga0070667_100013105
436 Ga0070667_100075761
437 Ga0070667_100135683
438 Ga0070714_100035345
439 Ga0070663_100000065
440 Ga0070678_100168254
441 Ga0070662_100000006
442 Ga0070681_10004368
443 Ga0070681_10062304
444 Ga0068867_100008063
445 Ga0070685_10000053
446 Ga0070685_10000301
447 Ga0070685_10052845
448 Ga0070679_100000461
449 Ga0070679_100020836
450 Ga0070684_100048504
451 Ga0070684_100118311
452 Ga0070684_100186689
453 Ga0068853_100010340
454 Ga0070672_100000049
455 Ga0070693_100009223
456 Ga0070665_100000040
457 Ga0070665_100162333
458 Ga0070704_100049578
459 Ga0068855_100374582
460 Ga0070664_100072547
461 Ga0070664_100100239
462 Ga0068854_100025675
463 Ga0068854_100055889
464 Ga0068856_100000377
465 Ga0068856_100006911
466 Ga0068856_100016576
467 Ga0068852_100000539
468 Ga0068852_100129237
469 Ga0068852_100309271
470 Ga0068864_100000053
471 Ga0068866_10000004
472 Ga0068866_10000036
473 Ga0068851_10004698
474 Ga0068863_100000432
475 Ga0068863_100022480
476 Ga0068858_100000526
477 Ga0068858_100002599
478 Ga0068860_100001579
479 Ga0068860_100318189
480 Ga0068862_100013486
481 Ga0081540_1000129
482 Ga0081539_10002112
483 Ga0081539_10053708
484 Ga0075363_100057095
485 Ga0075364_10049918
486 Ga0075364_10063096
487 Ga0070715_10000014
488 Ga0070716_100014183
489 Ga0075433_10000051
490 Ga0075433_10004054
491 Ga0068865_100000042
492 Ga0105240_10464644
493 Ga0105245_10000104
494 Ga0105245_10000143
495 Ga0105245_10000917
496 Ga0105245_10003306
497 Ga0105245_10266227
498 Ga0105247_10000249
499 Ga0105247_10115254
500 Ga0105243_10004539
501 Ga0105242_10000034
502 Ga0105242_10001234
503 Ga0105242_10077200
504 Ga0105242_10175768
505 Ga0105248_10000175
506 Ga0105237_10473507
507 Ga0105238_10000009
508 Ga0105249_10000070
509 Ga0105249_10009609
510 Ga0105249_10092553
511 Ga0105239_10095374
512 Ga0105246_10065860
513 Ga0157371_10003743
514 Ga0157370_10003852
515 Ga0157369_10000014
516 Ga0157374_10111318
517 Ga0157372_10000210
518 Ga0157372_10355228
519 Ga0157375_10000137
520 Ga0157375_10010523
521 Ga0157375_10139391
522 Ga0157380_10000323
523 Ga0157380_10019228
524 Ga0157379_10179232
525 Ga0157376_10019340
526 Ga0157376_10050533
527 Ga0163161_10000027
528 Ga0163161_10008256
529 Ga0207656_10000518
530 Ga0207682_10000581
531 Ga0207642_10000005
532 Ga0207642_10000060
533 Ga0207710_10000307
534 Ga0207680_10013881
535 Ga0207685_10000025
536 Ga0207707_10007406
537 Ga0207649_10000003
538 Ga0207652_10003198
539 Ga0207652_10036566
540 Ga0207694_10000004
541 Ga0207650_10164838
542 Ga0207659_10000018
543 Ga0207687_10000015
544 Ga0207687_10000020
545 Ga0207687_10001054
546 Ga0207687_10003325
547 Ga0207706_10000017
548 Ga0207686_10001224
549 Ga0207686_10008569
550 Ga0207686_10154594
551 Ga0207669_10000003
552 Ga0207669_10000056
553 Ga0207704_10000026
554 Ga0207665_10035261
555 Ga0207691_10000002
556 Ga0207711_10000006
557 Ga0207689_10266257
558 Ga0207661_10000774
559 Ga0207661_10010255
560 Ga0207661_10026415
561 Ga0207661_10029292
562 Ga0207661_10044501
563 Ga0207651_10001711
564 Ga0207712_10000019
565 Ga0207712_10117232
566 Ga0207640_10001278
567 Ga0207640_10013621
568 Ga0207658_10110083
569 Ga0207677_10000299
570 Ga0207677_10000361
571 Ga0207703_10000169
572 Ga0207703_10000170
573 Ga0207703_10137740
574 Ga0207678_10000253
575 Ga0207678_10166896
576 Ga0207702_10000085
577 Ga0207702_10003690
578 Ga0207641_10000077
579 Ga0207641_10003646
580 Ga0207648_10013946
581 Ga0207676_10000094
582 Ga0207683_10006424
583 Ga0207683_10116451
584 Ga0207698_10000004
585 Ga0268266_10000045
586 Ga0268266_10000537
587 Ga0268266_10149941
588 Ga0268265_10027175
589 Ga0268264_10001292
590 Ga0265337_1000223
591 Ga0265326_10000079
592 Ga0265319_1000035
593 Ga0265322_10000004
594 Ga0265336_10008788
595 Ga0265338_10000171
596 Ga0265324_10001122
597 Ga0265328_10006864
598 Ga0265320_10000029
599 Ga0265325_10010611
600 Ga0265331_10005798
601 Ga0265327_10000723
602 Ga0265314_10000484
603 Ga0265342_10017549
604 Ga0316576_10003584
605 Ga0307415_100017652
606 Ga0316574_0000563
607 Ga0316574_0035716
608 Ga0373937_0028334
609 Ga0316584_0031011
610 Ga0451807_0659185
611 Ga0451833_0471626
612 Ga0451839_1641430
613 Ga0451849_0021162
614 Ga0451853_1364708
615 Ga0466967_0000006
616 Ga0466967_0007717
617 Ga0495592_0008902
618 Ga0495592_0026085
619 Ga0495592_0076522
620 Ga0495603_0000938
621 Ga0495603_0001338
622 Ga0495629_0013175
623 Ga0495638_0019755
624 Ga0495641_0000014
625 Ga0495641_0019172
626 Ga0495641_0039946
627 Ga0495653_0011392
628 Ga0495653_0099573
629 Ga0495653_0187054
630 Ga0495582_0000003
631 Ga0495662_0005830
632 Ga0495662_0032277
633 Ga0495594_0000006
634 Ga0495608_0007193
635 Ga0495608_0009408
636 Ga0495618_0000144
637 Ga0495620_0000352
638 Ga0495628_0000437
639 Ga0495628_0014714
640 Ga0495630_0000034
641 Ga0495630_0002693
642 Ga0495630_0043899
643 Ga0495630_0087916
644 Ga0495630_0187275
645 Ga0495644_0001542
646 Ga0495652_0000010
647 Ga0495652_0010402
648 Ga0495652_0193971
649 Ga0495640_0034849
650 Ga0495586_0001281
651 Ga0495587_0006085
652 Ga0495587_0057515
653 Ga0495621_0004433
654 Ga0495645_0002432
655 Ga0495622_0000132
656 Ga0495633_0067696
657 Ga0495667_0000505
658 Ga0495667_0075099
659 Ga0495667_0093886
660 Ga0495634_0000002
661 Ga0495634_0000638
662 Ga0495634_0002399
663 Ga0495625_0000032
664 Ga0495625_0154627
665 Ga0495635_0000005
666 Ga0495635_0101221
667 Ga0495657_0031168
668 Ga0495599_0096203
669 Ga0495647_0000009
670 Ga0495647_0000049
671 Ga0495647_0006384
672 Ga0495658_0000001
673 Ga0495658_0003950
674 Ga0495669_0000121
675 Ga0495669_0010118
676 Ga0495613_0001352
677 Ga0495613_0077064
678 Ga0495613_0206400
679 Ga0495624_0001301
680 Ga0495624_0029354
681 Ga0495624_0091625
682 Ga0495670_0010128
683 Ga0495600_0002554
684 Ga0495600_0148041
685 Ga0495604_0000089
686 Ga0495674_0000010
687 Ga0495674_0017685
688 Ga0495676_0000136
689 Ga0495676_0000346
690 Ga0495676_0123030
691 Ga0495680_0000856
692 Ga0495680_0010286
693 Ga0495680_0023946
694 Ga0495675_0089752
695 Ga0495679_004872
696 Ga0495684_0213203
697 Ga0495593_0081916
698 Ga0495602_0004094
699 Ga0496100_0000001
700 Ga0496100_0000014
701 Ga0496101_0000028
702 Ga0496101_0000036
703 Ga0496101_0219864
704 Ga0496102_0000561
705 Ga0496103_0000057
706 Ga0496103_0076788
707 Ga0496104_0000010
708 Ga0496104_0000024
709 Ga0496104_0000213
710 Ga0496105_0000005
711 Ga0496105_0000013
712 Ga0496105_0002964
713 Ga0496105_0015185
714 Ga0496105_0324190
715 Ga0496106_0000055
716 Ga0496106_0000111
717 Ga0496106_0000475
718 Ga0496106_0099358
719 Ga0496107_0000002
720 Ga0496107_0000022
721 Ga0496107_0057106
722 Ga0496108_0000006
723 Ga0496108_0000120
724 Ga0496108_0081368
725 Ga0496109_0000004
726 Ga0496109_0000044
727 Ga0496109_0066530
728 Ga0496109_0126637
729 Ga0496109_0281112
730 Ga0496110_0001628
731 Ga0496110_0011973
732 Ga0496110_0114365
733 Ga0496110_0115596
734 Ga0496111_0000117
735 Ga0496111_0005401
736 Ga0496111_0043096
737 Ga0496112_0000013
738 Ga0496112_0003359
739 Ga0496112_0284802
740 Ga0496113_0000001
741 Ga0496113_0012131
742 Ga0496113_0014085
743 Ga0496113_0029881
744 Ga0496114_0000003
745 Ga0496114_0002941
746 Ga0496115_0000016
747 Ga0496115_0000031
748 Ga0496115_0004971
749 Ga0496116_0000257
750 Ga0496119_0009468
751 Ga0496119_0013765
752 Ga0496119_0015137
753 Ga0496119_0020085
754 Ga0496120_0001948
755 Ga0496120_0019904
756 Ga0496121_0011390
757 Ga0496121_0031400
758 Ga0496121_0075941
759 Ga0496124_0045846
760 Ga0496125_0050954
761 Ga0496126_0026312
762 Ga0501031_0002912
763 Ga0501032_0005064
764 Ga0501033_0000283
765 Ga0501034_0066118
766 Ga0501034_0214744
767 Ga0501036_0004416
768 Ga0501036_0277483
769 Ga0501037_0007698
770 Ga0501037_0152875
771 Ga0501038_0001500
772 Ga0501039_0037581
773 Ga0501042_0018761
774 Ga0501043_0000291
775 Ga0501046_0000313
776 Ga0501047_0000313
777 Ga0501047_0007896
778 Ga0501047_0125180
779 Ga0501048_0004263
780 Ga0501068_0022157
781 Ga0501070_0000308
782 Ga0501070_0008194
783 Ga0501073_0004201
784 Ga0501075_0034640
785 Ga0501079_0068352
786 Ga0501080_0012300
787 Ga0501081_0096977
788 Ga0501083_0006480
789 Ga0501035_0000405
790 Ga0501035_0220104
791 Ga0501044_0000211
792 Ga0501044_0216624
793 Ga0501045_0130945
794 Ga0501045_0148559
795 nmdc:mga03n38_25058_c1
796 nmdc:mga00v17_56311_c1
797 nmdc:mga00v17_68492_c1
798 nmdc:mga0yw44_115860_c1
799 nmdc:mga0yw44_257787_c1
800 nmdc:mga0a205_1185_c1
801 nmdc:mga0a205_94_c1
802 Ga0495601_0000330
803 Ga0495601_0009240
804 Ga0495601_0031969
805 Ga0495612_0000031
806 Ga0495612_0004069
807 Ga0495612_0076281
808 Ga0495655_0000005
809 Ga0495595_0003902
810 Ga0495619_0000010
811 Ga0495619_0000144
812 Ga0495619_0000146
813 Ga0495619_0000412
814 Ga0495619_0001825
815 Ga0495619_0016018
816 Ga0495619_0040172
817 Ga0500566_0012661
818 Ga0500641_0001087
819 Ga0500614_000632
820 Ga0500628_000025

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01098

FTSW_RODA_SPOVE

Cell cycle protein

29

391

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bas-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) 0.8041 31 387
6bar-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) 0.8014 31 387
6pl6-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.7941 31 390
6bas-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) 0.7801 31 387
6pl6-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.7796 31 390
ID Description Score Start End Superfamily
af_A4I924_23_177_1.20.940.10 Mainly Alpha;Up-down Bundle;RNA Binding Protein, Prp18; Chain A;Functional domain of the splicing factor Prp18 0.345 52 201 1.20.940.10
af_D3Z868_1_172_1.25.40.270 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Vacuolar protein sorting-associated protein vta1 0.3441 43 216 1.25.40.270
af_O02096_39_207_1.25.40.330 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Adenylate cyclase-associated CAP, N-terminal domain 0.3418 237 356 1.25.40.330
af_D3Z868_1_172_1.25.40.270 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Vacuolar protein sorting-associated protein vta1 0.326 43 216 1.25.40.270
af_P9WFR7_179_308_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.3236 254 395 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A5B8U9I7-F1-model_v4 peptidoglycan glycosyltransferase (EC 2.4.99.28) 0.862 31 395 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
GO:0071555
AF-A0A538EL08-F1-model_v4 Rod shape-determining protein RodA 0.8601 25 394 GO:0005886
GO:0008360
GO:0015648
GO:0016740
GO:0032153
GO:0051301
AF-A0A2H0YSQ6-F1-model_v4 Rod shape-determining protein RodA 0.8595 24 395 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
GO:0071555
AF-A0A1F2WS17-F1-model_v4 Rod shape-determining protein RodA 0.8594 31 391 GO:0005886
GO:0008360
GO:0015648
GO:0016740
GO:0032153
GO:0051301
AF-A0A537TP45-F1-model_v4 peptidoglycan glycosyltransferase (EC 2.4.99.28) 0.855 14 396 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
GO:0071555

Map