F437337
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 410 | 238 | 820 | 395 |
Family's Representative Sequence
| Representative Sequence | 3300046476|Ga0495662_0039154|Ga0495662_0039154_680_1924 |
| Length | 414 |
| Sequence | MSVATRSRRARPESFSVKPGIAERLSLPYMDAALFLAAAALVALSVFVLSQTTRHDVPGDPGYYSNRQTIYAVLGIVGMYLLARVDYSRFRELRVGIYTFLCVSISLVFVFGFAARGSRRAFDLPFFSFQPSELGKLLLVLALAGFVIDGARRGSPRQRTVRYLCLGLAPAALVFLQPDLGTALVFGAITLAVMYVGGVPWTHFAVIGVALAALVALILVVAPAAHMPLLKSYQQERLTSFLNPSADPSDAGYQQNQAKTAIGAGEFSGRGDRATQTRLDFVPERHTDFIFAVIGERYGFMGAALVLSLYALLIWRALRIVTLSKNSYGMLVAGGIAAMLLFQVFVNVGMNLGIMPITGIPLPLMSYGGSSVLATFLAVGVLQSVHVQARLSQKGRLAWSPRTRPGDAYLTELS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 46 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 47 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 111 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 112 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 113 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 114 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 117 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 118 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 119 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 120 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 121 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 122 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 124 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 125 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 126 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 127 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 129 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 130 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 131 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 132 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 133 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 134 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 135 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 182 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 183 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 184 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 185 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 186 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 187 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 190 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 191 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 192 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 193 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 194 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 195 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 196 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 197 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 198 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 199 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 200 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 201 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 202 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 227 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 228 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 229 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 236 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 237 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 238 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.93 |
| Nodule | 0 |
| Rhizoplane | 12.44 |
| Rhizosphere | 80.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495662_0039154 | 3300046476 | Bacteria | 2290 |
| 2 | JGI24746J21847_1000324 | 3300001977 | Bacteria | 6853 |
| 3 | JGI24740J21852_10003899 | 3300001979 | Bacteria | 6475 |
| 4 | JGI24034J26672_10000321 | 3300002239 | Bacteria | 6179 |
| 5 | JGI25404J52841_10000379 | 3300003659 | Bacteria | 6074 |
| 6 | Ga0070683_100016420 | 3300005329 | Bacteria | 6531 |
| 7 | Ga0070683_100043999 | 3300005329 | Bacteria | 4117 |
| 8 | Ga0070683_100088535 | 3300005329 | Bacteria | 2905 |
| 9 | Ga0070683_100165254 | 3300005329 | Bacteria | 2100 |
| 10 | Ga0070677_10000322 | 3300005333 | Bacteria | 16716 |
| 11 | Ga0068869_100243350 | 3300005334 | Bacteria | 1434 |
| 12 | Ga0070682_100000011 | 3300005337 | Bacteria | 266253 |
| 13 | Ga0070682_100000030 | 3300005337 | Bacteria | 182768 |
| 14 | Ga0070682_100049311 | 3300005337 | Bacteria | 2625 |
| 15 | Ga0068868_100000445 | 3300005338 | Bacteria | 27750 |
| 16 | Ga0068868_100002347 | 3300005338 | Bacteria | 13098 |
| 17 | Ga0070691_10000270 | 3300005341 | Bacteria | 18137 |
| 18 | Ga0070691_10008904 | 3300005341 | Bacteria | 4595 |
| 19 | Ga0070675_100000028 | 3300005354 | Bacteria | 103914 |
| 20 | Ga0070674_100000002 | 3300005356 | Bacteria | 271088 |
| 21 | Ga0070674_100000004 | 3300005356 | Bacteria | 169446 |
| 22 | Ga0070673_100004080 | 3300005364 | Bacteria | 9197 |
| 23 | Ga0070688_100000251 | 3300005365 | Bacteria | 28262 |
| 24 | Ga0070688_100000368 | 3300005365 | Bacteria | 22900 |
| 25 | Ga0070667_100013105 | 3300005367 | Bacteria | 6853 |
| 26 | Ga0070667_100075761 | 3300005367 | Bacteria | 2872 |
| 27 | Ga0070667_100135683 | 3300005367 | Bacteria | 2151 |
| 28 | Ga0070714_100035345 | 3300005435 | Bacteria | 4188 |
| 29 | Ga0070663_100000065 | 3300005455 | Bacteria | 45157 |
| 30 | Ga0070678_100168254 | 3300005456 | Bacteria | 1782 |
| 31 | Ga0070662_100000006 | 3300005457 | Bacteria | 169366 |
| 32 | Ga0070681_10004368 | 3300005458 | Bacteria | 13449 |
| 33 | Ga0070681_10062304 | 3300005458 | Bacteria | 3703 |
| 34 | Ga0068867_100008063 | 3300005459 | Bacteria | 7442 |
| 35 | Ga0070685_10000053 | 3300005466 | Bacteria | 70868 |
| 36 | Ga0070685_10000301 | 3300005466 | Bacteria | 31302 |
| 37 | Ga0070685_10052845 | 3300005466 | Bacteria | 2352 |
| 38 | Ga0070679_100000461 | 3300005530 | Bacteria | 34593 |
| 39 | Ga0070679_100020836 | 3300005530 | Bacteria | 6395 |
| 40 | Ga0070684_100048504 | 3300005535 | Bacteria | 3685 |
| 41 | Ga0070684_100118311 | 3300005535 | Bacteria | 2381 |
| 42 | Ga0070684_100186689 | 3300005535 | Bacteria | 1885 |
| 43 | Ga0068853_100010340 | 3300005539 | Bacteria | 7548 |
| 44 | Ga0070672_100000049 | 3300005543 | Bacteria | 52233 |
| 45 | Ga0070693_100009223 | 3300005547 | Bacteria | 4902 |
| 46 | Ga0070665_100000040 | 3300005548 | Bacteria | 305480 |
| 47 | Ga0070665_100162333 | 3300005548 | Bacteria | 2236 |
| 48 | Ga0070704_100049578 | 3300005549 | Bacteria | 2947 |
| 49 | Ga0068855_100374582 | 3300005563 | Bacteria | 1564 |
| 50 | Ga0070664_100072547 | 3300005564 | Bacteria | 2953 |
| 51 | Ga0070664_100100239 | 3300005564 | Bacteria | 2518 |
| 52 | Ga0068854_100025675 | 3300005578 | Bacteria | 4043 |
| 53 | Ga0068854_100055889 | 3300005578 | Bacteria | 2844 |
| 54 | Ga0068856_100000377 | 3300005614 | Bacteria | 48877 |
| 55 | Ga0068856_100006911 | 3300005614 | Bacteria | 11099 |
| 56 | Ga0068856_100016576 | 3300005614 | Bacteria | 7132 |
| 57 | Ga0068852_100000539 | 3300005616 | Bacteria | 24879 |
| 58 | Ga0068852_100129237 | 3300005616 | Bacteria | 2324 |
| 59 | Ga0068852_100309271 | 3300005616 | Bacteria | 1532 |
| 60 | Ga0068864_100000053 | 3300005618 | Bacteria | 133049 |
| 61 | Ga0068866_10000004 | 3300005718 | Bacteria | 202810 |
| 62 | Ga0068866_10000036 | 3300005718 | Bacteria | 51111 |
| 63 | Ga0068851_10004698 | 3300005834 | Bacteria | 6176 |
| 64 | Ga0068863_100000432 | 3300005841 | Bacteria | 42297 |
| 65 | Ga0068863_100022480 | 3300005841 | Bacteria | 6022 |
| 66 | Ga0068858_100000526 | 3300005842 | Bacteria | 40242 |
| 67 | Ga0068858_100002599 | 3300005842 | Bacteria | 18181 |
| 68 | Ga0068860_100001579 | 3300005843 | Bacteria | 24553 |
| 69 | Ga0068860_100318189 | 3300005843 | Bacteria | 1527 |
| 70 | Ga0068862_100013486 | 3300005844 | Bacteria | 6767 |
| 71 | Ga0081540_1000129 | 3300005983 | Bacteria | 80446 |
| 72 | Ga0081539_10002112 | 3300005985 | Bacteria | 29436 |
| 73 | Ga0081539_10053708 | 3300005985 | Bacteria | 2254 |
| 74 | Ga0075363_100057095 | 3300006048 | Bacteria | 2094 |
| 75 | Ga0075364_10049918 | 3300006051 | Bacteria | 2729 |
| 76 | Ga0075364_10063096 | 3300006051 | Bacteria | 2432 |
| 77 | Ga0070715_10000014 | 3300006163 | Bacteria | 154272 |
| 78 | Ga0070716_100014183 | 3300006173 | Bacteria | 4078 |
| 79 | Ga0075433_10000051 | 3300006852 | Bacteria | 49800 |
| 80 | Ga0075433_10004054 | 3300006852 | Bacteria | 11346 |
| 81 | Ga0068865_100000042 | 3300006881 | Bacteria | 71057 |
| 82 | Ga0105240_10464644 | 3300009093 | Bacteria | 1413 |
| 83 | Ga0105245_10000104 | 3300009098 | Bacteria | 80951 |
| 84 | Ga0105245_10000143 | 3300009098 | Bacteria | 67618 |
| 85 | Ga0105245_10000917 | 3300009098 | Bacteria | 26795 |
| 86 | Ga0105245_10003306 | 3300009098 | Bacteria | 14474 |
| 87 | Ga0105245_10266227 | 3300009098 | Bacteria | 1670 |
| 88 | Ga0105247_10000249 | 3300009101 | Bacteria | 50022 |
| 89 | Ga0105247_10115254 | 3300009101 | Bacteria | 1734 |
| 90 | Ga0105243_10004539 | 3300009148 | Bacteria | 10970 |
| 91 | Ga0105242_10000034 | 3300009176 | Bacteria | 95536 |
| 92 | Ga0105242_10001234 | 3300009176 | Bacteria | 20158 |
| 93 | Ga0105242_10077200 | 3300009176 | Bacteria | 2778 |
| 94 | Ga0105242_10175768 | 3300009176 | Bacteria | 1885 |
| 95 | Ga0105248_10000175 | 3300009177 | Bacteria | 74795 |
| 96 | Ga0105237_10473507 | 3300009545 | Bacteria | 1258 |
| 97 | Ga0105238_10000009 | 3300009551 | Bacteria | 288729 |
| 98 | Ga0105249_10000070 | 3300009553 | Bacteria | 147277 |
| 99 | Ga0105249_10009609 | 3300009553 | Bacteria | 8475 |
| 100 | Ga0105249_10092553 | 3300009553 | Bacteria | 2831 |
| 101 | Ga0105239_10095374 | 3300010375 | Bacteria | 3286 |
| 102 | Ga0105246_10065860 | 3300011119 | Bacteria | 2534 |
| 103 | Ga0157371_10003743 | 3300013102 | Bacteria | 13616 |
| 104 | Ga0157370_10003852 | 3300013104 | Bacteria | 17496 |
| 105 | Ga0157369_10000014 | 3300013105 | Bacteria | 266411 |
| 106 | Ga0157374_10111318 | 3300013296 | Bacteria | 2634 |
| 107 | Ga0157372_10000210 | 3300013307 | Bacteria | 65290 |
| 108 | Ga0157372_10355228 | 3300013307 | Bacteria | 1708 |
| 109 | Ga0157375_10000137 | 3300013308 | Bacteria | 72720 |
| 110 | Ga0157375_10010523 | 3300013308 | Bacteria | 8143 |
| 111 | Ga0157375_10139391 | 3300013308 | Bacteria | 2551 |
| 112 | Ga0157380_10000323 | 3300014326 | Bacteria | 28968 |
| 113 | Ga0157380_10019228 | 3300014326 | Bacteria | 5088 |
| 114 | Ga0157379_10179232 | 3300014968 | Bacteria | 1914 |
| 115 | Ga0157376_10019340 | 3300014969 | Bacteria | 5247 |
| 116 | Ga0157376_10050533 | 3300014969 | Bacteria | 3450 |
| 117 | Ga0163161_10000027 | 3300017792 | Bacteria | 197774 |
| 118 | Ga0163161_10008256 | 3300017792 | Bacteria | 7204 |
| 119 | Ga0207656_10000518 | 3300025321 | Bacteria | 12760 |
| 120 | Ga0207682_10000581 | 3300025893 | Bacteria | 16931 |
| 121 | Ga0207642_10000005 | 3300025899 | Bacteria | 401934 |
| 122 | Ga0207642_10000060 | 3300025899 | Bacteria | 32182 |
| 123 | Ga0207710_10000307 | 3300025900 | Bacteria | 38735 |
| 124 | Ga0207680_10013881 | 3300025903 | Bacteria | 4151 |
| 125 | Ga0207685_10000025 | 3300025905 | Bacteria | 110358 |
| 126 | Ga0207707_10007406 | 3300025912 | Bacteria | 9560 |
| 127 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 128 | Ga0207652_10003198 | 3300025921 | Bacteria | 13608 |
| 129 | Ga0207652_10036566 | 3300025921 | Bacteria | 4151 |
| 130 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 131 | Ga0207650_10164838 | 3300025925 | Bacteria | 1758 |
| 132 | Ga0207659_10000018 | 3300025926 | Bacteria | 156920 |
| 133 | Ga0207687_10000015 | 3300025927 | Bacteria | 261701 |
| 134 | Ga0207687_10000020 | 3300025927 | Bacteria | 228407 |
| 135 | Ga0207687_10001054 | 3300025927 | Bacteria | 18684 |
| 136 | Ga0207687_10003325 | 3300025927 | Bacteria | 10858 |
| 137 | Ga0207706_10000017 | 3300025933 | Bacteria | 169589 |
| 138 | Ga0207686_10001224 | 3300025934 | Bacteria | 14908 |
| 139 | Ga0207686_10008569 | 3300025934 | Bacteria | 5525 |
| 140 | Ga0207686_10154594 | 3300025934 | Bacteria | 1601 |
| 141 | Ga0207669_10000003 | 3300025937 | Bacteria | 252239 |
| 142 | Ga0207669_10000056 | 3300025937 | Bacteria | 56304 |
| 143 | Ga0207704_10000026 | 3300025938 | Bacteria | 123892 |
| 144 | Ga0207665_10035261 | 3300025939 | Bacteria | 3320 |
| 145 | Ga0207691_10000002 | 3300025940 | Bacteria | 189785 |
| 146 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 147 | Ga0207689_10266257 | 3300025942 | Bacteria | 1418 |
| 148 | Ga0207661_10000774 | 3300025944 | Bacteria | 20762 |
| 149 | Ga0207661_10010255 | 3300025944 | Bacteria | 6739 |
| 150 | Ga0207661_10026415 | 3300025944 | Bacteria | 4424 |
| 151 | Ga0207661_10029292 | 3300025944 | Bacteria | 4227 |
| 152 | Ga0207661_10044501 | 3300025944 | Bacteria | 3509 |
| 153 | Ga0207651_10001711 | 3300025960 | Bacteria | 10131 |
| 154 | Ga0207712_10000019 | 3300025961 | Bacteria | 317060 |
| 155 | Ga0207712_10117232 | 3300025961 | Bacteria | 2008 |
| 156 | Ga0207640_10001278 | 3300025981 | Bacteria | 13673 |
| 157 | Ga0207640_10013621 | 3300025981 | Bacteria | 4666 |
| 158 | Ga0207658_10110083 | 3300025986 | Bacteria | 2175 |
| 159 | Ga0207677_10000299 | 3300026023 | Bacteria | 37042 |
| 160 | Ga0207677_10000361 | 3300026023 | Bacteria | 31898 |
| 161 | Ga0207703_10000169 | 3300026035 | Bacteria | 76131 |
| 162 | Ga0207703_10000170 | 3300026035 | Bacteria | 75814 |
| 163 | Ga0207703_10137740 | 3300026035 | Bacteria | 2115 |
| 164 | Ga0207678_10000253 | 3300026067 | Bacteria | 48388 |
| 165 | Ga0207678_10166896 | 3300026067 | Bacteria | 1880 |
| 166 | Ga0207702_10000085 | 3300026078 | Bacteria | 106728 |
| 167 | Ga0207702_10003690 | 3300026078 | Bacteria | 13856 |
| 168 | Ga0207641_10000077 | 3300026088 | Bacteria | 144978 |
| 169 | Ga0207641_10003646 | 3300026088 | Bacteria | 13583 |
| 170 | Ga0207648_10013946 | 3300026089 | Bacteria | 7450 |
| 171 | Ga0207676_10000094 | 3300026095 | Bacteria | 80575 |
| 172 | Ga0207683_10006424 | 3300026121 | Bacteria | 10067 |
| 173 | Ga0207683_10116451 | 3300026121 | Bacteria | 2396 |
| 174 | Ga0207698_10000004 | 3300026142 | Bacteria | 313614 |
| 175 | Ga0268266_10000045 | 3300028379 | Bacteria | 312955 |
| 176 | Ga0268266_10000537 | 3300028379 | Bacteria | 52878 |
| 177 | Ga0268266_10149941 | 3300028379 | Bacteria | 2101 |
| 178 | Ga0268265_10027175 | 3300028380 | Bacteria | 4080 |
| 179 | Ga0268264_10001292 | 3300028381 | Bacteria | 23636 |
| 180 | Ga0265337_1000223 | 3300028556 | Bacteria | 30346 |
| 181 | Ga0265326_10000079 | 3300028558 | Bacteria | 51707 |
| 182 | Ga0265319_1000035 | 3300028563 | Bacteria | 117269 |
| 183 | Ga0265322_10000004 | 3300028654 | Bacteria | 275155 |
| 184 | Ga0265336_10008788 | 3300028666 | Bacteria | 3522 |
| 185 | Ga0265338_10000171 | 3300028800 | Bacteria | 120054 |
| 186 | Ga0265324_10001122 | 3300029957 | Bacteria | 16059 |
| 187 | Ga0265328_10006864 | 3300031239 | Bacteria | 4782 |
| 188 | Ga0265320_10000029 | 3300031240 | Bacteria | 159627 |
| 189 | Ga0265325_10010611 | 3300031241 | Bacteria | 5325 |
| 190 | Ga0265331_10005798 | 3300031250 | Bacteria | 7401 |
| 191 | Ga0265327_10000723 | 3300031251 | Bacteria | 51798 |
| 192 | Ga0265314_10000484 | 3300031711 | Bacteria | 52007 |
| 193 | Ga0265342_10017549 | 3300031712 | Bacteria | 4652 |
| 194 | Ga0316576_10003584 | 3300031727 | Bacteria | 9148 |
| 195 | Ga0307415_100017652 | 3300032126 | Bacteria | 4283 |
| 196 | Ga0316574_0000563 | 3300035398 | Bacteria | 15371 |
| 197 | Ga0316574_0035716 | 3300035398 | Bacteria | 3039 |
| 198 | Ga0373937_0028334 | 3300036401 | Bacteria | 5067 |
| 199 | Ga0316584_0031011 | 3300036712 | Bacteria | 3952 |
| 200 | Ga0451807_0659185 | 3300041486 | Bacteria | 2454 |
| 201 | Ga0451833_0471626 | 3300041491 | Bacteria | 2384 |
| 202 | Ga0451839_1641430 | 3300041496 | Bacteria | 1235 |
| 203 | Ga0451849_0021162 | 3300041505 | Bacteria | 1415 |
| 204 | Ga0451853_1364708 | 3300041512 | Bacteria | 2160 |
| 205 | Ga0466967_0000006 | 3300045976 | Bacteria | 144065 |
| 206 | Ga0466967_0007717 | 3300045976 | Bacteria | 7800 |
| 207 | Ga0495592_0008902 | 3300046454 | Bacteria | 7539 |
| 208 | Ga0495592_0026085 | 3300046454 | Bacteria | 4433 |
| 209 | Ga0495592_0076522 | 3300046454 | Bacteria | 2428 |
| 210 | Ga0495603_0000938 | 3300046455 | Bacteria | 16778 |
| 211 | Ga0495603_0001338 | 3300046455 | Bacteria | 14315 |
| 212 | Ga0495629_0013175 | 3300046459 | Bacteria | 5970 |
| 213 | Ga0495638_0019755 | 3300046460 | Bacteria | 4454 |
| 214 | Ga0495641_0000014 | 3300046461 | Bacteria | 140908 |
| 215 | Ga0495641_0019172 | 3300046461 | Bacteria | 3509 |
| 216 | Ga0495641_0039946 | 3300046461 | Bacteria | 2184 |
| 217 | Ga0495653_0011392 | 3300046463 | Bacteria | 7266 |
| 218 | Ga0495653_0099573 | 3300046463 | Bacteria | 2109 |
| 219 | Ga0495653_0187054 | 3300046463 | Bacteria | 1416 |
| 220 | Ga0495582_0000003 | 3300046473 | Bacteria | 168880 |
| 221 | Ga0495662_0005830 | 3300046476 | Bacteria | 6164 |
| 222 | Ga0495662_0032277 | 3300046476 | Bacteria | 2529 |
| 223 | Ga0495594_0000006 | 3300046499 | Bacteria | 167901 |
| 224 | Ga0495608_0007193 | 3300046511 | Bacteria | 7872 |
| 225 | Ga0495608_0009408 | 3300046511 | Bacteria | 6832 |
| 226 | Ga0495618_0000144 | 3300046514 | Bacteria | 50904 |
| 227 | Ga0495620_0000352 | 3300046515 | Bacteria | 31894 |
| 228 | Ga0495628_0000437 | 3300046516 | Bacteria | 37922 |
| 229 | Ga0495628_0014714 | 3300046516 | Bacteria | 6551 |
| 230 | Ga0495630_0000034 | 3300046517 | Bacteria | 126055 |
| 231 | Ga0495630_0002693 | 3300046517 | Bacteria | 12329 |
| 232 | Ga0495630_0043899 | 3300046517 | Bacteria | 3340 |
| 233 | Ga0495630_0087916 | 3300046517 | Bacteria | 2347 |
| 234 | Ga0495630_0187275 | 3300046517 | Bacteria | 1579 |
| 235 | Ga0495644_0001542 | 3300046523 | Bacteria | 9397 |
| 236 | Ga0495652_0000010 | 3300046529 | Bacteria | 261584 |
| 237 | Ga0495652_0010402 | 3300046529 | Bacteria | 8433 |
| 238 | Ga0495652_0193971 | 3300046529 | Bacteria | 1548 |
| 239 | Ga0495640_0034849 | 3300046533 | Bacteria | 3564 |
| 240 | Ga0495586_0001281 | 3300046535 | Bacteria | 14059 |
| 241 | Ga0495587_0006085 | 3300046536 | Bacteria | 7873 |
| 242 | Ga0495587_0057515 | 3300046536 | Bacteria | 2286 |
| 243 | Ga0495621_0004433 | 3300046539 | Bacteria | 3946 |
| 244 | Ga0495645_0002432 | 3300046543 | Bacteria | 12646 |
| 245 | Ga0495622_0000132 | 3300046557 | Bacteria | 63863 |
| 246 | Ga0495633_0067696 | 3300046558 | Bacteria | 1667 |
| 247 | Ga0495667_0000505 | 3300046559 | Bacteria | 24881 |
| 248 | Ga0495667_0075099 | 3300046559 | Bacteria | 2200 |
| 249 | Ga0495667_0093886 | 3300046559 | Bacteria | 1943 |
| 250 | Ga0495634_0000002 | 3300046642 | Bacteria | 247842 |
| 251 | Ga0495634_0000638 | 3300046642 | Bacteria | 34084 |
| 252 | Ga0495634_0002399 | 3300046642 | Bacteria | 15606 |
| 253 | Ga0495625_0000032 | 3300046660 | Bacteria | 233135 |
| 254 | Ga0495625_0154627 | 3300046660 | Bacteria | 1540 |
| 255 | Ga0495635_0000005 | 3300046663 | Bacteria | 302178 |
| 256 | Ga0495635_0101221 | 3300046663 | Bacteria | 1969 |
| 257 | Ga0495657_0031168 | 3300046675 | Bacteria | 3729 |
| 258 | Ga0495599_0096203 | 3300046678 | Bacteria | 1846 |
| 259 | Ga0495647_0000009 | 3300046681 | Bacteria | 94874 |
| 260 | Ga0495647_0000049 | 3300046681 | Bacteria | 34446 |
| 261 | Ga0495647_0006384 | 3300046681 | Bacteria | 3901 |
| 262 | Ga0495658_0000001 | 3300046683 | Bacteria | 385362 |
| 263 | Ga0495658_0003950 | 3300046683 | Bacteria | 7317 |
| 264 | Ga0495669_0000121 | 3300046684 | Bacteria | 50495 |
| 265 | Ga0495669_0010118 | 3300046684 | Bacteria | 3983 |
| 266 | Ga0495613_0001352 | 3300046689 | Bacteria | 18688 |
| 267 | Ga0495613_0077064 | 3300046689 | Unclassified | 2426 |
| 268 | Ga0495613_0206400 | 3300046689 | Bacteria | 1383 |
| 269 | Ga0495624_0001301 | 3300046690 | Bacteria | 19637 |
| 270 | Ga0495624_0029354 | 3300046690 | Bacteria | 3588 |
| 271 | Ga0495624_0091625 | 3300046690 | Bacteria | 1875 |
| 272 | Ga0495670_0010128 | 3300046691 | Bacteria | 4639 |
| 273 | Ga0495600_0002554 | 3300046809 | Bacteria | 10488 |
| 274 | Ga0495600_0148041 | 3300046809 | Bacteria | 1521 |
| 275 | Ga0495604_0000089 | 3300047317 | Bacteria | 77741 |
| 276 | Ga0495674_0000010 | 3300047319 | Bacteria | 285794 |
| 277 | Ga0495674_0017685 | 3300047319 | Bacteria | 6638 |
| 278 | Ga0495676_0000136 | 3300047321 | Bacteria | 55706 |
| 279 | Ga0495676_0000346 | 3300047321 | Bacteria | 37821 |
| 280 | Ga0495676_0123030 | 3300047321 | Bacteria | 1884 |
| 281 | Ga0495680_0000856 | 3300047322 | Bacteria | 33820 |
| 282 | Ga0495680_0010286 | 3300047322 | Bacteria | 8345 |
| 283 | Ga0495680_0023946 | 3300047322 | Bacteria | 5072 |
| 284 | Ga0495675_0089752 | 3300047444 | Bacteria | 1929 |
| 285 | Ga0495679_004872 | 3300047446 | Bacteria | 6061 |
| 286 | Ga0495684_0213203 | 3300047471 | Bacteria | 1419 |
| 287 | Ga0495593_0081916 | 3300047673 | Bacteria | 1668 |
| 288 | Ga0495602_0004094 | 3300048088 | Bacteria | 15176 |
| 289 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 290 | Ga0496100_0000014 | 3300048903 | Bacteria | 174991 |
| 291 | Ga0496101_0000028 | 3300048904 | Bacteria | 198664 |
| 292 | Ga0496101_0000036 | 3300048904 | Bacteria | 175595 |
| 293 | Ga0496101_0219864 | 3300048904 | Bacteria | 1474 |
| 294 | Ga0496102_0000561 | 3300048905 | Bacteria | 39545 |
| 295 | Ga0496103_0000057 | 3300048906 | Bacteria | 142223 |
| 296 | Ga0496103_0076788 | 3300048906 | Bacteria | 2097 |
| 297 | Ga0496104_0000010 | 3300048907 | Bacteria | 475255 |
| 298 | Ga0496104_0000024 | 3300048907 | Bacteria | 229913 |
| 299 | Ga0496104_0000213 | 3300048907 | Bacteria | 51219 |
| 300 | Ga0496105_0000005 | 3300048908 | Bacteria | 475797 |
| 301 | Ga0496105_0000013 | 3300048908 | Bacteria | 229894 |
| 302 | Ga0496105_0002964 | 3300048908 | Bacteria | 12459 |
| 303 | Ga0496105_0015185 | 3300048908 | Bacteria | 6132 |
| 304 | Ga0496105_0324190 | 3300048908 | Bacteria | 1234 |
| 305 | Ga0496106_0000055 | 3300048909 | Bacteria | 91570 |
| 306 | Ga0496106_0000111 | 3300048909 | Bacteria | 63431 |
| 307 | Ga0496106_0000475 | 3300048909 | Bacteria | 28606 |
| 308 | Ga0496106_0099358 | 3300048909 | Unclassified | 2256 |
| 309 | Ga0496107_0000002 | 3300048910 | Bacteria | 320871 |
| 310 | Ga0496107_0000022 | 3300048910 | Bacteria | 128991 |
| 311 | Ga0496107_0057106 | 3300048910 | Bacteria | 2821 |
| 312 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 313 | Ga0496108_0000120 | 3300048911 | Bacteria | 77596 |
| 314 | Ga0496108_0081368 | 3300048911 | Bacteria | 2744 |
| 315 | Ga0496109_0000004 | 3300048912 | Bacteria | 404818 |
| 316 | Ga0496109_0000044 | 3300048912 | Bacteria | 133779 |
| 317 | Ga0496109_0066530 | 3300048912 | Bacteria | 3300 |
| 318 | Ga0496109_0126637 | 3300048912 | Bacteria | 2382 |
| 319 | Ga0496109_0281112 | 3300048912 | Bacteria | 1568 |
| 320 | Ga0496110_0001628 | 3300048913 | Bacteria | 16468 |
| 321 | Ga0496110_0011973 | 3300048913 | Bacteria | 7124 |
| 322 | Ga0496110_0114365 | 3300048913 | Bacteria | 2428 |
| 323 | Ga0496110_0115596 | 3300048913 | Bacteria | 2415 |
| 324 | Ga0496111_0000117 | 3300048914 | Bacteria | 34553 |
| 325 | Ga0496111_0005401 | 3300048914 | Bacteria | 8184 |
| 326 | Ga0496111_0043096 | 3300048914 | Bacteria | 3243 |
| 327 | Ga0496112_0000013 | 3300048915 | Bacteria | 237194 |
| 328 | Ga0496112_0003359 | 3300048915 | Bacteria | 13208 |
| 329 | Ga0496112_0284802 | 3300048915 | Unclassified | 1599 |
| 330 | Ga0496113_0000001 | 3300048916 | Bacteria | 224977 |
| 331 | Ga0496113_0012131 | 3300048916 | Bacteria | 5782 |
| 332 | Ga0496113_0014085 | 3300048916 | Bacteria | 5444 |
| 333 | Ga0496113_0029881 | 3300048916 | Bacteria | 3940 |
| 334 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 335 | Ga0496114_0002941 | 3300048917 | Bacteria | 13063 |
| 336 | Ga0496115_0000016 | 3300048918 | Bacteria | 187067 |
| 337 | Ga0496115_0000031 | 3300048918 | Bacteria | 138258 |
| 338 | Ga0496115_0004971 | 3300048918 | Bacteria | 9656 |
| 339 | Ga0496116_0000257 | 3300048919 | Bacteria | 93214 |
| 340 | Ga0496119_0009468 | 3300048922 | Bacteria | 8352 |
| 341 | Ga0496119_0013765 | 3300048922 | Bacteria | 6405 |
| 342 | Ga0496119_0015137 | 3300048922 | Bacteria | 5970 |
| 343 | Ga0496119_0020085 | 3300048922 | Bacteria | 4886 |
| 344 | Ga0496120_0001948 | 3300048923 | Bacteria | 22617 |
| 345 | Ga0496120_0019904 | 3300048923 | Bacteria | 4280 |
| 346 | Ga0496121_0011390 | 3300048924 | Bacteria | 9884 |
| 347 | Ga0496121_0031400 | 3300048924 | Bacteria | 4853 |
| 348 | Ga0496121_0075941 | 3300048924 | Bacteria | 2682 |
| 349 | Ga0496124_0045846 | 3300048927 | Bacteria | 3747 |
| 350 | Ga0496125_0050954 | 3300048928 | Bacteria | 3420 |
| 351 | Ga0496126_0026312 | 3300048929 | Bacteria | 5580 |
| 352 | Ga0501031_0002912 | 3300049568 | Bacteria | 10943 |
| 353 | Ga0501032_0005064 | 3300049569 | Bacteria | 9845 |
| 354 | Ga0501033_0000283 | 3300049570 | Bacteria | 48801 |
| 355 | Ga0501034_0066118 | 3300049571 | Bacteria | 3628 |
| 356 | Ga0501034_0214744 | 3300049571 | Unclassified | 1878 |
| 357 | Ga0501036_0004416 | 3300049572 | Bacteria | 11353 |
| 358 | Ga0501036_0277483 | 3300049572 | Bacteria | 1403 |
| 359 | Ga0501037_0007698 | 3300049573 | Bacteria | 7884 |
| 360 | Ga0501037_0152875 | 3300049573 | Bacteria | 1649 |
| 361 | Ga0501038_0001500 | 3300049574 | Bacteria | 21463 |
| 362 | Ga0501039_0037581 | 3300049575 | Bacteria | 3738 |
| 363 | Ga0501042_0018761 | 3300049578 | Bacteria | 4794 |
| 364 | Ga0501043_0000291 | 3300049579 | Bacteria | 45276 |
| 365 | Ga0501046_0000313 | 3300049580 | Bacteria | 48865 |
| 366 | Ga0501047_0000313 | 3300049581 | Bacteria | 55964 |
| 367 | Ga0501047_0007896 | 3300049581 | Bacteria | 10033 |
| 368 | Ga0501047_0125180 | 3300049581 | Bacteria | 2451 |
| 369 | Ga0501048_0004263 | 3300049582 | Bacteria | 10896 |
| 370 | Ga0501068_0022157 | 3300049584 | Bacteria | 3712 |
| 371 | Ga0501070_0000308 | 3300049586 | Bacteria | 44689 |
| 372 | Ga0501070_0008194 | 3300049586 | Bacteria | 8837 |
| 373 | Ga0501073_0004201 | 3300049589 | Bacteria | 10798 |
| 374 | Ga0501075_0034640 | 3300049591 | Bacteria | 3760 |
| 375 | Ga0501079_0068352 | 3300049741 | Bacteria | 2742 |
| 376 | Ga0501080_0012300 | 3300049742 | Bacteria | 7841 |
| 377 | Ga0501081_0096977 | 3300049743 | Bacteria | 2080 |
| 378 | Ga0501083_0006480 | 3300049744 | Bacteria | 8304 |
| 379 | Ga0501035_0000405 | 3300049822 | Bacteria | 48987 |
| 380 | Ga0501035_0220104 | 3300049822 | Bacteria | 1621 |
| 381 | Ga0501044_0000211 | 3300049823 | Bacteria | 73920 |
| 382 | Ga0501044_0216624 | 3300049823 | Bacteria | 1867 |
| 383 | Ga0501045_0130945 | 3300049824 | Bacteria | 1865 |
| 384 | Ga0501045_0148559 | 3300049824 | Bacteria | 1743 |
| 385 | nmdc:mga03n38_25058_c1 | 3300050490 | Bacteria | 2445 |
| 386 | nmdc:mga00v17_56311_c1 | 3300050491 | Unclassified | 2403 |
| 387 | nmdc:mga00v17_68492_c1 | 3300050491 | Bacteria | 2194 |
| 388 | nmdc:mga0yw44_115860_c1 | 3300050492 | Bacteria | 1722 |
| 389 | nmdc:mga0yw44_257787_c1 | 3300050492 | Unclassified | 1162 |
| 390 | nmdc:mga0a205_1185_c1 | 3300050515 | Bacteria | 21788 |
| 391 | nmdc:mga0a205_94_c1 | 3300050515 | Bacteria | 50261 |
| 392 | Ga0495601_0000330 | 3300053077 | Bacteria | 25170 |
| 393 | Ga0495601_0009240 | 3300053077 | Bacteria | 5827 |
| 394 | Ga0495601_0031969 | 3300053077 | Bacteria | 3273 |
| 395 | Ga0495612_0000031 | 3300053078 | Bacteria | 80955 |
| 396 | Ga0495612_0004069 | 3300053078 | Bacteria | 6057 |
| 397 | Ga0495612_0076281 | 3300053078 | Bacteria | 1404 |
| 398 | Ga0495655_0000005 | 3300053083 | Bacteria | 257472 |
| 399 | Ga0495595_0003902 | 3300053084 | Bacteria | 5950 |
| 400 | Ga0495619_0000010 | 3300053085 | Bacteria | 302390 |
| 401 | Ga0495619_0000144 | 3300053085 | Bacteria | 52554 |
| 402 | Ga0495619_0000146 | 3300053085 | Bacteria | 52136 |
| 403 | Ga0495619_0000412 | 3300053085 | Bacteria | 29043 |
| 404 | Ga0495619_0001825 | 3300053085 | Bacteria | 14157 |
| 405 | Ga0495619_0016018 | 3300053085 | Bacteria | 4745 |
| 406 | Ga0495619_0040172 | 3300053085 | Bacteria | 3057 |
| 407 | Ga0500566_0012661 | 3300053094 | Bacteria | 4962 |
| 408 | Ga0500641_0001087 | 3300053096 | Bacteria | 9671 |
| 409 | Ga0500614_000632 | 3300053123 | Bacteria | 8960 |
| 410 | Ga0500628_000025 | 3300053129 | Bacteria | 62808 |
| 411 | Ga0495662_0039154 | |||
| 412 | JGI24746J21847_1000324 | |||
| 413 | JGI24740J21852_10003899 | |||
| 414 | JGI24034J26672_10000321 | |||
| 415 | JGI25404J52841_10000379 | |||
| 416 | Ga0070683_100016420 | |||
| 417 | Ga0070683_100043999 | |||
| 418 | Ga0070683_100088535 | |||
| 419 | Ga0070683_100165254 | |||
| 420 | Ga0070677_10000322 | |||
| 421 | Ga0068869_100243350 | |||
| 422 | Ga0070682_100000011 | |||
| 423 | Ga0070682_100000030 | |||
| 424 | Ga0070682_100049311 | |||
| 425 | Ga0068868_100000445 | |||
| 426 | Ga0068868_100002347 | |||
| 427 | Ga0070691_10000270 | |||
| 428 | Ga0070691_10008904 | |||
| 429 | Ga0070675_100000028 | |||
| 430 | Ga0070674_100000002 | |||
| 431 | Ga0070674_100000004 | |||
| 432 | Ga0070673_100004080 | |||
| 433 | Ga0070688_100000251 | |||
| 434 | Ga0070688_100000368 | |||
| 435 | Ga0070667_100013105 | |||
| 436 | Ga0070667_100075761 | |||
| 437 | Ga0070667_100135683 | |||
| 438 | Ga0070714_100035345 | |||
| 439 | Ga0070663_100000065 | |||
| 440 | Ga0070678_100168254 | |||
| 441 | Ga0070662_100000006 | |||
| 442 | Ga0070681_10004368 | |||
| 443 | Ga0070681_10062304 | |||
| 444 | Ga0068867_100008063 | |||
| 445 | Ga0070685_10000053 | |||
| 446 | Ga0070685_10000301 | |||
| 447 | Ga0070685_10052845 | |||
| 448 | Ga0070679_100000461 | |||
| 449 | Ga0070679_100020836 | |||
| 450 | Ga0070684_100048504 | |||
| 451 | Ga0070684_100118311 | |||
| 452 | Ga0070684_100186689 | |||
| 453 | Ga0068853_100010340 | |||
| 454 | Ga0070672_100000049 | |||
| 455 | Ga0070693_100009223 | |||
| 456 | Ga0070665_100000040 | |||
| 457 | Ga0070665_100162333 | |||
| 458 | Ga0070704_100049578 | |||
| 459 | Ga0068855_100374582 | |||
| 460 | Ga0070664_100072547 | |||
| 461 | Ga0070664_100100239 | |||
| 462 | Ga0068854_100025675 | |||
| 463 | Ga0068854_100055889 | |||
| 464 | Ga0068856_100000377 | |||
| 465 | Ga0068856_100006911 | |||
| 466 | Ga0068856_100016576 | |||
| 467 | Ga0068852_100000539 | |||
| 468 | Ga0068852_100129237 | |||
| 469 | Ga0068852_100309271 | |||
| 470 | Ga0068864_100000053 | |||
| 471 | Ga0068866_10000004 | |||
| 472 | Ga0068866_10000036 | |||
| 473 | Ga0068851_10004698 | |||
| 474 | Ga0068863_100000432 | |||
| 475 | Ga0068863_100022480 | |||
| 476 | Ga0068858_100000526 | |||
| 477 | Ga0068858_100002599 | |||
| 478 | Ga0068860_100001579 | |||
| 479 | Ga0068860_100318189 | |||
| 480 | Ga0068862_100013486 | |||
| 481 | Ga0081540_1000129 | |||
| 482 | Ga0081539_10002112 | |||
| 483 | Ga0081539_10053708 | |||
| 484 | Ga0075363_100057095 | |||
| 485 | Ga0075364_10049918 | |||
| 486 | Ga0075364_10063096 | |||
| 487 | Ga0070715_10000014 | |||
| 488 | Ga0070716_100014183 | |||
| 489 | Ga0075433_10000051 | |||
| 490 | Ga0075433_10004054 | |||
| 491 | Ga0068865_100000042 | |||
| 492 | Ga0105240_10464644 | |||
| 493 | Ga0105245_10000104 | |||
| 494 | Ga0105245_10000143 | |||
| 495 | Ga0105245_10000917 | |||
| 496 | Ga0105245_10003306 | |||
| 497 | Ga0105245_10266227 | |||
| 498 | Ga0105247_10000249 | |||
| 499 | Ga0105247_10115254 | |||
| 500 | Ga0105243_10004539 | |||
| 501 | Ga0105242_10000034 | |||
| 502 | Ga0105242_10001234 | |||
| 503 | Ga0105242_10077200 | |||
| 504 | Ga0105242_10175768 | |||
| 505 | Ga0105248_10000175 | |||
| 506 | Ga0105237_10473507 | |||
| 507 | Ga0105238_10000009 | |||
| 508 | Ga0105249_10000070 | |||
| 509 | Ga0105249_10009609 | |||
| 510 | Ga0105249_10092553 | |||
| 511 | Ga0105239_10095374 | |||
| 512 | Ga0105246_10065860 | |||
| 513 | Ga0157371_10003743 | |||
| 514 | Ga0157370_10003852 | |||
| 515 | Ga0157369_10000014 | |||
| 516 | Ga0157374_10111318 | |||
| 517 | Ga0157372_10000210 | |||
| 518 | Ga0157372_10355228 | |||
| 519 | Ga0157375_10000137 | |||
| 520 | Ga0157375_10010523 | |||
| 521 | Ga0157375_10139391 | |||
| 522 | Ga0157380_10000323 | |||
| 523 | Ga0157380_10019228 | |||
| 524 | Ga0157379_10179232 | |||
| 525 | Ga0157376_10019340 | |||
| 526 | Ga0157376_10050533 | |||
| 527 | Ga0163161_10000027 | |||
| 528 | Ga0163161_10008256 | |||
| 529 | Ga0207656_10000518 | |||
| 530 | Ga0207682_10000581 | |||
| 531 | Ga0207642_10000005 | |||
| 532 | Ga0207642_10000060 | |||
| 533 | Ga0207710_10000307 | |||
| 534 | Ga0207680_10013881 | |||
| 535 | Ga0207685_10000025 | |||
| 536 | Ga0207707_10007406 | |||
| 537 | Ga0207649_10000003 | |||
| 538 | Ga0207652_10003198 | |||
| 539 | Ga0207652_10036566 | |||
| 540 | Ga0207694_10000004 | |||
| 541 | Ga0207650_10164838 | |||
| 542 | Ga0207659_10000018 | |||
| 543 | Ga0207687_10000015 | |||
| 544 | Ga0207687_10000020 | |||
| 545 | Ga0207687_10001054 | |||
| 546 | Ga0207687_10003325 | |||
| 547 | Ga0207706_10000017 | |||
| 548 | Ga0207686_10001224 | |||
| 549 | Ga0207686_10008569 | |||
| 550 | Ga0207686_10154594 | |||
| 551 | Ga0207669_10000003 | |||
| 552 | Ga0207669_10000056 | |||
| 553 | Ga0207704_10000026 | |||
| 554 | Ga0207665_10035261 | |||
| 555 | Ga0207691_10000002 | |||
| 556 | Ga0207711_10000006 | |||
| 557 | Ga0207689_10266257 | |||
| 558 | Ga0207661_10000774 | |||
| 559 | Ga0207661_10010255 | |||
| 560 | Ga0207661_10026415 | |||
| 561 | Ga0207661_10029292 | |||
| 562 | Ga0207661_10044501 | |||
| 563 | Ga0207651_10001711 | |||
| 564 | Ga0207712_10000019 | |||
| 565 | Ga0207712_10117232 | |||
| 566 | Ga0207640_10001278 | |||
| 567 | Ga0207640_10013621 | |||
| 568 | Ga0207658_10110083 | |||
| 569 | Ga0207677_10000299 | |||
| 570 | Ga0207677_10000361 | |||
| 571 | Ga0207703_10000169 | |||
| 572 | Ga0207703_10000170 | |||
| 573 | Ga0207703_10137740 | |||
| 574 | Ga0207678_10000253 | |||
| 575 | Ga0207678_10166896 | |||
| 576 | Ga0207702_10000085 | |||
| 577 | Ga0207702_10003690 | |||
| 578 | Ga0207641_10000077 | |||
| 579 | Ga0207641_10003646 | |||
| 580 | Ga0207648_10013946 | |||
| 581 | Ga0207676_10000094 | |||
| 582 | Ga0207683_10006424 | |||
| 583 | Ga0207683_10116451 | |||
| 584 | Ga0207698_10000004 | |||
| 585 | Ga0268266_10000045 | |||
| 586 | Ga0268266_10000537 | |||
| 587 | Ga0268266_10149941 | |||
| 588 | Ga0268265_10027175 | |||
| 589 | Ga0268264_10001292 | |||
| 590 | Ga0265337_1000223 | |||
| 591 | Ga0265326_10000079 | |||
| 592 | Ga0265319_1000035 | |||
| 593 | Ga0265322_10000004 | |||
| 594 | Ga0265336_10008788 | |||
| 595 | Ga0265338_10000171 | |||
| 596 | Ga0265324_10001122 | |||
| 597 | Ga0265328_10006864 | |||
| 598 | Ga0265320_10000029 | |||
| 599 | Ga0265325_10010611 | |||
| 600 | Ga0265331_10005798 | |||
| 601 | Ga0265327_10000723 | |||
| 602 | Ga0265314_10000484 | |||
| 603 | Ga0265342_10017549 | |||
| 604 | Ga0316576_10003584 | |||
| 605 | Ga0307415_100017652 | |||
| 606 | Ga0316574_0000563 | |||
| 607 | Ga0316574_0035716 | |||
| 608 | Ga0373937_0028334 | |||
| 609 | Ga0316584_0031011 | |||
| 610 | Ga0451807_0659185 | |||
| 611 | Ga0451833_0471626 | |||
| 612 | Ga0451839_1641430 | |||
| 613 | Ga0451849_0021162 | |||
| 614 | Ga0451853_1364708 | |||
| 615 | Ga0466967_0000006 | |||
| 616 | Ga0466967_0007717 | |||
| 617 | Ga0495592_0008902 | |||
| 618 | Ga0495592_0026085 | |||
| 619 | Ga0495592_0076522 | |||
| 620 | Ga0495603_0000938 | |||
| 621 | Ga0495603_0001338 | |||
| 622 | Ga0495629_0013175 | |||
| 623 | Ga0495638_0019755 | |||
| 624 | Ga0495641_0000014 | |||
| 625 | Ga0495641_0019172 | |||
| 626 | Ga0495641_0039946 | |||
| 627 | Ga0495653_0011392 | |||
| 628 | Ga0495653_0099573 | |||
| 629 | Ga0495653_0187054 | |||
| 630 | Ga0495582_0000003 | |||
| 631 | Ga0495662_0005830 | |||
| 632 | Ga0495662_0032277 | |||
| 633 | Ga0495594_0000006 | |||
| 634 | Ga0495608_0007193 | |||
| 635 | Ga0495608_0009408 | |||
| 636 | Ga0495618_0000144 | |||
| 637 | Ga0495620_0000352 | |||
| 638 | Ga0495628_0000437 | |||
| 639 | Ga0495628_0014714 | |||
| 640 | Ga0495630_0000034 | |||
| 641 | Ga0495630_0002693 | |||
| 642 | Ga0495630_0043899 | |||
| 643 | Ga0495630_0087916 | |||
| 644 | Ga0495630_0187275 | |||
| 645 | Ga0495644_0001542 | |||
| 646 | Ga0495652_0000010 | |||
| 647 | Ga0495652_0010402 | |||
| 648 | Ga0495652_0193971 | |||
| 649 | Ga0495640_0034849 | |||
| 650 | Ga0495586_0001281 | |||
| 651 | Ga0495587_0006085 | |||
| 652 | Ga0495587_0057515 | |||
| 653 | Ga0495621_0004433 | |||
| 654 | Ga0495645_0002432 | |||
| 655 | Ga0495622_0000132 | |||
| 656 | Ga0495633_0067696 | |||
| 657 | Ga0495667_0000505 | |||
| 658 | Ga0495667_0075099 | |||
| 659 | Ga0495667_0093886 | |||
| 660 | Ga0495634_0000002 | |||
| 661 | Ga0495634_0000638 | |||
| 662 | Ga0495634_0002399 | |||
| 663 | Ga0495625_0000032 | |||
| 664 | Ga0495625_0154627 | |||
| 665 | Ga0495635_0000005 | |||
| 666 | Ga0495635_0101221 | |||
| 667 | Ga0495657_0031168 | |||
| 668 | Ga0495599_0096203 | |||
| 669 | Ga0495647_0000009 | |||
| 670 | Ga0495647_0000049 | |||
| 671 | Ga0495647_0006384 | |||
| 672 | Ga0495658_0000001 | |||
| 673 | Ga0495658_0003950 | |||
| 674 | Ga0495669_0000121 | |||
| 675 | Ga0495669_0010118 | |||
| 676 | Ga0495613_0001352 | |||
| 677 | Ga0495613_0077064 | |||
| 678 | Ga0495613_0206400 | |||
| 679 | Ga0495624_0001301 | |||
| 680 | Ga0495624_0029354 | |||
| 681 | Ga0495624_0091625 | |||
| 682 | Ga0495670_0010128 | |||
| 683 | Ga0495600_0002554 | |||
| 684 | Ga0495600_0148041 | |||
| 685 | Ga0495604_0000089 | |||
| 686 | Ga0495674_0000010 | |||
| 687 | Ga0495674_0017685 | |||
| 688 | Ga0495676_0000136 | |||
| 689 | Ga0495676_0000346 | |||
| 690 | Ga0495676_0123030 | |||
| 691 | Ga0495680_0000856 | |||
| 692 | Ga0495680_0010286 | |||
| 693 | Ga0495680_0023946 | |||
| 694 | Ga0495675_0089752 | |||
| 695 | Ga0495679_004872 | |||
| 696 | Ga0495684_0213203 | |||
| 697 | Ga0495593_0081916 | |||
| 698 | Ga0495602_0004094 | |||
| 699 | Ga0496100_0000001 | |||
| 700 | Ga0496100_0000014 | |||
| 701 | Ga0496101_0000028 | |||
| 702 | Ga0496101_0000036 | |||
| 703 | Ga0496101_0219864 | |||
| 704 | Ga0496102_0000561 | |||
| 705 | Ga0496103_0000057 | |||
| 706 | Ga0496103_0076788 | |||
| 707 | Ga0496104_0000010 | |||
| 708 | Ga0496104_0000024 | |||
| 709 | Ga0496104_0000213 | |||
| 710 | Ga0496105_0000005 | |||
| 711 | Ga0496105_0000013 | |||
| 712 | Ga0496105_0002964 | |||
| 713 | Ga0496105_0015185 | |||
| 714 | Ga0496105_0324190 | |||
| 715 | Ga0496106_0000055 | |||
| 716 | Ga0496106_0000111 | |||
| 717 | Ga0496106_0000475 | |||
| 718 | Ga0496106_0099358 | |||
| 719 | Ga0496107_0000002 | |||
| 720 | Ga0496107_0000022 | |||
| 721 | Ga0496107_0057106 | |||
| 722 | Ga0496108_0000006 | |||
| 723 | Ga0496108_0000120 | |||
| 724 | Ga0496108_0081368 | |||
| 725 | Ga0496109_0000004 | |||
| 726 | Ga0496109_0000044 | |||
| 727 | Ga0496109_0066530 | |||
| 728 | Ga0496109_0126637 | |||
| 729 | Ga0496109_0281112 | |||
| 730 | Ga0496110_0001628 | |||
| 731 | Ga0496110_0011973 | |||
| 732 | Ga0496110_0114365 | |||
| 733 | Ga0496110_0115596 | |||
| 734 | Ga0496111_0000117 | |||
| 735 | Ga0496111_0005401 | |||
| 736 | Ga0496111_0043096 | |||
| 737 | Ga0496112_0000013 | |||
| 738 | Ga0496112_0003359 | |||
| 739 | Ga0496112_0284802 | |||
| 740 | Ga0496113_0000001 | |||
| 741 | Ga0496113_0012131 | |||
| 742 | Ga0496113_0014085 | |||
| 743 | Ga0496113_0029881 | |||
| 744 | Ga0496114_0000003 | |||
| 745 | Ga0496114_0002941 | |||
| 746 | Ga0496115_0000016 | |||
| 747 | Ga0496115_0000031 | |||
| 748 | Ga0496115_0004971 | |||
| 749 | Ga0496116_0000257 | |||
| 750 | Ga0496119_0009468 | |||
| 751 | Ga0496119_0013765 | |||
| 752 | Ga0496119_0015137 | |||
| 753 | Ga0496119_0020085 | |||
| 754 | Ga0496120_0001948 | |||
| 755 | Ga0496120_0019904 | |||
| 756 | Ga0496121_0011390 | |||
| 757 | Ga0496121_0031400 | |||
| 758 | Ga0496121_0075941 | |||
| 759 | Ga0496124_0045846 | |||
| 760 | Ga0496125_0050954 | |||
| 761 | Ga0496126_0026312 | |||
| 762 | Ga0501031_0002912 | |||
| 763 | Ga0501032_0005064 | |||
| 764 | Ga0501033_0000283 | |||
| 765 | Ga0501034_0066118 | |||
| 766 | Ga0501034_0214744 | |||
| 767 | Ga0501036_0004416 | |||
| 768 | Ga0501036_0277483 | |||
| 769 | Ga0501037_0007698 | |||
| 770 | Ga0501037_0152875 | |||
| 771 | Ga0501038_0001500 | |||
| 772 | Ga0501039_0037581 | |||
| 773 | Ga0501042_0018761 | |||
| 774 | Ga0501043_0000291 | |||
| 775 | Ga0501046_0000313 | |||
| 776 | Ga0501047_0000313 | |||
| 777 | Ga0501047_0007896 | |||
| 778 | Ga0501047_0125180 | |||
| 779 | Ga0501048_0004263 | |||
| 780 | Ga0501068_0022157 | |||
| 781 | Ga0501070_0000308 | |||
| 782 | Ga0501070_0008194 | |||
| 783 | Ga0501073_0004201 | |||
| 784 | Ga0501075_0034640 | |||
| 785 | Ga0501079_0068352 | |||
| 786 | Ga0501080_0012300 | |||
| 787 | Ga0501081_0096977 | |||
| 788 | Ga0501083_0006480 | |||
| 789 | Ga0501035_0000405 | |||
| 790 | Ga0501035_0220104 | |||
| 791 | Ga0501044_0000211 | |||
| 792 | Ga0501044_0216624 | |||
| 793 | Ga0501045_0130945 | |||
| 794 | Ga0501045_0148559 | |||
| 795 | nmdc:mga03n38_25058_c1 | |||
| 796 | nmdc:mga00v17_56311_c1 | |||
| 797 | nmdc:mga00v17_68492_c1 | |||
| 798 | nmdc:mga0yw44_115860_c1 | |||
| 799 | nmdc:mga0yw44_257787_c1 | |||
| 800 | nmdc:mga0a205_1185_c1 | |||
| 801 | nmdc:mga0a205_94_c1 | |||
| 802 | Ga0495601_0000330 | |||
| 803 | Ga0495601_0009240 | |||
| 804 | Ga0495601_0031969 | |||
| 805 | Ga0495612_0000031 | |||
| 806 | Ga0495612_0004069 | |||
| 807 | Ga0495612_0076281 | |||
| 808 | Ga0495655_0000005 | |||
| 809 | Ga0495595_0003902 | |||
| 810 | Ga0495619_0000010 | |||
| 811 | Ga0495619_0000144 | |||
| 812 | Ga0495619_0000146 | |||
| 813 | Ga0495619_0000412 | |||
| 814 | Ga0495619_0001825 | |||
| 815 | Ga0495619_0016018 | |||
| 816 | Ga0495619_0040172 | |||
| 817 | Ga0500566_0012661 | |||
| 818 | Ga0500641_0001087 | |||
| 819 | Ga0500614_000632 | |||
| 820 | Ga0500628_000025 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bas-assembly1.cif.gz_A | crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) | 0.8041 | 31 | 387 |
| 6bar-assembly1.cif.gz_A | crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) | 0.8014 | 31 | 387 |
| 6pl6-assembly1.cif.gz_A | structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex | 0.7941 | 31 | 390 |
| 6bas-assembly1.cif.gz_A | crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) | 0.7801 | 31 | 387 |
| 6pl6-assembly1.cif.gz_A | structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex | 0.7796 | 31 | 390 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4I924_23_177_1.20.940.10 | Mainly Alpha;Up-down Bundle;RNA Binding Protein, Prp18; Chain A;Functional domain of the splicing factor Prp18 | 0.345 | 52 | 201 | 1.20.940.10 |
| af_D3Z868_1_172_1.25.40.270 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Vacuolar protein sorting-associated protein vta1 | 0.3441 | 43 | 216 | 1.25.40.270 |
| af_O02096_39_207_1.25.40.330 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Adenylate cyclase-associated CAP, N-terminal domain | 0.3418 | 237 | 356 | 1.25.40.330 |
| af_D3Z868_1_172_1.25.40.270 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Vacuolar protein sorting-associated protein vta1 | 0.326 | 43 | 216 | 1.25.40.270 |
| af_P9WFR7_179_308_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.3236 | 254 | 395 | 1.20.120.550 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5B8U9I7-F1-model_v4 | peptidoglycan glycosyltransferase (EC 2.4.99.28) | 0.862 | 31 | 395 |
GO:0005886
GO:0008360 GO:0009252 GO:0015648 GO:0016757 GO:0032153 GO:0051301 GO:0071555 |
| AF-A0A538EL08-F1-model_v4 | Rod shape-determining protein RodA | 0.8601 | 25 | 394 |
GO:0005886
GO:0008360 GO:0015648 GO:0016740 GO:0032153 GO:0051301 |
| AF-A0A2H0YSQ6-F1-model_v4 | Rod shape-determining protein RodA | 0.8595 | 24 | 395 |
GO:0005886
GO:0008360 GO:0009252 GO:0015648 GO:0016757 GO:0032153 GO:0051301 GO:0071555 |
| AF-A0A1F2WS17-F1-model_v4 | Rod shape-determining protein RodA | 0.8594 | 31 | 391 |
GO:0005886
GO:0008360 GO:0015648 GO:0016740 GO:0032153 GO:0051301 |
| AF-A0A537TP45-F1-model_v4 | peptidoglycan glycosyltransferase (EC 2.4.99.28) | 0.855 | 14 | 396 |
GO:0005886
GO:0008360 GO:0009252 GO:0015648 GO:0016757 GO:0032153 GO:0051301 GO:0071555 |