F437460

General Info

Members Datasets Scaffolds Average Seq Length
411 254 822 967

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100000576|Ga0070663_10000057614
Length 1023
Sequence MKERLVFHNSATLQTALQNGVDATTQTKYRGANAQMHLRSYGGTPVVRTDIALAACILGLASVASAAKPALEAXXXXASELDANGHPRALLPGDGEFRFTRLPDGVQFRVKGITKTILFYGADTVRVNANLGENYWTARSLVVTAKPGGVSFSVTESPATLLIATQKLRIIADKQTGALRFTDAGGKLFTEERQADPEMLKRVTISGAPSYEAQNTLKLQRDEAIYGFGFTADDHSNRRGTDLLLVQTNMGIIIPVMMSSRRYGVMWDTYSQMRFKDDANGASLWAESAPGGVDYYFMAGNTPDDVVRAYRDLTGAAPMYPKQAFGLFMSKERYKTQEQLLDVASSFRKEGFPLDYIVQDWQYWGSDKDGSWSGMTWDPTRYPDPEGMIKALHDMHLKLMMSIWPSIGNDTALAHELDAHNLRFAPLHWISKHARVYDAYSPLGRQIYFKHIKAGLLDKGVDALWMDGTEVEVSSAMWNAADNIRDTKALGSNALGDFTRYLNPYSLLTTQGTYDGERATANKRVFTLTRSAWAGAQRTAAASWSGDIFASWKTLKQQIAGGVDVTVTGNPYWTQDTGGFFVSEFPGGEQNPAWRELYARWLQFATFNPLMRIHGTDVEREPYRFKSLDPQVYDSLLKSVQLRYRLLPYIYPLSWKVTSAGYTLMRPLMMDFPDDRATDTIDDSFMFGPSLLVHPVTRAMYHILPPPPATVPGEYLRTPDGKPGLAGQYFEGRFGVPKGEFVDAKIDHTWPDPPLADIPGGLTSLNDFSVRWQGTLTAPEDGTYELGLDGDDGYRLILDGKTVVSSWQNGAARYKGTEQTLRKGQVVNVTIEYFQGDGNRSLRFGWRRPSELQEARNAVHALDTSVATYLPKGAGWFDFWTNQRFAGGQRVTRQVPLDILPLYVRAGSIVPMGPKVQYATQAPGAPYELRIYPGADARFTIYEDDNETYDYEKGRYASYDLVWNDRTHSLIIGPRHGRFTGMIPTRRLNIAVMSERNATGLGAAPPSKSILYRGKPVTVSFAR

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
65 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
73 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
133 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
134 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
137 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
138 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
139 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
155 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
158 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
159 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
175 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
206 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
207 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
208 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
209 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
210 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
213 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
214 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
215 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
216 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
217 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
218 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
219 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
220 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
221 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
222 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
223 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
224 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
225 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
226 2643221556 Massilia sp. Root1485 Isolate Unclassified
227 2643221583 Caulobacter sp. Root655 Isolate Unclassified
228 2643221638 Duganella sp. Root336D2 Isolate Unclassified
229 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
230 2643221645 Massilia sp. Root351 Isolate Unclassified
231 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
232 2643221664 Massilia sp. Root418 Isolate Unclassified
233 2643221684 Massilia sp. Root133 Isolate Unclassified
234 2738541280 Massilia sp. GV090 Isolate Unclassified
235 2738541300 Massilia sp. GV016 Isolate Unclassified
236 2738543018 Massilia sp. GV045 Isolate Unclassified
237 2738543030 Massilia sp. GV097 Isolate Unclassified
238 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
239 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
240 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
241 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
242 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
243 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
244 2821131069 Duganella sp. 1224 Isolate Unclassified
245 2842711865 Duganella sp. R-73148 Isolate Unclassified
246 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
247 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
248 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
249 2904424332 Duganella sp. 1411 Isolate Rhizosphere
250 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
251 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
252 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
253 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
254 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.21
Metatranscriptomes 0
Isolates 7.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.84
Nodule 0
Rhizoplane 2.92
Rhizosphere 59.37
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100000576 3300005455 Bacteria 19619
2 JGI24741J21665_1000426 3300001915 Bacteria 12780
3 JGI24741J21665_1001663 3300001915 Bacteria 6175
4 JGI24740J21852_10006425 3300001979 Bacteria 4869
5 JGI24740J21852_10009529 3300001979 Bacteria 3796
6 JGI24735J21928_10002943 3300002067 Bacteria 5854
7 JGI24735J21928_10008643 3300002067 Bacteria 3287
8 JGI24744J21845_10000760 3300002077 Bacteria 6018
9 JGI25156J39149_1000026 3300002705 Bacteria 132099
10 JGI25154J39366_1002022 3300002738 Bacteria 5858
11 JGI25157J39369_1000008 3300002741 Bacteria 211083
12 JGI25152J39213_1000002 3300002773 Bacteria 219237
13 JGI25150J39212_1000038 3300002774 Bacteria 88070
14 JGI25165J46597_1000082 3300003214 Bacteria 174736
15 JGI25153J46596_10000005 3300003215 Bacteria 492839
16 JGI25153J46596_10007021 3300003215 Bacteria 5608
17 rootL2_10017473 3300003322 Bacteria 12107
18 rootL2_10093835 3300003322 Bacteria 3625
19 JGI25161J50226_1000062 3300003374 Bacteria 99783
20 JGI25161J50226_1000758 3300003374 Bacteria 12367
21 Ga0055539_1000561 3300003752 Bacteria 10746
22 Ga0055526_1000229 3300003771 Bacteria 47279
23 Ga0055526_1000734 3300003771 Bacteria 24710
24 Ga0055526_1002194 3300003771 Bacteria 13377
25 Ga0055537_1000516 3300003773 Bacteria 22835
26 Ga0055537_1000569 3300003773 Bacteria 20727
27 Ga0055537_1001433 3300003773 Bacteria 9319
28 Ga0055524_1000095 3300003775 Bacteria 109223
29 Ga0055524_1000105 3300003775 Bacteria 104121
30 Ga0055524_1000543 3300003775 Bacteria 28542
31 Ga0055536_1000614 3300003781 Bacteria 24285
32 Ga0055536_1000979 3300003781 Bacteria 18138
33 Ga0055528_1000296 3300003790 Bacteria 42288
34 Ga0055530_10000078 3300003791 Bacteria 83740
35 Ga0055530_10001470 3300003791 Bacteria 17163
36 Ga0055530_10001919 3300003791 Bacteria 14197
37 Ga0055530_10003310 3300003791 Bacteria 9312
38 Ga0055531_10001121 3300003794 Bacteria 20738
39 Ga0055531_10001916 3300003794 Bacteria 14551
40 Ga0055543_1000413 3300004625 Bacteria 26934
41 Ga0065165_1000261 3300005262 Bacteria 90816
42 Ga0065165_1001967 3300005262 Bacteria 19463
43 Ga0070658_10000198 3300005327 Bacteria 53037
44 Ga0070658_10000997 3300005327 Bacteria 24288
45 Ga0070658_10001963 3300005327 Bacteria 17312
46 Ga0070658_10037455 3300005327 Bacteria 3910
47 Ga0070658_10062123 3300005327 Bacteria 3044
48 Ga0068869_100002615 3300005334 Bacteria 10866
49 Ga0068868_100000025 3300005338 Bacteria 82086
50 Ga0070660_100000328 3300005339 Bacteria 31334
51 Ga0070660_100002358 3300005339 Bacteria 12979
52 Ga0070660_100002527 3300005339 Bacteria 12533
53 Ga0070660_100007482 3300005339 Bacteria 7614
54 Ga0070660_100017743 3300005339 Bacteria 5191
55 Ga0070660_100023355 3300005339 Bacteria 4581
56 Ga0070661_100004712 3300005344 Bacteria 9384
57 Ga0070673_100000016 3300005364 Bacteria 114927
58 Ga0070659_100000795 3300005366 Bacteria 22991
59 Ga0070678_100000008 3300005456 Bacteria 64802
60 Ga0068867_100000962 3300005459 Bacteria 19626
61 Ga0070679_100007263 3300005530 Bacteria 10344
62 Ga0068853_100000036 3300005539 Bacteria 108488
63 Ga0068853_100001281 3300005539 Bacteria 18024
64 Ga0068855_100000007 3300005563 Bacteria 273676
65 Ga0068855_100008887 3300005563 Bacteria 12145
66 Ga0068855_100019042 3300005563 Bacteria 8252
67 Ga0068854_100000016 3300005578 Bacteria 145396
68 Ga0068854_100000092 3300005578 Bacteria 63516
69 Ga0068856_100053290 3300005614 Bacteria 3988
70 Ga0068852_100044171 3300005616 Bacteria 3782
71 Ga0068859_100000074 3300005617 Bacteria 92064
72 Ga0068861_100000017 3300005719 Bacteria 78362
73 Ga0068851_10004689 3300005834 Bacteria 6179
74 Ga0068858_100000608 3300005842 Bacteria 37381
75 Ga0075362_10007195 3300006177 Bacteria 4200
76 Ga0075370_10021119 3300006353 Bacteria 3566
77 Ga0068871_100005824 3300006358 Bacteria 8661
78 Ga0068865_100000026 3300006881 Bacteria 93349
79 Ga0097620_100000074 3300006931 Bacteria 92064
80 Ga0105240_10000025 3300009093 Bacteria 367124
81 Ga0105240_10008610 3300009093 Bacteria 14579
82 Ga0105240_10069202 3300009093 Bacteria 4370
83 Ga0105245_10000078 3300009098 Bacteria 100583
84 Ga0105245_10001409 3300009098 Bacteria 21801
85 Ga0105243_10000394 3300009148 Bacteria 46074
86 Ga0105243_10000475 3300009148 Bacteria 41145
87 Ga0105243_10018075 3300009148 Bacteria 5335
88 Ga0105241_10000625 3300009174 Bacteria 26580
89 Ga0105241_10012337 3300009174 Bacteria 6267
90 Ga0105241_10018109 3300009174 Bacteria 5179
91 Ga0105242_10000137 3300009176 Bacteria 53136
92 Ga0105242_10002432 3300009176 Bacteria 14627
93 Ga0105242_10009092 3300009176 Bacteria 7632
94 Ga0105248_10001759 3300009177 Bacteria 24104
95 Ga0105248_10027048 3300009177 Bacteria 6381
96 Ga0105237_10000130 3300009545 Bacteria 105282
97 Ga0105237_10036831 3300009545 Bacteria 4949
98 Ga0105239_10000605 3300010375 Bacteria 51086
99 Ga0105246_10008012 3300011119 Bacteria 6485
100 Ga0157371_10000094 3300013102 Bacteria 139074
101 Ga0157370_10000288 3300013104 Bacteria 63948
102 Ga0157374_10000087 3300013296 Bacteria 91263
103 Ga0157372_10021230 3300013307 Bacteria 7015
104 Ga0157372_10025027 3300013307 Bacteria 6486
105 Ga0157372_10039265 3300013307 Bacteria 5224
106 Ga0157375_10000503 3300013308 Bacteria 35295
107 Ga0157376_10003058 3300014969 Bacteria 11466
108 Ga0183365_10004 3300015684 Bacteria 333304
109 Ga0183365_10006 3300015684 Bacteria 225936
110 Ga0209436_100005 3300025208 Bacteria 151087
111 Ga0209436_100565 3300025208 Bacteria 15949
112 Ga0207427_102137 3300025231 Bacteria 5711
113 Ga0207425_1000001 3300025245 Bacteria 2525432
114 Ga0207425_1000119 3300025245 Bacteria 74008
115 Ga0209646_1000039 3300025246 Bacteria 349637
116 Ga0209026_1000006 3300025250 Bacteria 677225
117 Ga0209677_100549 3300025253 Bacteria 20845
118 Ga0209148_1000061 3300025254 Bacteria 349575
119 Ga0209148_1000650 3300025254 Bacteria 30019
120 Ga0209148_1001058 3300025254 Bacteria 16945
121 Ga0209759_1000020 3300025256 Bacteria 344904
122 Ga0209129_1000001 3300025258 Bacteria 1452436
123 Ga0209129_1004363 3300025258 Bacteria 5564
124 Ga0209233_1000041 3300025261 Bacteria 515463
125 Ga0209233_1007364 3300025261 Bacteria 3491
126 Ga0209565_1000008 3300025263 Bacteria 774179
127 Ga0209565_1000397 3300025263 Bacteria 36695
128 Ga0209565_1000643 3300025263 Bacteria 22611
129 Ga0209565_1000672 3300025263 Bacteria 21620
130 Ga0209565_1001325 3300025263 Bacteria 11340
131 Ga0209455_1000429 3300025272 Bacteria 32869
132 Ga0209673_1000007 3300025273 Bacteria 634477
133 Ga0209673_1001402 3300025273 Bacteria 23466
134 Ga0209130_1000055 3300025284 Bacteria 211696
135 Ga0209130_1001525 3300025284 Bacteria 14857
136 Ga0209675_1000003 3300025291 Bacteria 1003982
137 Ga0209675_1000234 3300025291 Bacteria 55443
138 Ga0209675_1000374 3300025291 Bacteria 37975
139 Ga0209676_1000295 3300025292 Bacteria 100711
140 Ga0209676_1000468 3300025292 Bacteria 67646
141 Ga0209564_1000124 3300025295 Bacteria 202046
142 Ga0209564_1000203 3300025295 Bacteria 136358
143 Ga0209564_1000444 3300025295 Bacteria 71274
144 Ga0209564_1000459 3300025295 Bacteria 68564
145 Ga0209564_1001715 3300025295 Bacteria 20596
146 Ga0209758_1000001 3300025297 Bacteria 1981790
147 Ga0209758_1000020 3300025297 Bacteria 734220
148 Ga0209050_1000253 3300025298 Bacteria 114525
149 Ga0209050_1000293 3300025298 Bacteria 106097
150 Ga0209050_1000313 3300025298 Bacteria 98580
151 Ga0209050_1000362 3300025298 Bacteria 87030
152 Ga0209050_1000486 3300025298 Bacteria 69279
153 Ga0209256_1000009 3300025299 Bacteria 922071
154 Ga0209256_1000010 3300025299 Bacteria 912110
155 Ga0209256_1000028 3300025299 Bacteria 420213
156 Ga0209256_1000097 3300025299 Bacteria 204513
157 Ga0209256_1000790 3300025299 Bacteria 40844
158 Ga0209256_1001184 3300025299 Bacteria 29313
159 Ga0209256_1001522 3300025299 Bacteria 23395
160 Ga0209256_1005370 3300025299 Bacteria 7418
161 Ga0209051_1009013 3300025303 Bacteria 5196
162 Ga0209257_1000003 3300025304 Bacteria 1702593
163 Ga0209257_1000520 3300025304 Bacteria 66890
164 Ga0209257_1000850 3300025304 Bacteria 43660
165 Ga0209257_1003579 3300025304 Bacteria 13165
166 Ga0209257_1006121 3300025304 Bacteria 7978
167 Ga0207656_10003715 3300025321 Bacteria 5284
168 Ga0207656_10012799 3300025321 Bacteria 3193
169 Ga0207688_10015724 3300025901 Bacteria 4105
170 Ga0207647_10004083 3300025904 Bacteria 10848
171 Ga0207647_10004207 3300025904 Bacteria 10674
172 Ga0207705_10000049 3300025909 Bacteria 170616
173 Ga0207705_10000249 3300025909 Bacteria 53095
174 Ga0207705_10007510 3300025909 Bacteria 8010
175 Ga0207705_10044287 3300025909 Unclassified 3198
176 Ga0207654_10000020 3300025911 Bacteria 167053
177 Ga0207654_10003662 3300025911 Bacteria 7751
178 Ga0207654_10014844 3300025911 Bacteria 4032
179 Ga0207695_10000025 3300025913 Bacteria 627211
180 Ga0207695_10005407 3300025913 Bacteria 16946
181 Ga0207695_10012282 3300025913 Bacteria 10287
182 Ga0207695_10017885 3300025913 Bacteria 8213
183 Ga0207671_10001177 3300025914 Bacteria 31119
184 Ga0207671_10023603 3300025914 Bacteria 4637
185 Ga0207657_10001967 3300025919 Bacteria 22194
186 Ga0207657_10002419 3300025919 Bacteria 20168
187 Ga0207657_10008244 3300025919 Bacteria 10606
188 Ga0207657_10032249 3300025919 Bacteria 4736
189 Ga0207657_10050412 3300025919 Bacteria 3623
190 Ga0207649_10009836 3300025920 Bacteria 5241
191 Ga0207652_10001407 3300025921 Bacteria 21349
192 Ga0207694_10007016 3300025924 Bacteria 8552
193 Ga0207694_10041828 3300025924 Bacteria 3532
194 Ga0207687_10002419 3300025927 Bacteria 12664
195 Ga0207664_10030391 3300025929 Unclassified 4125
196 Ga0207690_10004189 3300025932 Bacteria 8522
197 Ga0207706_10005052 3300025933 Bacteria 12318
198 Ga0207686_10002463 3300025934 Bacteria 10052
199 Ga0207709_10000139 3300025935 Bacteria 102200
200 Ga0207709_10000187 3300025935 Bacteria 82937
201 Ga0207709_10017749 3300025935 Bacteria 3977
202 Ga0207669_10001661 3300025937 Bacteria 9467
203 Ga0207704_10000006 3300025938 Bacteria 220005
204 Ga0207691_10014508 3300025940 Bacteria 7514
205 Ga0207711_10003423 3300025941 Bacteria 13728
206 Ga0207689_10001911 3300025942 Bacteria 19691
207 Ga0207667_10000006 3300025949 Bacteria 679876
208 Ga0207667_10000038 3300025949 Bacteria 280720
209 Ga0207667_10005692 3300025949 Bacteria 15198
210 Ga0207667_10010760 3300025949 Bacteria 10671
211 Ga0207651_10000001 3300025960 Bacteria 516823
212 Ga0207640_10000001 3300025981 Bacteria 628778
213 Ga0207640_10000142 3300025981 Bacteria 52324
214 Ga0207640_10004700 3300025981 Bacteria 7415
215 Ga0207677_10000016 3300026023 Bacteria 153771
216 Ga0207703_10000123 3300026035 Bacteria 92590
217 Ga0207639_10000058 3300026041 Bacteria 108456
218 Ga0207639_10001458 3300026041 Bacteria 15924
219 Ga0207639_10002766 3300026041 Bacteria 11786
220 Ga0207639_10005197 3300026041 Bacteria 8780
221 Ga0207678_10003654 3300026067 Bacteria 13821
222 Ga0207678_10004134 3300026067 Bacteria 13040
223 Ga0207678_10030842 3300026067 Unclassified 4681
224 Ga0207678_10042503 3300026067 Bacteria 3937
225 Ga0207702_10002032 3300026078 Bacteria 19607
226 Ga0207702_10002612 3300026078 Bacteria 16920
227 Ga0207702_10003011 3300026078 Bacteria 15666
228 Ga0207648_10000042 3300026089 Bacteria 114885
229 Ga0207674_10010322 3300026116 Bacteria 10588
230 Ga0207674_10023489 3300026116 Bacteria 6603
231 Ga0207675_100000462 3300026118 Bacteria 39560
232 Ga0207698_10013641 3300026142 Bacteria 5370
233 Ga0265326_10002838 3300028558 Bacteria 5782
234 Ga0307515_10000004 3300028794 Bacteria 846506
235 Ga0307515_10000026 3300028794 Bacteria 382411
236 Ga0307515_10035278 3300028794 Bacteria 8144
237 Ga0265331_10002582 3300031250 Bacteria 12175
238 Ga0307408_100000022 3300031548 Bacteria 310242
239 Ga0307408_100000964 3300031548 Bacteria 22306
240 Ga0307408_100001584 3300031548 Bacteria 16793
241 Ga0307408_100004400 3300031548 Bacteria 9562
242 Ga0307408_100007022 3300031548 Bacteria 7446
243 Ga0307508_10001070 3300031616 Bacteria 31688
244 Ga0307412_10000126 3300031911 Bacteria 56270
245 Ga0307414_10000270 3300032004 Bacteria 32016
246 Ga0373931_0000925 3300035691 Bacteria 12354
247 Ga0395900_0006364 3300037418 Bacteria 12310
248 Ga0395900_0052951 3300037418 Bacteria 4177
249 Ga0395898_0013893 3300037466 Bacteria 8275
250 Ga0395905_0013977 3300037471 Bacteria 7680
251 Ga0439461_0001555 3300041410 Bacteria 3560
252 Ga0451800_0972437 3300041459 Bacteria 17116
253 Ga0451806_498691 3300041462 Bacteria 4799
254 Ga0451807_2635666 3300041486 Bacteria 9989
255 Ga0439432_000490 3300042006 Bacteria 14764
256 Ga0439449_0000136 3300042007 Bacteria 24746
257 Ga0439449_0005325 3300042007 Bacteria 4928
258 Ga0439462_0000345 3300042015 Bacteria 8770
259 Ga0439458_0003719 3300042157 Bacteria 3539
260 Ga0451577_0010591 3300042876 Bacteria 8794
261 Ga0451577_0036398 3300042876 Bacteria 4430
262 Ga0466972_0000678 3300044658 Bacteria 16352
263 Ga0466965_0003484 3300044683 Bacteria 6905
264 Ga0466966_0003289 3300044684 Bacteria 10659
265 Ga0466961_0024527 3300044693 Bacteria 3879
266 Ga0466964_0000369 3300044706 Bacteria 13607
267 Ga0453684_0012388 3300044712 Bacteria 14076
268 Ga0451576_0000869 3300045051 Bacteria 58069
269 Ga0495627_001669 3300046453 Bacteria 12257
270 Ga0495638_0000294 3300046460 Bacteria 65635
271 Ga0495638_0000360 3300046460 Bacteria 56554
272 Ga0495650_0002387 3300046471 Bacteria 15378
273 Ga0495605_0000039 3300046474 Bacteria 196802
274 Ga0495639_0006254 3300046475 Bacteria 5116
275 Ga0495584_0000611 3300046491 Bacteria 23905
276 Ga0495584_0004954 3300046491 Bacteria 7099
277 Ga0495607_0001269 3300046501 Bacteria 22570
278 Ga0495607_0001918 3300046501 Bacteria 17580
279 Ga0495583_0000006 3300046506 Bacteria 436893
280 Ga0495606_0000059 3300046507 Bacteria 186886
281 Ga0495606_0012988 3300046507 Bacteria 6624
282 Ga0495610_0000091 3300046512 Bacteria 105916
283 Ga0495610_0002817 3300046512 Bacteria 14175
284 Ga0495610_0006775 3300046512 Bacteria 7773
285 Ga0495616_0000731 3300046513 Bacteria 24175
286 Ga0495616_0010686 3300046513 Bacteria 5301
287 Ga0495644_0001141 3300046523 Bacteria 10900
288 Ga0495648_0000263 3300046524 Bacteria 59213
289 Ga0495648_0010002 3300046524 Bacteria 7274
290 Ga0495663_0001405 3300046525 Bacteria 7594
291 Ga0495642_0001641 3300046528 Bacteria 9731
292 Ga0495609_0000019 3300046538 Bacteria 297777
293 Ga0495609_0000408 3300046538 Bacteria 35895
294 Ga0495597_0008096 3300046542 Bacteria 5288
295 Ga0495622_0000048 3300046557 Bacteria 108955
296 Ga0495633_0000024 3300046558 Bacteria 225077
297 Ga0495668_0001234 3300046616 Bacteria 25687
298 Ga0495625_0000043 3300046660 Bacteria 205715
299 Ga0495625_0000072 3300046660 Bacteria 166439
300 Ga0495625_0000519 3300046660 Bacteria 56854
301 Ga0495625_0001203 3300046660 Bacteria 32899
302 Ga0495625_0015917 3300046660 Bacteria 5934
303 Ga0495625_0018286 3300046660 Bacteria 5474
304 Ga0495659_0000185 3300046664 Bacteria 27168
305 Ga0495661_0000012 3300046665 Bacteria 276804
306 Ga0495661_0001409 3300046665 Bacteria 20155
307 Ga0495588_0000059 3300046674 Bacteria 263358
308 Ga0495588_0009381 3300046674 Bacteria 4521
309 Ga0495671_0000088 3300046692 Bacteria 87282
310 Ga0495649_0022092 3300046694 Bacteria 3562
311 Ga0495589_0000007 3300046794 Bacteria 276444
312 Ga0495589_0000047 3300046794 Bacteria 117810
313 Ga0495660_0000135 3300046810 Bacteria 80391
314 Ga0495672_0000262 3300047320 Bacteria 73028
315 Ga0495672_0001994 3300047320 Bacteria 19290
316 Ga0495687_000003 3300047443 Bacteria 859509
317 Ga0495687_000431 3300047443 Bacteria 51764
318 Ga0495687_000987 3300047443 Bacteria 28644
319 Ga0495687_002076 3300047443 Bacteria 16834
320 Ga0495677_0000150 3300047445 Bacteria 33321
321 Ga0495677_0012370 3300047445 Bacteria 3112
322 Ga0495673_0000025 3300047469 Bacteria 512352
323 Ga0495686_0000976 3300047472 Bacteria 35073
324 Ga0495626_0000047 3300048091 Bacteria 161939
325 Ga0496102_0000086 3300048905 Bacteria 132217
326 Ga0496103_0000055 3300048906 Bacteria 143870
327 Ga0496105_0000421 3300048908 Bacteria 27828
328 Ga0496107_0000033 3300048910 Bacteria 94532
329 Ga0496110_0010167 3300048913 Bacteria 7644
330 Ga0496111_0017866 3300048914 Bacteria 4905
331 Ga0496115_0000099 3300048918 Bacteria 82245
332 Ga0496116_0002282 3300048919 Bacteria 20338
333 Ga0496117_0000175 3300048920 Bacteria 132363
334 Ga0496118_0000325 3300048921 Bacteria 82266
335 Ga0496118_0004674 3300048921 Bacteria 16047
336 Ga0496118_0024252 3300048921 Bacteria 5244
337 Ga0496119_0005730 3300048922 Bacteria 11774
338 Ga0496120_0027005 3300048923 Bacteria 3538
339 Ga0496121_0000022 3300048924 Bacteria 472849
340 Ga0496121_0000259 3300048924 Bacteria 110676
341 Ga0496121_0000434 3300048924 Bacteria 82428
342 Ga0496121_0018321 3300048924 Bacteria 7068
343 Ga0496121_0018852 3300048924 Bacteria 6925
344 Ga0496122_0001697 3300048925 Bacteria 34173
345 Ga0496123_0001172 3300048926 Bacteria 38728
346 Ga0496123_0005237 3300048926 Bacteria 13174
347 Ga0496123_0030545 3300048926 Bacteria 3942
348 Ga0496124_0000367 3300048927 Bacteria 82348
349 Ga0496124_0006888 3300048927 Bacteria 12215
350 Ga0496124_0014393 3300048927 Bacteria 7648
351 Ga0496125_0008080 3300048928 Bacteria 11089
352 Ga0496125_0045027 3300048928 Bacteria 3720
353 Ga0496126_0000204 3300048929 Bacteria 132495
354 Ga0496126_0001931 3300048929 Bacteria 29568
355 Ga0495678_000483 3300049459 Bacteria 39595
356 Ga0501032_0009002 3300049569 Bacteria 7257
357 Ga0501033_0000047 3300049570 Bacteria 122884
358 Ga0501034_0010928 3300049571 Bacteria 9433
359 Ga0501038_0033705 3300049574 Bacteria 4508
360 Ga0501223_000116 3300049663 Bacteria 22926
361 Ga0501224_000011 3300049664 Bacteria 93275
362 Ga0501234_000263 3300049707 Bacteria 7656
363 Ga0501269_000459 3300049766 Bacteria 8929
364 Ga0501279_000104 3300049775 Bacteria 12890
365 Ga0501279_000571 3300049775 Bacteria 4810
366 Ga0501226_000024 3300049853 Bacteria 93123
367 nmdc:mga0k408_4722_c1 3300050493 Bacteria 7218
368 nmdc:mga0sz30_7848_c1 3300050516 Bacteria 4015
369 Ga0500578_0000043 3300053086 Bacteria 128295
370 Ga0500583_0001237 3300053092 Bacteria 7309
371 Ga0500556_0000186 3300053104 Bacteria 50723
372 Ga0500594_0000030 3300053118 Bacteria 47305
373 Ga0500608_000488 3300053122 Bacteria 14852
374 Ga0500642_0000192 3300053130 Bacteria 24971
375 Ga0500658_0000921 3300053134 Bacteria 12019
376 Ga0500577_0001773 3300053142 Bacteria 5515
377 Ga0500622_0002456 3300053156 Bacteria 13368
378 Ga0500622_0033357 3300053156 Bacteria 2699
379 Ga0500645_000149 3300053730 Bacteria 54622
380 2600203234 2599185354 Bacteria 4398675
381 2643744577 2643221544 Bacteria 5886209
382 2643791708 2643221554 Bacteria 6603920
383 2643797011 2643221556 Bacteria 7251154
384 2643924853 2643221583 Bacteria 5218014
385 2644211339 2643221638 Bacteria 6579467
386 2644219153 2643221639 Bacteria 6649903
387 2644253118 2643221645 Bacteria 7207331
388 2644255669 2643221646 Bacteria 6433402
389 2644355283 2643221664 Bacteria 7272945
390 2644469885 2643221684 Bacteria 7145183
391 2738741755 2738541280 Bacteria 6630198
392 2738843925 2738541300 Bacteria 6675882
393 2739274514 2738543018 Bacteria 6718814
394 2739343558 2738543030 Bacteria 6719714
395 2753766760 2751185897 Bacteria 5322941
396 2787438995 2786546517 Bacteria 6614109
397 2788436741 2786546940 Bacteria 6396474
398 2809063466 2808606401 Bacteria 4586670
399 2809079563 2808606404 Bacteria 4652788
400 2809083799 2808606405 Bacteria 4586632
401 2821135470 2821131069 Bacteria 6108407
402 2842712526 2842711865 Bacteria 7155354
403 2852685857 2852684882 Bacteria 5463342
404 2880520973 2880518877 Bacteria 5012590
405 2884963299 2884960567 Bacteria 5437054
406 2904425262 2904424332 Bacteria 7633521
407 2919141824 2919138771 Bacteria 5281312
408 2919712286 2919709256 Bacteria 4318106
409 2928531345 2928531327 Bacteria 5101314
410 8002870036 8002869464 Bacteria 3588529
411 8047676713 8047673197 Bacteria 7395230
412 Ga0070663_100000576
413 JGI24741J21665_1000426
414 JGI24741J21665_1001663
415 JGI24740J21852_10006425
416 JGI24740J21852_10009529
417 JGI24735J21928_10002943
418 JGI24735J21928_10008643
419 JGI24744J21845_10000760
420 JGI25156J39149_1000026
421 JGI25154J39366_1002022
422 JGI25157J39369_1000008
423 JGI25152J39213_1000002
424 JGI25150J39212_1000038
425 JGI25165J46597_1000082
426 JGI25153J46596_10000005
427 JGI25153J46596_10007021
428 rootL2_10017473
429 rootL2_10093835
430 JGI25161J50226_1000062
431 JGI25161J50226_1000758
432 Ga0055539_1000561
433 Ga0055526_1000229
434 Ga0055526_1000734
435 Ga0055526_1002194
436 Ga0055537_1000516
437 Ga0055537_1000569
438 Ga0055537_1001433
439 Ga0055524_1000095
440 Ga0055524_1000105
441 Ga0055524_1000543
442 Ga0055536_1000614
443 Ga0055536_1000979
444 Ga0055528_1000296
445 Ga0055530_10000078
446 Ga0055530_10001470
447 Ga0055530_10001919
448 Ga0055530_10003310
449 Ga0055531_10001121
450 Ga0055531_10001916
451 Ga0055543_1000413
452 Ga0065165_1000261
453 Ga0065165_1001967
454 Ga0070658_10000198
455 Ga0070658_10000997
456 Ga0070658_10001963
457 Ga0070658_10037455
458 Ga0070658_10062123
459 Ga0068869_100002615
460 Ga0068868_100000025
461 Ga0070660_100000328
462 Ga0070660_100002358
463 Ga0070660_100002527
464 Ga0070660_100007482
465 Ga0070660_100017743
466 Ga0070660_100023355
467 Ga0070661_100004712
468 Ga0070673_100000016
469 Ga0070659_100000795
470 Ga0070678_100000008
471 Ga0068867_100000962
472 Ga0070679_100007263
473 Ga0068853_100000036
474 Ga0068853_100001281
475 Ga0068855_100000007
476 Ga0068855_100008887
477 Ga0068855_100019042
478 Ga0068854_100000016
479 Ga0068854_100000092
480 Ga0068856_100053290
481 Ga0068852_100044171
482 Ga0068859_100000074
483 Ga0068861_100000017
484 Ga0068851_10004689
485 Ga0068858_100000608
486 Ga0075362_10007195
487 Ga0075370_10021119
488 Ga0068871_100005824
489 Ga0068865_100000026
490 Ga0097620_100000074
491 Ga0105240_10000025
492 Ga0105240_10008610
493 Ga0105240_10069202
494 Ga0105245_10000078
495 Ga0105245_10001409
496 Ga0105243_10000394
497 Ga0105243_10000475
498 Ga0105243_10018075
499 Ga0105241_10000625
500 Ga0105241_10012337
501 Ga0105241_10018109
502 Ga0105242_10000137
503 Ga0105242_10002432
504 Ga0105242_10009092
505 Ga0105248_10001759
506 Ga0105248_10027048
507 Ga0105237_10000130
508 Ga0105237_10036831
509 Ga0105239_10000605
510 Ga0105246_10008012
511 Ga0157371_10000094
512 Ga0157370_10000288
513 Ga0157374_10000087
514 Ga0157372_10021230
515 Ga0157372_10025027
516 Ga0157372_10039265
517 Ga0157375_10000503
518 Ga0157376_10003058
519 Ga0183365_10004
520 Ga0183365_10006
521 Ga0209436_100005
522 Ga0209436_100565
523 Ga0207427_102137
524 Ga0207425_1000001
525 Ga0207425_1000119
526 Ga0209646_1000039
527 Ga0209026_1000006
528 Ga0209677_100549
529 Ga0209148_1000061
530 Ga0209148_1000650
531 Ga0209148_1001058
532 Ga0209759_1000020
533 Ga0209129_1000001
534 Ga0209129_1004363
535 Ga0209233_1000041
536 Ga0209233_1007364
537 Ga0209565_1000008
538 Ga0209565_1000397
539 Ga0209565_1000643
540 Ga0209565_1000672
541 Ga0209565_1001325
542 Ga0209455_1000429
543 Ga0209673_1000007
544 Ga0209673_1001402
545 Ga0209130_1000055
546 Ga0209130_1001525
547 Ga0209675_1000003
548 Ga0209675_1000234
549 Ga0209675_1000374
550 Ga0209676_1000295
551 Ga0209676_1000468
552 Ga0209564_1000124
553 Ga0209564_1000203
554 Ga0209564_1000444
555 Ga0209564_1000459
556 Ga0209564_1001715
557 Ga0209758_1000001
558 Ga0209758_1000020
559 Ga0209050_1000253
560 Ga0209050_1000293
561 Ga0209050_1000313
562 Ga0209050_1000362
563 Ga0209050_1000486
564 Ga0209256_1000009
565 Ga0209256_1000010
566 Ga0209256_1000028
567 Ga0209256_1000097
568 Ga0209256_1000790
569 Ga0209256_1001184
570 Ga0209256_1001522
571 Ga0209256_1005370
572 Ga0209051_1009013
573 Ga0209257_1000003
574 Ga0209257_1000520
575 Ga0209257_1000850
576 Ga0209257_1003579
577 Ga0209257_1006121
578 Ga0207656_10003715
579 Ga0207656_10012799
580 Ga0207688_10015724
581 Ga0207647_10004083
582 Ga0207647_10004207
583 Ga0207705_10000049
584 Ga0207705_10000249
585 Ga0207705_10007510
586 Ga0207705_10044287
587 Ga0207654_10000020
588 Ga0207654_10003662
589 Ga0207654_10014844
590 Ga0207695_10000025
591 Ga0207695_10005407
592 Ga0207695_10012282
593 Ga0207695_10017885
594 Ga0207671_10001177
595 Ga0207671_10023603
596 Ga0207657_10001967
597 Ga0207657_10002419
598 Ga0207657_10008244
599 Ga0207657_10032249
600 Ga0207657_10050412
601 Ga0207649_10009836
602 Ga0207652_10001407
603 Ga0207694_10007016
604 Ga0207694_10041828
605 Ga0207687_10002419
606 Ga0207664_10030391
607 Ga0207690_10004189
608 Ga0207706_10005052
609 Ga0207686_10002463
610 Ga0207709_10000139
611 Ga0207709_10000187
612 Ga0207709_10017749
613 Ga0207669_10001661
614 Ga0207704_10000006
615 Ga0207691_10014508
616 Ga0207711_10003423
617 Ga0207689_10001911
618 Ga0207667_10000006
619 Ga0207667_10000038
620 Ga0207667_10005692
621 Ga0207667_10010760
622 Ga0207651_10000001
623 Ga0207640_10000001
624 Ga0207640_10000142
625 Ga0207640_10004700
626 Ga0207677_10000016
627 Ga0207703_10000123
628 Ga0207639_10000058
629 Ga0207639_10001458
630 Ga0207639_10002766
631 Ga0207639_10005197
632 Ga0207678_10003654
633 Ga0207678_10004134
634 Ga0207678_10030842
635 Ga0207678_10042503
636 Ga0207702_10002032
637 Ga0207702_10002612
638 Ga0207702_10003011
639 Ga0207648_10000042
640 Ga0207674_10010322
641 Ga0207674_10023489
642 Ga0207675_100000462
643 Ga0207698_10013641
644 Ga0265326_10002838
645 Ga0307515_10000004
646 Ga0307515_10000026
647 Ga0307515_10035278
648 Ga0265331_10002582
649 Ga0307408_100000022
650 Ga0307408_100000964
651 Ga0307408_100001584
652 Ga0307408_100004400
653 Ga0307408_100007022
654 Ga0307508_10001070
655 Ga0307412_10000126
656 Ga0307414_10000270
657 Ga0373931_0000925
658 Ga0395900_0006364
659 Ga0395900_0052951
660 Ga0395898_0013893
661 Ga0395905_0013977
662 Ga0439461_0001555
663 Ga0451800_0972437
664 Ga0451806_498691
665 Ga0451807_2635666
666 Ga0439432_000490
667 Ga0439449_0000136
668 Ga0439449_0005325
669 Ga0439462_0000345
670 Ga0439458_0003719
671 Ga0451577_0010591
672 Ga0451577_0036398
673 Ga0466972_0000678
674 Ga0466965_0003484
675 Ga0466966_0003289
676 Ga0466961_0024527
677 Ga0466964_0000369
678 Ga0453684_0012388
679 Ga0451576_0000869
680 Ga0495627_001669
681 Ga0495638_0000294
682 Ga0495638_0000360
683 Ga0495650_0002387
684 Ga0495605_0000039
685 Ga0495639_0006254
686 Ga0495584_0000611
687 Ga0495584_0004954
688 Ga0495607_0001269
689 Ga0495607_0001918
690 Ga0495583_0000006
691 Ga0495606_0000059
692 Ga0495606_0012988
693 Ga0495610_0000091
694 Ga0495610_0002817
695 Ga0495610_0006775
696 Ga0495616_0000731
697 Ga0495616_0010686
698 Ga0495644_0001141
699 Ga0495648_0000263
700 Ga0495648_0010002
701 Ga0495663_0001405
702 Ga0495642_0001641
703 Ga0495609_0000019
704 Ga0495609_0000408
705 Ga0495597_0008096
706 Ga0495622_0000048
707 Ga0495633_0000024
708 Ga0495668_0001234
709 Ga0495625_0000043
710 Ga0495625_0000072
711 Ga0495625_0000519
712 Ga0495625_0001203
713 Ga0495625_0015917
714 Ga0495625_0018286
715 Ga0495659_0000185
716 Ga0495661_0000012
717 Ga0495661_0001409
718 Ga0495588_0000059
719 Ga0495588_0009381
720 Ga0495671_0000088
721 Ga0495649_0022092
722 Ga0495589_0000007
723 Ga0495589_0000047
724 Ga0495660_0000135
725 Ga0495672_0000262
726 Ga0495672_0001994
727 Ga0495687_000003
728 Ga0495687_000431
729 Ga0495687_000987
730 Ga0495687_002076
731 Ga0495677_0000150
732 Ga0495677_0012370
733 Ga0495673_0000025
734 Ga0495686_0000976
735 Ga0495626_0000047
736 Ga0496102_0000086
737 Ga0496103_0000055
738 Ga0496105_0000421
739 Ga0496107_0000033
740 Ga0496110_0010167
741 Ga0496111_0017866
742 Ga0496115_0000099
743 Ga0496116_0002282
744 Ga0496117_0000175
745 Ga0496118_0000325
746 Ga0496118_0004674
747 Ga0496118_0024252
748 Ga0496119_0005730
749 Ga0496120_0027005
750 Ga0496121_0000022
751 Ga0496121_0000259
752 Ga0496121_0000434
753 Ga0496121_0018321
754 Ga0496121_0018852
755 Ga0496122_0001697
756 Ga0496123_0001172
757 Ga0496123_0005237
758 Ga0496123_0030545
759 Ga0496124_0000367
760 Ga0496124_0006888
761 Ga0496124_0014393
762 Ga0496125_0008080
763 Ga0496125_0045027
764 Ga0496126_0000204
765 Ga0496126_0001931
766 Ga0495678_000483
767 Ga0501032_0009002
768 Ga0501033_0000047
769 Ga0501034_0010928
770 Ga0501038_0033705
771 Ga0501223_000116
772 Ga0501224_000011
773 Ga0501234_000263
774 Ga0501269_000459
775 Ga0501279_000104
776 Ga0501279_000571
777 Ga0501226_000024
778 nmdc:mga0k408_4722_c1
779 nmdc:mga0sz30_7848_c1
780 Ga0500578_0000043
781 Ga0500583_0001237
782 Ga0500556_0000186
783 Ga0500594_0000030
784 Ga0500608_000488
785 Ga0500642_0000192
786 Ga0500658_0000921
787 Ga0500577_0001773
788 Ga0500622_0002456
789 Ga0500622_0033357
790 Ga0500645_000149
791 2600203234
792 2643744577
793 2643791708
794 2643797011
795 2643924853
796 2644211339
797 2644219153
798 2644253118
799 2644255669
800 2644355283
801 2644469885
802 2738741755
803 2738843925
804 2739274514
805 2739343558
806 2753766760
807 2787438995
808 2788436741
809 2809063466
810 2809079563
811 2809083799
812 2821135470
813 2842712526
814 2852685857
815 2880520973
816 2884963299
817 2904425262
818 2919141824
819 2919712286
820 2928531345
821 8002870036
822 8047676713

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17137

DUF5110

Domain of unknown function (DUF5110)

926

995

0.96

PF21365

Glyco_hydro_31_3rd

Glycosyl hydrolase family 31 C-terminal domain

661

708

0.93

PF21365

Glyco_hydro_31_3rd

Glycosyl hydrolase family 31 C-terminal domain

854

910

0.92

PF01055

Glyco_hydro_31_2nd

Glycosyl hydrolases family 31 TIM-barrel domain

317

653

0.89

PF07691

PA14

PA14 domain

721

858

0.87

PF13802

Gal_mutarotas_2

Glycosyl hydrolase 31 N-terminal galactose mutarotase-like domain

114

275

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b9y-assembly1.cif.gz_A crystal structure of apo agd31b, alpha-transglucosylase in glycoside hydrolase family 31 0.8892 50 947
5i24-assembly1.cif.gz_A crystal structure of agd31b, alpha-transglucosylase in glycoside hydrolase family 31, in complex with cyclophellitol aziridine probe cf021 0.8872 50 947
5npd-assembly1.cif.gz_A crystal structure of d412n nucleophile mutant cjagd31b (alpha-transglucosylase from glycoside hydrolase family 31) in complex with alpha cyclophellitol aziridine probe cf021 0.8872 50 947
4ba0-assembly1.cif.gz_A-2 crystal structure of agd31b, alpha-transglucosylase, complexed with 5f-alpha-glcf 0.887 50 947
5zn7-assembly2.cif.gz_E crystal structure of gh31 alpha-xylosidase from a soil metagenome complexed with xylose 0.8782 52 860
ID Description Score Start End Superfamily
5npeA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9143 255 647 3.20.20.80
2xvkA03 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9125 273 617 3.20.20.80
5npeA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9119 255 647 3.20.20.80
5jouA01 Mainly Beta;Sandwich;Immunoglobulin-like;glycosyl hydrolase (family 31) 0.9089 44 269 2.60.40.1760
2xvlA05 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.8998 861 975 2.60.40.1180
ID Description Score Start End GO Terms
AF-A0A353GKB2-F1-model_v4 Glycoside hydrolase 0.9789 22 667 GO:0004553
GO:0005975
GO:0030246
AF-A0A520HWM5-F1-model_v4 DUF5110 domain-containing protein 0.9627 254 919 GO:0004553
GO:0005975
AF-A0A353GKB2-F1-model_v4 Glycoside hydrolase 0.9568 22 667 GO:0004553
GO:0005975
GO:0030246
AF-A0A662I7F6-F1-model_v4 Alpha-xylosidase 0.9546 91 976 GO:0004553
GO:0005975
GO:0030246
AF-A7LRS4-F1-model_v4 deleted 0.9545 820 976

Map