F437397

General Info

Members Datasets Scaffolds Average Seq Length
410 352 201 284

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2738541293|2738800402
Length 323
Sequence PGETRRKLTTIFSADVQDYTRLMGADEEGTLATLKRYRDRMSRLIEAHGGRVVNTWGDGLIAEFPSVVEAVRAAVDVQNELAGLNAARPADGRMLFRIGINLGDVIVEGSDIYGDGVNIAARLQAQAPAGGVVISNTVYDQVRNKVAVGFDFLGPLNVKNVAEAVPSYAVRIGEDAGDTTTGHVHAAGMPSGAAARSTGPGLLAGDRPGPLAGVLPGQRGGQSVDQRRNLAVLGVIAVALVVINTLTWHGVFWAAWPLLALAYVAAMRWAHLQDRFDLRLAALAISALGLIGINLLSWHGTFWAIWPLLAIAVVAGLRWARRG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
8 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
9 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
10 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
11 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
12 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
13 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
14 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
15 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
16 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
17 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
18 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
19 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
20 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
21 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
22 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
23 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
24 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
25 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
26 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
27 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
28 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
29 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
30 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
31 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
32 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
33 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
34 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
35 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
36 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
37 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
38 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
39 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
40 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
41 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
42 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
43 2643221599 Rhizobium sp. Root708 Isolate Unclassified
44 2643221607 Rhizobium sp. Root73 Isolate Unclassified
45 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
46 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
47 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
48 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
49 2718217882 Rhizobium sp. N741 Isolate Nodule
50 2718217927 Rhizobium sp. N324 Isolate Nodule
51 2718218009 Rhizobium sp. N561 Isolate Nodule
52 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
53 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
54 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
55 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
56 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
57 2718218363 Rhizobium sp. N113 Isolate Nodule
58 2718218365 Rhizobium sp. N731 Isolate Nodule
59 2718218366 Rhizobium sp. N621 Isolate Nodule
60 2718218423 Rhizobium sp. N941 Isolate Nodule
61 2721755514 Rhizobium sp. N6212 Isolate Nodule
62 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
63 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
64 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
65 2721755809 Rhizobium sp. N541 Isolate Nodule
66 2721755810 Rhizobium sp. N871 Isolate Nodule
67 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
68 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
69 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
70 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
71 2728369365 Rhizobium sp. N1341 Isolate Nodule
72 2728369397 Rhizobium sp. N1314 Isolate Nodule
73 2738541293 Rhizobium sp. GV031 Isolate Unclassified
74 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
75 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
76 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
77 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
78 2791355260 Rhizobium sp. L9 Isolate Nodule
79 2791355261 Rhizobium sp. J15 Isolate Nodule
80 2791355263 Rhizobium chutanense C5 Isolate Nodule
81 2791355264 Rhizobium sp. S9 Isolate Nodule
82 2791355265 Rhizobium sp. H4 Isolate Nodule
83 2791355266 Rhizobium sp. L43 Isolate Nodule
84 2791355267 Rhizobium sp. L18 Isolate Nodule
85 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
86 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
87 2802429633 Rhizobium anhuiense J3 Isolate Nodule
88 2802429634 Rhizobium anhuiense S10 Isolate Nodule
89 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
90 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
91 2802429637 Rhizobium anhuiense C15 Isolate Nodule
92 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
93 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
94 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
95 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
96 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
97 2838048938 Rhizobium pisi 27/80 Isolate Nodule
98 2838061910 Rhizobium phaseoli L15 Isolate Nodule
99 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
100 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
101 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
102 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
103 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
104 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
105 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
106 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
107 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
108 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
109 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
110 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
111 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
112 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
113 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
114 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
115 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
116 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
117 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
118 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
119 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
120 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
121 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
122 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
123 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
124 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
125 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
126 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
127 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
128 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
129 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
130 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
131 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
132 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
133 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
134 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
135 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
136 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
137 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
138 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
139 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
140 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
141 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
142 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
143 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
144 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
145 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
146 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
147 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
148 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
149 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
150 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
151 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
152 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
153 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
154 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
155 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
156 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
157 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
158 2933599457 Rhizobium phaseoli M3 Isolate Nodule
159 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
160 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
161 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
162 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
163 2936381700 Rhizobium chutanense C16 Isolate Unclassified
164 2996887358 Rhizobium sp. R711 Isolate Nodule
165 2996893221 Rhizobium sp. R635 Isolate Nodule
166 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
167 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
168 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
169 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
170 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
171 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
172 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
173 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
174 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
175 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
176 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
177 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
178 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
179 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
180 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
181 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
182 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
183 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
184 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
185 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
186 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
187 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
188 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
189 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
190 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
191 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
192 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
193 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
194 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
195 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
196 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
197 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
198 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
199 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
200 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
201 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
202 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
203 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
204 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
205 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
206 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
207 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
208 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
209 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
210 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
211 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
212 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
213 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
214 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
215 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
216 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
218 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
219 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
220 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
221 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
224 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
225 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
226 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
228 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
229 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
230 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
231 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
232 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
233 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
245 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
246 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
247 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
248 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
249 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
250 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
251 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
252 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
253 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
254 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
255 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
256 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
257 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
258 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
259 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
263 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
264 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
265 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
266 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
267 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
268 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
269 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
277 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
278 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
279 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
285 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
286 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
287 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
288 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
289 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
290 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
291 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
292 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
298 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
299 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
300 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
301 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
302 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
303 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
304 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
305 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
306 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
307 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
308 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
309 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
310 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
311 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
312 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
313 8005258706 Rhizobium sp. R693 Isolate Nodule
314 8005275841 Rhizobium sp. N4311 Isolate Nodule
315 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
316 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
317 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
318 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
319 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
320 8005321885 Rhizobium sp. R72 Isolate Nodule
321 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
322 8005382845 Rhizobium sp. R634 Isolate Nodule
323 8005395548 Rhizobium sp. R339 Isolate Nodule
324 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
325 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
326 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
327 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
328 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
329 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
330 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
331 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
332 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
333 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
334 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
335 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
336 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
337 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
338 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
339 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
340 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
341 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
342 8018176218 Rhizobium sp. N122 Isolate Nodule
343 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
344 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
345 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
346 8024501048 Rhizobium sp. H4 Isolate Nodule
347 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
348 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
349 8056382006 Rhizobium croatiense 13T Isolate Nodule
350 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
351 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
352 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 49.02
Metatranscriptomes 0
Isolates 50.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.29
Nodule 39.02
Rhizoplane 2.44
Rhizosphere 22.68
Stem 0
Stem Tuber 0
Unclassified 17.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3536183 2162886007 Bacteria 1338
2 JGI24740J21852_10001206 3300001979 Bacteria 11676
3 JGI25155J39150_1000097 3300002704 Bacteria 48934
4 JGI25156J39149_1000174 3300002705 Bacteria 47087
5 JGI25162J39368_1000240 3300002737 Bacteria 54635
6 JGI25162J39368_1001228 3300002737 Bacteria 14812
7 JGI25162J39368_1002112 3300002737 Bacteria 8448
8 JGI25154J39366_1000011 3300002738 Bacteria 296007
9 JGI25157J39369_1000218 3300002741 Bacteria 47085
10 JGI25150J39212_1008245 3300002774 Bacteria 2049
11 JGI25151J46595_10000381 3300003187 Bacteria 46048
12 JGI25151J46595_10001041 3300003187 Bacteria 20704
13 JGI25151J46595_10041634 3300003187 Bacteria 1666
14 JGI25165J46597_1000709 3300003214 Bacteria 26301
15 JGI25165J46597_1000755 3300003214 Bacteria 24825
16 JGI25165J46597_1005747 3300003214 Bacteria 2324
17 JGI25153J46596_10005312 3300003215 Bacteria 6772
18 JGI25153J46596_10028674 3300003215 Bacteria 1926
19 rootL2_10000948 3300003322 Bacteria 7576
20 JGI25160J50197_1003038 3300003354 Bacteria 7654
21 JGI25161J50226_1004940 3300003374 Bacteria 2700
22 Ga0055526_1002660 3300003771 Bacteria 11927
23 Ga0055526_1006114 3300003771 Bacteria 6640
24 Ga0055524_1011904 3300003775 Bacteria 3369
25 Ga0055528_1000475 3300003790 Bacteria 32037
26 Ga0055528_1017160 3300003790 Bacteria 2523
27 Ga0055543_1001740 3300004625 Bacteria 8154
28 Ga0065704_10134458 3300005289 Bacteria 1588
29 Ga0065707_10010524 3300005295 Bacteria 2209
30 Ga0070713_100016670 3300005436 Bacteria 5528
31 Ga0070710_10070009 3300005437 Bacteria 2020
32 Ga0070711_100082156 3300005439 Bacteria 2299
33 Ga0070665_100057619 3300005548 Bacteria 3895
34 Ga0068854_100090804 3300005578 Bacteria 2272
35 Ga0068861_100366766 3300005719 Bacteria 1268
36 Ga0081539_10004437 3300005985 Bacteria 15491
37 Ga0070717_10179134 3300006028 Bacteria 1846
38 Ga0075365_10002565 3300006038 Bacteria 8967
39 Ga0075365_10005267 3300006038 Bacteria 6959
40 Ga0070715_10025930 3300006163 Bacteria 2326
41 Ga0070712_100014661 3300006175 Bacteria 5032
42 Ga0075362_10016181 3300006177 Bacteria 3050
43 Ga0075369_10094509 3300006186 Bacteria 1336
44 Ga0075366_10002745 3300006195 Bacteria 9104
45 Ga0075370_10089344 3300006353 Bacteria 1776
46 Ga0105240_10000005 3300009093 Bacteria 702630
47 Ga0105240_10004093 3300009093 Bacteria 22404
48 Ga0105245_10102642 3300009098 Bacteria 2648
49 Ga0105243_10083519 3300009148 Bacteria 2613
50 Ga0105241_10036631 3300009174 Bacteria 3693
51 Ga0105237_10003910 3300009545 Bacteria 17459
52 Ga0105237_10008240 3300009545 Bacteria 11316
53 Ga0105239_10011022 3300010375 Bacteria 10091
54 Ga0105239_10023758 3300010375 Bacteria 6750
55 Ga0105246_10011453 3300011119 Bacteria 5504
56 Ga0157370_10003581 3300013104 Bacteria 18168
57 Ga0157370_10477892 3300013104 Bacteria 1145
58 Ga0157369_10267103 3300013105 Bacteria 1784
59 Ga0157378_10390266 3300013297 Bacteria 1369
60 Ga0163162_10778992 3300013306 Bacteria 1075
61 Ga0182007_10001056 3300015262 Bacteria 15052
62 Ga0209435_100012 3300025206 Bacteria 401621
63 Ga0209672_104904 3300025228 Bacteria 2387
64 Ga0209437_100047 3300025233 Bacteria 405163
65 Ga0209437_100308 3300025233 Bacteria 66019
66 Ga0207425_1000070 3300025245 Bacteria 116438
67 Ga0209646_1000026 3300025246 Bacteria 401621
68 Ga0209026_1000014 3300025250 Bacteria 401621
69 Ga0209677_101997 3300025253 Bacteria 8116
70 Ga0209148_1000335 3300025254 Bacteria 63754
71 Ga0209759_1000012 3300025256 Bacteria 401621
72 Ga0209129_1000172 3300025258 Bacteria 95144
73 Ga0209129_1001417 3300025258 Bacteria 13387
74 Ga0209129_1007048 3300025258 Bacteria 3449
75 Ga0209233_1000048 3300025261 Bacteria 453669
76 Ga0209233_1000069 3300025261 Bacteria 367639
77 Ga0209233_1000221 3300025261 Bacteria 104090
78 Ga0209233_1010100 3300025261 Bacteria 2843
79 Ga0209455_1002543 3300025272 Bacteria 6976
80 Ga0209673_1000117 3300025273 Bacteria 172081
81 Ga0209673_1000151 3300025273 Bacteria 148103
82 Ga0209673_1022402 3300025273 Bacteria 2180
83 Ga0209025_1000083 3300025294 Bacteria 265556
84 Ga0209025_1000506 3300025294 Bacteria 74798
85 Ga0209025_1006114 3300025294 Bacteria 9496
86 Ga0209025_1014354 3300025294 Bacteria 4880
87 Ga0209025_1034006 3300025294 Bacteria 2340
88 Ga0209564_1000581 3300025295 Bacteria 57912
89 Ga0209564_1000690 3300025295 Bacteria 49556
90 Ga0209758_1000090 3300025297 Bacteria 246564
91 Ga0209758_1000467 3300025297 Bacteria 66705
92 Ga0209758_1001919 3300025297 Bacteria 22619
93 Ga0209256_1000656 3300025299 Bacteria 47104
94 Ga0209256_1000736 3300025299 Bacteria 43165
95 Ga0207426_1000221 3300025302 Bacteria 134756
96 Ga0207426_1015525 3300025302 Bacteria 2759
97 Ga0209257_1012201 3300025304 Bacteria 4011
98 Ga0207654_10039589 3300025911 Bacteria 2652
99 Ga0207695_10000011 3300025913 Bacteria 910221
100 Ga0207695_10000123 3300025913 Bacteria 232059
101 Ga0207671_10000674 3300025914 Bacteria 44575
102 Ga0207671_10002081 3300025914 Bacteria 21897
103 Ga0207664_10138173 3300025929 Bacteria 2058
104 Ga0207665_10090690 3300025939 Bacteria 2118
105 Ga0207667_10509164 3300025949 Bacteria 1220
106 Ga0207640_10250918 3300025981 Bacteria 1373
107 Ga0207639_10334231 3300026041 Bacteria 1349
108 Ga0207698_10045706 3300026142 Bacteria 3301
109 Ga0209371_1005732 3300027312 Bacteria 4836
110 Ga0209813_10034169 3300027866 Bacteria 1516
111 Ga0268256_1005615 3300030500 Bacteria 4877
112 Ga0307513_10005704 3300031456 Bacteria 16381
113 Ga0307405_10011639 3300031731 Bacteria 4623
114 Ga0307412_10006848 3300031911 Bacteria 6468
115 Ga0451798_0249815 3300041458 Bacteria 2113
116 Ga0451833_0769652 3300041491 Bacteria 3475
117 Ga0451837_1310425 3300041494 Bacteria 1367
118 Ga0451841_0177691 3300041498 Bacteria 2925
119 Ga0451855_0636481 3300041511 Bacteria 3314
120 Ga0451853_3382831 3300041512 Bacteria 5395
121 Ga0466963_0030765 3300044694 Bacteria 3465
122 Ga0466964_0111379 3300044706 Bacteria 1221
123 Ga0466970_0012736 3300044765 Bacteria 4303
124 Ga0466957_0186378 3300044842 Bacteria 1357
125 Ga0466958_0018946 3300045836 Bacteria 4001
126 Ga0466967_0262338 3300045976 Bacteria 1653
127 Ga0466967_0401963 3300045976 Bacteria 1333
128 Ga0495638_0006536 3300046460 Bacteria 8483
129 Ga0495606_0148396 3300046507 Bacteria 1378
130 Ga0495610_0006912 3300046512 Bacteria 7683
131 Ga0495620_0018233 3300046515 Bacteria 3479
132 Ga0495609_0204605 3300046538 Bacteria 824
133 Ga0495622_0002629 3300046557 Bacteria 8648
134 Ga0495633_0048061 3300046558 Bacteria 2015
135 Ga0495634_0084265 3300046642 Bacteria 2073
136 Ga0495611_0017476 3300046648 Bacteria 3069
137 Ga0495625_0068116 3300046660 Bacteria 2503
138 Ga0495661_0042659 3300046665 Bacteria 2795
139 Ga0495600_0078475 3300046809 Bacteria 2156
140 Ga0495604_0009206 3300047317 Bacteria 7817
141 Ga0495687_049213 3300047443 Bacteria 1802
142 Ga0495686_0022781 3300047472 Bacteria 4139
143 Ga0495686_0034830 3300047472 Bacteria 3239
144 Ga0496100_0010463 3300048903 Bacteria 5251
145 Ga0496101_0036345 3300048904 Bacteria 3488
146 Ga0496102_0366797 3300048905 Bacteria 1355
147 Ga0496103_0005191 3300048906 Bacteria 7835
148 Ga0496106_0095486 3300048909 Bacteria 2300
149 Ga0496113_0025414 3300048916 Bacteria 4221
150 Ga0496114_0864900 3300048917 Bacteria 785
151 Ga0496115_0323785 3300048918 Bacteria 1260
152 Ga0496116_0009884 3300048919 Bacteria 8068
153 Ga0496116_0020650 3300048919 Bacteria 4995
154 Ga0496116_0064484 3300048919 Bacteria 2354
155 Ga0496117_0002365 3300048920 Bacteria 24063
156 Ga0496117_0036997 3300048920 Bacteria 3642
157 Ga0496117_0051626 3300048920 Bacteria 2905
158 Ga0496118_0006409 3300048921 Bacteria 12947
159 Ga0496118_0008537 3300048921 Bacteria 10568
160 Ga0496118_0035393 3300048921 Bacteria 4054
161 Ga0496118_0121605 3300048921 Bacteria 1700
162 Ga0496119_0019642 3300048922 Bacteria 4964
163 Ga0496121_0001108 3300048924 Bacteria 47472
164 Ga0496121_0043355 3300048924 Bacteria 3897
165 Ga0496121_0094045 3300048924 Bacteria 2332
166 Ga0496122_0012934 3300048925 Bacteria 8236
167 Ga0496122_0033063 3300048925 Bacteria 4261
168 Ga0496122_0055550 3300048925 Bacteria 2961
169 Ga0496122_0064577 3300048925 Bacteria 2662
170 Ga0496123_0019876 3300048926 Bacteria 5272
171 Ga0496123_0024125 3300048926 Bacteria 4632
172 Ga0496123_0036815 3300048926 Bacteria 3462
173 Ga0496123_0038607 3300048926 Bacteria 3353
174 Ga0496124_0034297 3300048927 Bacteria 4455
175 Ga0496124_0039649 3300048927 Bacteria 4080
176 Ga0496124_0078076 3300048927 Bacteria 2729
177 Ga0496124_0089488 3300048927 Bacteria 2513
178 Ga0496124_0184803 3300048927 Bacteria 1600
179 Ga0496125_0021769 3300048928 Bacteria 5965
180 Ga0496125_0059289 3300048928 Bacteria 3085
181 Ga0496126_0043276 3300048929 Bacteria 4154
182 Ga0496126_0081247 3300048929 Bacteria 2865
183 Ga0501034_0204221 3300049571 Bacteria 1933
184 Ga0501038_0166844 3300049574 Bacteria 1785
185 Ga0501073_0304349 3300049589 Bacteria 1100
186 nmdc:mga03683_1152_c1 3300050489 Bacteria 7773
187 nmdc:mga0yw44_16520_c1 3300050492 Bacteria 3989
188 nmdc:mga0yw44_5208_c1 3300050492 Bacteria 6100
189 nmdc:mga0k408_56221_c1 3300050493 Bacteria 2283
190 nmdc:mga06z11_269744_c1 3300050494 Bacteria 1006
191 nmdc:mga04h51_40710_c1 3300050495 Bacteria 1515
192 nmdc:mga07m45_60442_c1 3300050496 Bacteria 2145
193 nmdc:mga0sz30_5112_c1 3300050516 Bacteria 4800
194 Ga0500644_0002378 3300053088 Bacteria 4723
195 Ga0500566_0071740 3300053094 Bacteria 1943
196 Ga0500618_003490 3300053125 Bacteria 5368
197 Ga0500568_0000347 3300053139 Bacteria 35988
198 Ga0500590_034405 3300053148 Bacteria 2623
199 Ga0500604_0009077 3300053151 Bacteria 2646
200 Ga0500622_0000268 3300053156 Bacteria 53412
201 Ga0500661_003295 3300055283 Bacteria 3036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046538 Ga0495609_0204605 Ga0495609_0204605_110_799 186
2 3300048917 Ga0496114_0864900 Ga0496114_0864900_17_715 187
3 iso_pu_bacteria 8006926726 8006932161 194
4 3300048918 Ga0496115_0323785 Ga0496115_0323785_465_1223 207
5 3300046507 Ga0495606_0148396 Ga0495606_0148396_318_1235 213
6 3300013104 Ga0157370_10477892 Ga0157370_104778921 215
7 3300025304 Ga0209257_1012201 Ga0209257_10122016 217
8 3300025949 Ga0207667_10509164 Ga0207667_105091641 217
9 3300013306 Ga0163162_10778992 Ga0163162_107789921 221
10 iso_pu_bacteria 2842395702 2842399924 221
11 iso_pu_bacteria 8005289223 8005293593 221
12 iso_pu_bacteria 8005695170 8005697356 221
13 iso_pu_bacteria 8024501048 8024504373 223
14 iso_pu_bacteria 2509276021 2509392100 224
15 iso_pu_bacteria 2509276033 2509445688 224
16 iso_pu_bacteria 2509276033 2509447011 224
17 iso_pu_bacteria 2510065019 2510133910 224
18 iso_pu_bacteria 2510461076 2510895328 224
19 iso_pu_bacteria 2510917030 2511196546 224
20 iso_pu_bacteria 2513237084 2513568019 224
21 iso_pu_bacteria 2513237085 2513576898 224
22 iso_pu_bacteria 2513237093 2513629443 224
23 iso_pu_bacteria 2513237103 2513708093 224
24 iso_pu_bacteria 2513237162 2514020053 224
25 iso_pu_bacteria 2515154113 2515637365 224
26 iso_pu_bacteria 2515154114 2515640916 224
27 iso_pu_bacteria 2515154116 2515655400 224
28 iso_pu_bacteria 2515154134 2515739438 224
29 iso_pu_bacteria 2516653077 2517036656 224
30 iso_pu_bacteria 2516653085 2517077019 224
31 iso_pu_bacteria 2517093000 2517095787 224
32 iso_pu_bacteria 2517287029 2517407355 224
33 iso_pu_bacteria 2529292951 2530646002 224
34 iso_pu_bacteria 2534681796 2535519403 224
35 iso_pu_bacteria 2582581294 2585202442 224
36 iso_pu_bacteria 2582581298 2585225535 224
37 iso_pu_bacteria 2582581306 2585266085 224
38 iso_pu_bacteria 2582581866 2585395067 224
39 iso_pu_bacteria 2585427526 2585527398 224
40 iso_pu_bacteria 2585427528 2585538140 224
41 iso_pu_bacteria 2585427529 2585548190 224
42 iso_pu_bacteria 2585427593 2585836088 224
43 iso_pu_bacteria 2643221599 2644006482 224
44 iso_pu_bacteria 2643221643 2644241899 224
45 iso_pu_bacteria 2718217882 2719181765 224
46 iso_pu_bacteria 2718217927 2719386367 224
47 iso_pu_bacteria 2718218009 2719732429 224
48 iso_pu_bacteria 2718218199 2720492535 224
49 iso_pu_bacteria 2718218232 2720613970 224
50 iso_pu_bacteria 2718218233 2720620774 224
51 iso_pu_bacteria 2718218235 2720632097 224
52 iso_pu_bacteria 2718218269 2720775825 224
53 iso_pu_bacteria 2718218363 2721147856 224
54 iso_pu_bacteria 2718218365 2721159307 224
55 iso_pu_bacteria 2718218366 2721164692 224
56 iso_pu_bacteria 2718218423 2721400072 224
57 iso_pu_bacteria 2721755514 2722840862 224
58 iso_pu_bacteria 2721755556 2723027432 224
59 iso_pu_bacteria 2721755684 2723561051 224
60 iso_pu_bacteria 2721755685 2723567644 224
61 iso_pu_bacteria 2721755809 2724038885 224
62 iso_pu_bacteria 2721755810 2724045185 224
63 iso_pu_bacteria 2721755819 2724090432 224
64 iso_pu_bacteria 2721755822 2724104909 224
65 iso_pu_bacteria 2724679232 2725952605 224
66 iso_pu_bacteria 2728369352 2730108368 224
67 iso_pu_bacteria 2728369365 2730165000 224
68 iso_pu_bacteria 2728369397 2730298939 224
69 iso_pu_bacteria 2738541333 2739032797 224
70 iso_pu_bacteria 2765235942 2766065822 224
71 iso_pu_bacteria 2791355259 2793314585 224
72 iso_pu_bacteria 2791355260 2793320412 224
73 iso_pu_bacteria 2791355261 2793329592 224
74 iso_pu_bacteria 2791355263 2793339164 224
75 iso_pu_bacteria 2791355264 2793348839 224
76 iso_pu_bacteria 2791355265 2793351875 224
77 iso_pu_bacteria 2791355266 2793362629 224
78 iso_pu_bacteria 2791355267 2793368917 224
79 iso_pu_bacteria 2802429605 2805928847 224
80 iso_pu_bacteria 2802429606 2805935128 224
81 iso_pu_bacteria 2802429633 2806043777 224
82 iso_pu_bacteria 2802429634 2806050292 224
83 iso_pu_bacteria 2802429635 2806057108 224
84 iso_pu_bacteria 2802429636 2806064490 224
85 iso_pu_bacteria 2802429637 2806071757 224
86 iso_pu_bacteria 2838016132 2838017695 224
87 iso_pu_bacteria 2838022645 2838028963 224
88 iso_pu_bacteria 2838048938 2838052012 224
89 iso_pu_bacteria 2838061910 2838067370 224
90 iso_pu_bacteria 2838068647 2838070188 224
91 iso_pu_bacteria 2838668709 2838670316 224
92 iso_pu_bacteria 2838680041 2838683516 224
93 iso_pu_bacteria 2838686498 2838687099 224
94 iso_pu_bacteria 2838694306 2838697541 224
95 iso_pu_bacteria 2838701080 2838702687 224
96 iso_pu_bacteria 2838707686 2838710657 224
97 iso_pu_bacteria 2838729681 2838729928 224
98 iso_pu_bacteria 2838742623 2838743057 224
99 iso_pu_bacteria 2841851746 2841852543 224
100 iso_pu_bacteria 2841864319 2841870739 224
101 iso_pu_bacteria 2842077413 2842078830 224
102 iso_pu_bacteria 2842110456 2842114937 224
103 iso_pu_bacteria 2842118031 2842118661 224
104 iso_pu_bacteria 2842146304 2842148055 224
105 iso_pu_bacteria 2842156927 2842157997 224
106 iso_pu_bacteria 2842163707 2842168839 224
107 iso_pu_bacteria 2842180545 2842181616 224
108 iso_pu_bacteria 2842192696 2842197312 224
109 iso_pu_bacteria 2842198810 2842205077 224
110 iso_pu_bacteria 2842205361 2842205524 224
111 iso_pu_bacteria 2842217011 2842217890 224
112 iso_pu_bacteria 2842229732 2842230333 224
113 iso_pu_bacteria 2842237096 2842240572 224
114 iso_pu_bacteria 2842243621 2842244235 224
115 iso_pu_bacteria 2842250916 2842253121 224
116 iso_pu_bacteria 2842257432 2842257679 224
117 iso_pu_bacteria 2842271015 2842271363 224
118 iso_pu_bacteria 2842278818 2842278981 224
119 iso_pu_bacteria 2842285085 2842285643 224
120 iso_pu_bacteria 2842291075 2842292492 224
121 iso_pu_bacteria 2842304105 2842304991 224
122 iso_pu_bacteria 2842311132 2842314956 224
123 iso_pu_bacteria 2842317721 2842320664 224
124 iso_pu_bacteria 2842341865 2842346413 224
125 iso_pu_bacteria 2842370503 2842374147 224
126 iso_pu_bacteria 2842377471 2842378890 224
127 iso_pu_bacteria 2842384541 2842385171 224
128 iso_pu_bacteria 2842402390 2842403003 224
129 iso_pu_bacteria 2842409023 2842409625 224
130 iso_pu_bacteria 2842415677 2842416276 224
131 iso_pu_bacteria 2842422224 2842423802 224
132 iso_pu_bacteria 2842447887 2842453176 224
133 iso_pu_bacteria 2842489311 2842491933 224
134 iso_pu_bacteria 2842495871 2842496872 224
135 iso_pu_bacteria 2842521101 2842524831 224
136 iso_pu_bacteria 2844454524 2844458466 224
137 iso_pu_bacteria 2857516855 2857517482 224
138 iso_pu_bacteria 2919100787 2919100935 224
139 iso_pu_bacteria 2919119836 2919122507 224
140 iso_pu_bacteria 2933570622 2933570799 224
141 iso_pu_bacteria 2933586486 2933591309 224
142 iso_pu_bacteria 2933599457 2933600993 224
143 iso_pu_bacteria 2935894831 2935897074 224
144 iso_pu_bacteria 2935901341 2935902003 224
145 iso_pu_bacteria 2936367885 2936372089 224
146 iso_pu_bacteria 2936375103 2936379953 224
147 iso_pu_bacteria 2936381700 2936382848 224
148 iso_pu_bacteria 2996893221 2996894382 224
149 iso_pu_bacteria 3005445848 3005446492 224
150 iso_pu_bacteria 3005452660 3005455598 224
151 iso_pu_bacteria 639633055 639649146 224
152 iso_pu_bacteria 8005275841 8005281164 224
153 iso_pu_bacteria 8005282627 8005283303 224
154 iso_pu_bacteria 8005301065 8005303077 224
155 iso_pu_bacteria 8005307578 8005312786 224
156 iso_pu_bacteria 8005376324 8005380880 224
157 iso_pu_bacteria 8005382845 8005385241 224
158 iso_pu_bacteria 8005395548 8005396158 224
159 iso_pu_bacteria 8005430974 8005435111 224
160 iso_pu_bacteria 8005460587 8005463632 224
161 iso_pu_bacteria 8005497431 8005500850 224
162 iso_pu_bacteria 8005542996 8005547092 224
163 iso_pu_bacteria 8005556819 8005557062 224
164 iso_pu_bacteria 8005563573 8005567944 224
165 iso_pu_bacteria 8005570704 8005573510 224
166 iso_pu_bacteria 8005619151 8005622226 224
167 iso_pu_bacteria 8005626139 8005632297 224
168 iso_pu_bacteria 8005668836 8005672267 224
169 iso_pu_bacteria 8005688590 8005692153 224
170 iso_pu_bacteria 8018127388 8018134047 224
171 iso_pu_bacteria 8018163183 8018164674 224
172 iso_pu_bacteria 8018176218 8018181370 224
173 iso_pu_bacteria 8023680758 8023683216 224
174 iso_pu_bacteria 8024479707 8024482913 224
175 iso_pu_bacteria 8024486573 8024487770 224
176 iso_pu_bacteria 8056375014 8056375887 224
177 iso_pu_bacteria 8056382006 8056386679 224
178 iso_pu_bacteria 8057874678 8057877725 224
179 3300049574 Ga0501038_0166844 Ga0501038_0166844_56_961 225
180 3300049589 Ga0501073_0304349 Ga0501073_0304349_144_1049 225
181 3300053094 Ga0500566_0071740 Ga0500566_0071740_1048_1926 225
182 iso_pu_bacteria 2513237138 2513868072 225
183 iso_pu_bacteria 2582581867 2585402248 225
184 iso_pu_bacteria 2585427590 2585822452 225
185 iso_pu_bacteria 2923556063 2923558757 225
186 3300025294 Ga0209025_1006114 Ga0209025_100611414 226
187 3300048920 Ga0496117_0036997 Ga0496117_0036997_1157_2152 226
188 3300048921 Ga0496118_0035393 Ga0496118_0035393_1734_2729 226
189 3300048927 Ga0496124_0034297 Ga0496124_0034297_1746_2741 226
190 3300046512 Ga0495610_0006912 Ga0495610_0006912_1764_2681 227
191 3300046515 Ga0495620_0018233 Ga0495620_0018233_1612_2529 227
192 3300047472 Ga0495686_0034830 Ga0495686_0034830_452_1369 227
193 3300003187 JGI25151J46595_10000381 JGI25151J46595_1000038115 228
194 3300003187 JGI25151J46595_10041634 JGI25151J46595_100416342 228
195 3300003215 JGI25153J46596_10028674 JGI25153J46596_100286742 228
196 3300003354 JGI25160J50197_1003038 JGI25160J50197_10030384 228
197 3300003374 JGI25161J50226_1004940 JGI25161J50226_10049402 228
198 3300003771 Ga0055526_1002660 Ga0055526_10026603 228
199 3300003771 Ga0055526_1006114 Ga0055526_10061141 228
200 3300003775 Ga0055524_1011904 Ga0055524_10119041 228
201 3300003790 Ga0055528_1000475 Ga0055528_100047510 228
202 3300003790 Ga0055528_1017160 Ga0055528_10171602 228
203 3300004625 Ga0055543_1001740 Ga0055543_10017404 228
204 3300006038 Ga0075365_10002565 Ga0075365_100025653 228
205 3300006177 Ga0075362_10016181 Ga0075362_100161812 228
206 3300006186 Ga0075369_10094509 Ga0075369_100945091 228
207 3300006195 Ga0075366_10002745 Ga0075366_100027456 228
208 3300006353 Ga0075370_10089344 Ga0075370_100893442 228
209 3300025258 Ga0209129_1001417 Ga0209129_10014174 228
210 3300025258 Ga0209129_1007048 Ga0209129_10070483 228
211 3300025273 Ga0209673_1000117 Ga0209673_1000117129 228
212 3300025273 Ga0209673_1000151 Ga0209673_100015128 228
213 3300025294 Ga0209025_1000506 Ga0209025_100050647 228
214 3300025294 Ga0209025_1014354 Ga0209025_10143542 228
215 3300025294 Ga0209025_1034006 Ga0209025_10340062 228
216 3300025295 Ga0209564_1000581 Ga0209564_100058119 228
217 3300025295 Ga0209564_1000690 Ga0209564_100069015 228
218 3300025297 Ga0209758_1000467 Ga0209758_100046719 228
219 3300025297 Ga0209758_1001919 Ga0209758_100191918 228
220 3300025299 Ga0209256_1000656 Ga0209256_100065610 228
221 3300025299 Ga0209256_1000736 Ga0209256_100073626 228
222 3300025302 Ga0207426_1000221 Ga0207426_100022178 228
223 3300031456 Ga0307513_10005704 Ga0307513_1000570411 228
224 3300041458 Ga0451798_0249815 Ga0451798_0249815_552_1478 228
225 3300041491 Ga0451833_0769652 Ga0451833_0769652_1398_2324 228
226 3300041494 Ga0451837_1310425 Ga0451837_1310425_216_1136 228
227 3300041498 Ga0451841_0177691 Ga0451841_0177691_1946_2872 228
228 3300041511 Ga0451855_0636481 Ga0451855_0636481_1961_2887 228
229 3300041512 Ga0451853_3382831 Ga0451853_3382831_2762_3688 228
230 3300046557 Ga0495622_0002629 Ga0495622_0002629_1478_2380 228
231 3300046558 Ga0495633_0048061 Ga0495633_0048061_615_1547 228
232 3300046642 Ga0495634_0084265 Ga0495634_0084265_1032_1934 228
233 3300046648 Ga0495611_0017476 Ga0495611_0017476_871_1797 228
234 3300046665 Ga0495661_0042659 Ga0495661_0042659_400_1326 228
235 3300046809 Ga0495600_0078475 Ga0495600_0078475_443_1345 228
236 3300047317 Ga0495604_0009206 Ga0495604_0009206_4718_5620 228
237 3300047472 Ga0495686_0022781 Ga0495686_0022781_1262_2185 228
238 3300048909 Ga0496106_0095486 Ga0496106_0095486_723_1655 228
239 3300048920 Ga0496117_0051626 Ga0496117_0051626_1370_2317 228
240 3300048921 Ga0496118_0008537 Ga0496118_0008537_7583_8530 228
241 3300048927 Ga0496124_0089488 Ga0496124_0089488_1071_1976 228
242 3300048927 Ga0496124_0184803 Ga0496124_0184803_104_1009 228
243 3300050489 nmdc:mga03683_1152_c1 nmdc:mga03683_1152_c1_3944_4864 228
244 3300050492 nmdc:mga0yw44_16520_c1 nmdc:mga0yw44_16520_c1_399_1319 228
245 3300050493 nmdc:mga0k408_56221_c1 nmdc:mga0k408_56221_c1_182_1102 228
246 3300050496 nmdc:mga07m45_60442_c1 nmdc:mga07m45_60442_c1_1089_2009 228
247 3300050516 nmdc:mga0sz30_5112_c1 nmdc:mga0sz30_5112_c1_3011_3931 228
248 3300053088 Ga0500644_0002378 Ga0500644_0002378_2192_3115 228
249 3300053148 Ga0500590_034405 Ga0500590_034405_178_1080 228
250 3300053156 Ga0500622_0000268 Ga0500622_0000268_41710_42633 228
251 iso_pu_bacteria 2513237088 2513597205 228
252 iso_pu_bacteria 2582581304 2585257870 228
253 iso_pu_bacteria 2643221607 2644046484 228
254 iso_pu_bacteria 2643221636 2644200837 228
255 iso_pu_bacteria 2643221686 2644479274 228
256 iso_pu_bacteria 2996887358 2996889231 228
257 iso_pu_bacteria 8005258706 8005264191 228
258 iso_pu_bacteria 8005321885 8005323758 228
259 3300002774 JGI25150J39212_1008245 JGI25150J39212_10082451 229
260 3300003187 JGI25151J46595_10001041 JGI25151J46595_100010411 229
261 3300003215 JGI25153J46596_10005312 JGI25153J46596_100053126 229
262 3300025245 Ga0207425_1000070 Ga0207425_10000701 229
263 3300025258 Ga0209129_1000172 Ga0209129_10001721 229
264 3300025273 Ga0209673_1022402 Ga0209673_10224021 229
265 3300025294 Ga0209025_1000083 Ga0209025_1000083262 229
266 3300025297 Ga0209758_1000090 Ga0209758_10000901 229
267 3300048904 Ga0496101_0036345 Ga0496101_0036345_446_1441 229
268 3300048919 Ga0496116_0009884 Ga0496116_0009884_4284_5279 229
269 3300048919 Ga0496116_0020650 Ga0496116_0020650_3986_4981 229
270 3300048921 Ga0496118_0121605 Ga0496118_0121605_438_1433 229
271 3300048924 Ga0496121_0094045 Ga0496121_0094045_1076_2071 229
272 3300048925 Ga0496122_0033063 Ga0496122_0033063_262_1257 229
273 3300048926 Ga0496123_0024125 Ga0496123_0024125_2846_3841 229
274 3300048926 Ga0496123_0036815 Ga0496123_0036815_768_1766 229
275 3300048927 Ga0496124_0039649 Ga0496124_0039649_2824_3819 229
276 3300048928 Ga0496125_0059289 Ga0496125_0059289_1838_2833 229
277 3300048929 Ga0496126_0043276 Ga0496126_0043276_2743_3738 229
278 3300006038 Ga0075365_10005267 Ga0075365_100052674 230
279 3300027866 Ga0209813_10034169 Ga0209813_100341692 230
280 3300031731 Ga0307405_10011639 Ga0307405_100116391 230
281 3300031911 Ga0307412_10006848 Ga0307412_100068482 230
282 3300044842 Ga0466957_0186378 Ga0466957_0186378_438_1265 230
283 3300046460 Ga0495638_0006536 Ga0495638_0006536_699_1655 230
284 3300048919 Ga0496116_0064484 Ga0496116_0064484_572_1603 230
285 3300048924 Ga0496121_0043355 Ga0496121_0043355_1132_2163 230
286 3300048925 Ga0496122_0055550 Ga0496122_0055550_1303_2334 230
287 3300048926 Ga0496123_0038607 Ga0496123_0038607_1286_2317 230
288 3300048927 Ga0496124_0078076 Ga0496124_0078076_1063_2094 230
289 3300049571 Ga0501034_0204221 Ga0501034_0204221_516_1487 230
290 3300050492 nmdc:mga0yw44_5208_c1 nmdc:mga0yw44_5208_c1_3397_4230 230
291 3300050494 nmdc:mga06z11_269744_c1 nmdc:mga06z11_269744_c1_80_913 230
292 3300050495 nmdc:mga04h51_40710_c1 nmdc:mga04h51_40710_c1_177_1010 230
293 iso_pu_bacteria 2585427594 2585845407 230
294 3300005719 Ga0068861_100366766 Ga0068861_1003667661 231
295 3300013297 Ga0157378_10390266 Ga0157378_103902662 231
296 3300025302 Ga0207426_1015525 Ga0207426_10155253 231
297 iso_pu_bacteria 2738541293 2738800402 231
298 iso_pu_bacteria 2838029111 2838030119 231
299 iso_pu_bacteria 2842475841 2842476596 231
300 iso_pu_bacteria 2842502639 2842503647 231
301 iso_pu_bacteria 8056967851 8056976052 231
302 3300005578 Ga0068854_100090804 Ga0068854_1000908042 232
303 3300009093 Ga0105240_10004093 Ga0105240_1000409310 232
304 3300009098 Ga0105245_10102642 Ga0105245_101026423 232
305 3300009174 Ga0105241_10036631 Ga0105241_100366312 232
306 3300009545 Ga0105237_10008240 Ga0105237_100082408 232
307 3300010375 Ga0105239_10023758 Ga0105239_100237582 232
308 3300025254 Ga0209148_1000335 Ga0209148_100033564 232
309 3300025261 Ga0209233_1010100 Ga0209233_10101004 232
310 3300025272 Ga0209455_1002543 Ga0209455_10025433 232
311 3300025911 Ga0207654_10039589 Ga0207654_100395892 232
312 3300025913 Ga0207695_10000123 Ga0207695_10000123174 232
313 3300025914 Ga0207671_10002081 Ga0207671_1000208110 232
314 3300026041 Ga0207639_10334231 Ga0207639_103342312 232
315 3300026142 Ga0207698_10045706 Ga0207698_100457062 232
316 3300053151 Ga0500604_0009077 Ga0500604_0009077_1126_2079 232
317 3300055283 Ga0500661_003295 Ga0500661_003295_1232_2113 232
318 iso_pu_bacteria 2582581315 2585323815 232
319 iso_pu_bacteria 2582581316 2585331793 232
320 iso_pu_bacteria 2585427527 2585534088 232
321 iso_pu_bacteria 2585427530 2585552061 232
322 iso_pu_bacteria 2615840626 2616308554 232
323 iso_pu_bacteria 2615840698 2616557143 232
324 iso_pu_bacteria 2617270742 2617385146 232
325 iso_pu_bacteria 2667528174 2671111741 232
326 iso_pu_bacteria 2775507266 2778173991 232
327 iso_pu_bacteria 2818991448 2819612823 232
328 iso_pu_bacteria 2818991453 2819637935 232
329 iso_pu_bacteria 2842298080 2842302072 232
330 iso_pu_bacteria 2842357229 2842357461 232
331 iso_pu_bacteria 2919408235 2919411714 232
332 iso_pu_bacteria 3005416602 3005420131 232
333 iso_pu_bacteria 8005314921 8005317082 232
334 iso_pu_bacteria 8005484373 8005485121 232
335 iso_pu_bacteria 8005645114 8005645284 232
336 iso_pu_bacteria 8005682033 8005683216 232
337 iso_pu_bacteria 8046767195 8046773821 232
338 iso_pu_bacteria 8057575449 8057576805 232
339 3300046660 Ga0495625_0068116 Ga0495625_0068116_1204_2169 235
340 3300047443 Ga0495687_049213 Ga0495687_049213_503_1423 235
341 3300001979 JGI24740J21852_10001206 JGI24740J21852_100012068 236
342 3300002704 JGI25155J39150_1000097 JGI25155J39150_100009741 236
343 3300002705 JGI25156J39149_1000174 JGI25156J39149_100017412 236
344 3300002737 JGI25162J39368_1000240 JGI25162J39368_100024048 236
345 3300002737 JGI25162J39368_1001228 JGI25162J39368_100122810 236
346 3300002737 JGI25162J39368_1002112 JGI25162J39368_10021122 236
347 3300002738 JGI25154J39366_1000011 JGI25154J39366_100001141 236
348 3300002741 JGI25157J39369_1000218 JGI25157J39369_100021812 236
349 3300003214 JGI25165J46597_1000709 JGI25165J46597_10007097 236
350 3300003214 JGI25165J46597_1000755 JGI25165J46597_100075521 236
351 3300003214 JGI25165J46597_1005747 JGI25165J46597_10057472 236
352 3300003322 rootL2_10000948 rootL2_100009484 236
353 3300005548 Ga0070665_100057619 Ga0070665_1000576192 236
354 3300009093 Ga0105240_10000005 Ga0105240_10000005569 236
355 3300009148 Ga0105243_10083519 Ga0105243_100835192 236
356 3300009545 Ga0105237_10003910 Ga0105237_1000391013 236
357 3300010375 Ga0105239_10011022 Ga0105239_100110229 236
358 3300013104 Ga0157370_10003581 Ga0157370_100035818 236
359 3300013105 Ga0157369_10267103 Ga0157369_102671031 236
360 3300015262 Ga0182007_10001056 Ga0182007_1000105614 236
361 3300025206 Ga0209435_100012 Ga0209435_10001240 236
362 3300025228 Ga0209672_104904 Ga0209672_1049042 236
363 3300025233 Ga0209437_100047 Ga0209437_100047252 236
364 3300025233 Ga0209437_100308 Ga0209437_10030817 236
365 3300025246 Ga0209646_1000026 Ga0209646_100002640 236
366 3300025250 Ga0209026_1000014 Ga0209026_100001440 236
367 3300025253 Ga0209677_101997 Ga0209677_1019978 236
368 3300025256 Ga0209759_1000012 Ga0209759_100001240 236
369 3300025261 Ga0209233_1000048 Ga0209233_1000048150 236
370 3300025261 Ga0209233_1000069 Ga0209233_1000069286 236
371 3300025261 Ga0209233_1000221 Ga0209233_100022195 236
372 3300025913 Ga0207695_10000011 Ga0207695_10000011349 236
373 3300025914 Ga0207671_10000674 Ga0207671_1000067422 236
374 3300025981 Ga0207640_10250918 Ga0207640_102509181 236
375 3300027312 Ga0209371_1005732 Ga0209371_10057324 236
376 3300030500 Ga0268256_1005615 Ga0268256_10056152 236
377 3300044694 Ga0466963_0030765 Ga0466963_0030765_1882_2811 236
378 3300044706 Ga0466964_0111379 Ga0466964_0111379_85_1014 236
379 3300044765 Ga0466970_0012736 Ga0466970_0012736_886_1815 236
380 3300045836 Ga0466958_0018946 Ga0466958_0018946_622_1551 236
381 3300045976 Ga0466967_0401963 Ga0466967_0401963_94_1023 236
382 3300048903 Ga0496100_0010463 Ga0496100_0010463_3164_4087 236
383 3300048905 Ga0496102_0366797 Ga0496102_0366797_108_1031 236
384 3300048906 Ga0496103_0005191 Ga0496103_0005191_5493_6416 236
385 3300048916 Ga0496113_0025414 Ga0496113_0025414_1229_2152 236
386 3300048920 Ga0496117_0002365 Ga0496117_0002365_11042_11965 236
387 3300048921 Ga0496118_0006409 Ga0496118_0006409_11345_12268 236
388 3300048922 Ga0496119_0019642 Ga0496119_0019642_856_1785 236
389 3300048924 Ga0496121_0001108 Ga0496121_0001108_35511_36434 236
390 3300048925 Ga0496122_0012934 Ga0496122_0012934_6989_7912 236
391 3300048925 Ga0496122_0064577 Ga0496122_0064577_1069_1998 236
392 3300048926 Ga0496123_0019876 Ga0496123_0019876_3083_4006 236
393 3300048928 Ga0496125_0021769 Ga0496125_0021769_3729_4652 236
394 3300048929 Ga0496126_0081247 Ga0496126_0081247_981_1904 236
395 3300053125 Ga0500618_003490 Ga0500618_003490_2977_3909 236
396 3300045976 Ga0466967_0262338 Ga0466967_0262338_634_1506 237
397 3300005985 Ga0081539_10004437 Ga0081539_1000443717 239
398 3300011119 Ga0105246_10011453 Ga0105246_100114534 239
399 3300053139 Ga0500568_0000347 Ga0500568_0000347_29710_30672 239
400 3300005436 Ga0070713_100016670 Ga0070713_1000166704 242
401 3300005437 Ga0070710_10070009 Ga0070710_100700093 242
402 3300006028 Ga0070717_10179134 Ga0070717_101791342 242
403 3300006175 Ga0070712_100014661 Ga0070712_1000146614 242
404 3300025929 Ga0207664_10138173 Ga0207664_101381731 242
405 3300005289 Ga0065704_10134458 Ga0065704_101344582 246
406 3300005295 Ga0065707_10010524 Ga0065707_100105243 246
407 3300005439 Ga0070711_100082156 Ga0070711_1000821562 246
408 3300025939 Ga0207665_10090690 Ga0207665_100906902 246
409 2162886007 SwRhRL2b_contig_3536183 SwRhRL2b_0916.00002870 247
410 3300006163 Ga0070715_10025930 Ga0070715_100259303 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00211

Guanylate_cyc

Adenylate and Guanylate cyclase catalytic domain

3

172

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mr7-assembly1.cif.gz_B crystal structure of adenylate/guanylate cyclase/hydrolase from silicibacter pomeroyi 0.9333 11 181
3mr7-assembly2.cif.gz_C-2 crystal structure of adenylate/guanylate cyclase/hydrolase from silicibacter pomeroyi 0.9274 13 180
3mr7-assembly1.cif.gz_B crystal structure of adenylate/guanylate cyclase/hydrolase from silicibacter pomeroyi 0.9229 11 181
1ybu-assembly2.cif.gz_C mycobacterium tuberculosis adenylyl cyclase rv1900c chd, in complex with a substrate analog. 0.9171 13 181
3mr7-assembly2.cif.gz_C-2 crystal structure of adenylate/guanylate cyclase/hydrolase from silicibacter pomeroyi 0.9064 13 180
ID Description Score Start End Superfamily
1ybuC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.9171 13 181 3.30.70.1230
3mr7C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.9144 13 180 3.30.70.1230
1ybuC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.9064 13 181 3.30.70.1230
af_P9WMU7_185_364_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.9036 14 181 3.30.70.1230
3mr7C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8932 13 180 3.30.70.1230
ID Description Score Start End GO Terms
AF-A0A4S0I5E4-F1-model_v4 deleted 0.9671 82 180
AF-A0A525JM45-F1-model_v4 Adenylate/guanylate cyclase domain-containing protein 0.9595 13 137 GO:0004016
GO:0006171
GO:0035556
AF-A0A531MIA3-F1-model_v4 Adenylate/guanylate cyclase domain-containing protein 0.9588 11 168 GO:0004016
GO:0006171
GO:0035556
AF-A0A508SUM0-F1-model_v4 pH-sensitive adenylate cyclase (EC 4.6.1.1) 0.9587 13 177 GO:0004016
GO:0006171
GO:0035556
AF-A0A101KUM3-F1-model_v4 Guanylate cyclase domain-containing protein 0.9578 10 138 GO:0004016
GO:0006171
GO:0035556

Feature Viewer

pLDDT pTM Quality
79.4 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map