F437512

General Info

Members Datasets Scaffolds Average Seq Length
411 166 822 216

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10458885|Ga0157370_104588852
Length 245
Sequence LIPILIMSVVASTPPAQPARANPLITGTATRQACPDLVTPDALICRALDAEKAGNNASAAQGFEEAAKASGDKDPKTARMYAAAGNLWIAANEPAKAAADLDKSLALNGLEGKQRGEALLDRARAAEQQDDLATARAKLNQAKEIISDDPFYWYFSAALALREHDGQTAQLAIGKALSMAPGDPAVLFEAGHIADFNGDDDQARSYWMRAAGSDPDGPVGKAAAKAVEMLGVTPVLKTDPTPAKN

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 3.41
Rhizosphere 95.86
Stem 0
Stem Tuber 0
Unclassified 3.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10458885 3300013104 Unclassified 1171
2 JGI24752J21851_1009606 3300001976 Bacteria 1262
3 JGI24740J21852_10000442 3300001979 Bacteria 17721
4 JGI24740J21852_10003212 3300001979 Bacteria 7212
5 JGI24739J22299_10000307 3300001989 Bacteria 16633
6 JGI24737J22298_10000206 3300001990 Bacteria 19194
7 JGI24737J22298_10000252 3300001990 Bacteria 17703
8 JGI24738J21930_10000885 3300002075 Bacteria 8575
9 Ga0070658_10000374 3300005327 Bacteria 38937
10 Ga0070658_10234221 3300005327 Bacteria 1555
11 Ga0070676_10007504 3300005328 Bacteria 5856
12 Ga0070683_100004192 3300005329 Bacteria 11822
13 Ga0070683_100091962 3300005329 Bacteria 2849
14 Ga0070690_100194437 3300005330 Bacteria 1408
15 Ga0070670_100148762 3300005331 Bacteria 2026
16 Ga0068869_100163275 3300005334 Bacteria 1735
17 Ga0070666_10046219 3300005335 Bacteria 2920
18 Ga0070680_100058253 3300005336 Bacteria 3159
19 Ga0070682_100043402 3300005337 Bacteria 2780
20 Ga0070682_100280308 3300005337 Bacteria 1215
21 Ga0068868_100001128 3300005338 Bacteria 18247
22 Ga0070660_100000209 3300005339 Bacteria 39223
23 Ga0070660_100068086 3300005339 Bacteria 2774
24 Ga0070660_100222197 3300005339 Bacteria 1535
25 Ga0070660_100279560 3300005339 Bacteria 1366
26 Ga0070660_100476090 3300005339 Bacteria 1037
27 Ga0070691_10017346 3300005341 Bacteria 3312
28 Ga0070661_100032636 3300005344 Bacteria 3768
29 Ga0070661_100085764 3300005344 Bacteria 2328
30 Ga0070692_10046140 3300005345 Bacteria 2251
31 Ga0070668_100007947 3300005347 Bacteria 7878
32 Ga0070669_100001511 3300005353 Bacteria 16803
33 Ga0070669_100149851 3300005353 Bacteria 1805
34 Ga0070675_100092185 3300005354 Bacteria 2540
35 Ga0070675_100171501 3300005354 Bacteria 1871
36 Ga0070671_100008331 3300005355 Bacteria 8301
37 Ga0070671_100015829 3300005355 Bacteria 6092
38 Ga0070674_100196452 3300005356 Bacteria 1555
39 Ga0070673_100002049 3300005364 Bacteria 12152
40 Ga0070673_100404988 3300005364 Bacteria 1220
41 Ga0070673_100407038 3300005364 Bacteria 1217
42 Ga0070659_100000565 3300005366 Bacteria 27071
43 Ga0070659_100007554 3300005366 Bacteria 7902
44 Ga0070659_100028961 3300005366 Bacteria 4278
45 Ga0070659_100075531 3300005366 Bacteria 2686
46 Ga0070659_100127386 3300005366 Bacteria 2066
47 Ga0070659_100317251 3300005366 Bacteria 1302
48 Ga0070659_100365248 3300005366 Bacteria 1213
49 Ga0070667_100001792 3300005367 Bacteria 19117
50 Ga0070667_100151191 3300005367 Bacteria 2039
51 Ga0070667_100158360 3300005367 Bacteria 1993
52 Ga0070667_100256718 3300005367 Bacteria 1564
53 Ga0070714_100028574 3300005435 Bacteria 4629
54 Ga0070714_100123453 3300005435 Unclassified 2306
55 Ga0070663_100014574 3300005455 Bacteria 5050
56 Ga0070663_100035009 3300005455 Bacteria 3481
57 Ga0070663_100039702 3300005455 Bacteria 3291
58 Ga0070678_100098004 3300005456 Bacteria 2266
59 Ga0070662_100000012 3300005457 Bacteria 129380
60 Ga0070662_100000854 3300005457 Bacteria 18719
61 Ga0070662_100323892 3300005457 Bacteria 1257
62 Ga0070681_10127401 3300005458 Bacteria 2479
63 Ga0068867_100000662 3300005459 Bacteria 22816
64 Ga0068867_100003278 3300005459 Bacteria 11405
65 Ga0070679_100119696 3300005530 Bacteria 2618
66 Ga0070679_100218021 3300005530 Bacteria 1870
67 Ga0070684_100026091 3300005535 Bacteria 4918
68 Ga0070684_100082577 3300005535 Bacteria 2845
69 Ga0070684_100507901 3300005535 Bacteria 1117
70 Ga0068853_100002629 3300005539 Bacteria 13520
71 Ga0068853_100045219 3300005539 Bacteria 3770
72 Ga0068853_100260724 3300005539 Bacteria 1593
73 Ga0068853_100272406 3300005539 Bacteria 1559
74 Ga0070672_100000558 3300005543 Bacteria 21795
75 Ga0070672_100068098 3300005543 Bacteria 2823
76 Ga0070693_100172350 3300005547 Bacteria 1387
77 Ga0070665_100026709 3300005548 Bacteria 5814
78 Ga0070665_100353984 3300005548 Bacteria 1474
79 Ga0068855_100000591 3300005563 Bacteria 44412
80 Ga0068855_100024315 3300005563 Bacteria 7252
81 Ga0068855_100050704 3300005563 Bacteria 4890
82 Ga0068855_100824487 3300005563 Bacteria 984
83 Ga0068855_100824488 3300005563 Bacteria 984
84 Ga0070664_100002849 3300005564 Bacteria 13993
85 Ga0070664_100038934 3300005564 Bacteria 4003
86 Ga0070664_100055645 3300005564 Bacteria 3360
87 Ga0070664_100059468 3300005564 Bacteria 3251
88 Ga0070664_100265622 3300005564 Bacteria 1545
89 Ga0070664_100723989 3300005564 Bacteria 928
90 Ga0068857_100003855 3300005577 Bacteria 12623
91 Ga0068857_100030612 3300005577 Bacteria 4753
92 Ga0068857_100215003 3300005577 Bacteria 1755
93 Ga0068857_100319179 3300005577 Unclassified 1434
94 Ga0068854_100004086 3300005578 Bacteria 9170
95 Ga0068854_100006478 3300005578 Bacteria 7451
96 Ga0068854_100030779 3300005578 Bacteria 3725
97 Ga0068854_100065629 3300005578 Bacteria 2639
98 Ga0068854_100106929 3300005578 Bacteria 2105
99 Ga0068856_100000190 3300005614 Bacteria 64644
100 Ga0068856_101130020 3300005614 Bacteria 800
101 Ga0068852_100000395 3300005616 Bacteria 29245
102 Ga0068852_100008050 3300005616 Bacteria 7731
103 Ga0068852_100033583 3300005616 Bacteria 4262
104 Ga0068852_100038247 3300005616 Bacteria 4031
105 Ga0068852_100777761 3300005616 Bacteria 970
106 Ga0068859_100003615 3300005617 Bacteria 15772
107 Ga0068859_100040131 3300005617 Bacteria 4698
108 Ga0068864_100003050 3300005618 Bacteria 13831
109 Ga0068864_100014893 3300005618 Bacteria 6460
110 Ga0068864_100092522 3300005618 Bacteria 2669
111 Ga0068861_100007538 3300005719 Bacteria 7462
112 Ga0068861_100079615 3300005719 Bacteria 2562
113 Ga0068851_10009379 3300005834 Bacteria 4549
114 Ga0068851_10058749 3300005834 Bacteria 1966
115 Ga0068851_10210792 3300005834 Unclassified 1088
116 Ga0068863_100007016 3300005841 Bacteria 11040
117 Ga0068863_100026328 3300005841 Bacteria 5549
118 Ga0068863_100193014 3300005841 Bacteria 1957
119 Ga0068858_100011989 3300005842 Bacteria 8171
120 Ga0068858_100238813 3300005842 Bacteria 1724
121 Ga0068860_100002873 3300005843 Bacteria 17873
122 Ga0068860_100080459 3300005843 Bacteria 3098
123 Ga0068860_100428066 3300005843 Bacteria 1313
124 Ga0068862_100011149 3300005844 Bacteria 7422
125 Ga0075366_10399725 3300006195 Bacteria 846
126 Ga0097621_100007674 3300006237 Bacteria 7737
127 Ga0097621_100047899 3300006237 Bacteria 3465
128 Ga0068871_100086882 3300006358 Bacteria 2599
129 Ga0068871_100320466 3300006358 Bacteria 1365
130 Ga0097620_100003615 3300006931 Bacteria 15772
131 Ga0097620_100040129 3300006931 Bacteria 4698
132 Ga0075435_100202712 3300007076 Bacteria 1681
133 Ga0105251_10048416 3300009011 Bacteria 2037
134 Ga0105240_10131645 3300009093 Bacteria 2999
135 Ga0105240_10689078 3300009093 Bacteria 1116
136 Ga0105245_10002121 3300009098 Bacteria 17965
137 Ga0105243_10088307 3300009148 Bacteria 2547
138 Ga0105241_10058462 3300009174 Bacteria 2961
139 Ga0105241_11016169 3300009174 Bacteria 776
140 Ga0105248_10000083 3300009177 Bacteria 110619
141 Ga0105248_10001592 3300009177 Bacteria 25260
142 Ga0105248_11206301 3300009177 Unclassified 855
143 Ga0105237_10027386 3300009545 Bacteria 5819
144 Ga0105237_10125346 3300009545 Bacteria 2563
145 Ga0105238_10060953 3300009551 Bacteria 3776
146 Ga0105238_10150193 3300009551 Bacteria 2305
147 Ga0105239_10012707 3300010375 Bacteria 9369
148 Ga0105239_10504831 3300010375 Bacteria 1375
149 Ga0157373_10014518 3300013100 Bacteria 5773
150 Ga0157373_10027921 3300013100 Bacteria 4072
151 Ga0157373_10101879 3300013100 Bacteria 2020
152 Ga0157373_10448692 3300013100 Bacteria 928
153 Ga0157371_10008908 3300013102 Bacteria 7947
154 Ga0157371_10013378 3300013102 Bacteria 6234
155 Ga0157371_10051752 3300013102 Bacteria 2918
156 Ga0157371_10127961 3300013102 Bacteria 1806
157 Ga0157371_10306408 3300013102 Bacteria 1150
158 Ga0157370_10005277 3300013104 Bacteria 14518
159 Ga0157370_10072675 3300013104 Bacteria 3245
160 Ga0157369_10331056 3300013105 Bacteria 1582
161 Ga0157369_11018104 3300013105 Bacteria 848
162 Ga0157374_10025193 3300013296 Bacteria 5338
163 Ga0157374_10131121 3300013296 Bacteria 2426
164 Ga0157374_10279882 3300013296 Bacteria 1647
165 Ga0157378_10000154 3300013297 Bacteria 64986
166 Ga0163162_10087181 3300013306 Bacteria 3200
167 Ga0157372_10042514 3300013307 Bacteria 5027
168 Ga0157372_10113320 3300013307 Bacteria 3108
169 Ga0157372_10905372 3300013307 Bacteria 1023
170 Ga0157375_10577897 3300013308 Bacteria 1284
171 Ga0163163_10000364 3300014325 Bacteria 43563
172 Ga0163163_10095748 3300014325 Bacteria 2988
173 Ga0163163_10209021 3300014325 Bacteria 2000
174 Ga0157379_10005320 3300014968 Bacteria 11057
175 Ga0197907_10545280 3300020069 Bacteria 1390
176 Ga0207697_10000059 3300025315 Bacteria 45306
177 Ga0207656_10080149 3300025321 Bacteria 1466
178 Ga0207688_10001805 3300025901 Bacteria 11389
179 Ga0207688_10051977 3300025901 Bacteria 2295
180 Ga0207680_10022148 3300025903 Bacteria 3451
181 Ga0207680_10090791 3300025903 Bacteria 1942
182 Ga0207647_10001983 3300025904 Bacteria 15649
183 Ga0207647_10003750 3300025904 Bacteria 11358
184 Ga0207647_10005744 3300025904 Bacteria 9057
185 Ga0207647_10034868 3300025904 Bacteria 3209
186 Ga0207647_10190981 3300025904 Bacteria 1187
187 Ga0207647_10192723 3300025904 Unclassified 1181
188 Ga0207645_10008346 3300025907 Bacteria 7233
189 Ga0207705_10000072 3300025909 Bacteria 126043
190 Ga0207705_10025156 3300025909 Bacteria 4250
191 Ga0207705_10062574 3300025909 Bacteria 2688
192 Ga0207654_10033330 3300025911 Bacteria 2854
193 Ga0207654_10544103 3300025911 Bacteria 824
194 Ga0207707_10114422 3300025912 Bacteria 2358
195 Ga0207695_10005583 3300025913 Bacteria 16616
196 Ga0207671_10062809 3300025914 Bacteria 2759
197 Ga0207671_10383211 3300025914 Bacteria 1117
198 Ga0207660_10056156 3300025917 Bacteria 2817
199 Ga0207657_10000496 3300025919 Bacteria 41552
200 Ga0207657_10007401 3300025919 Bacteria 11255
201 Ga0207657_10009405 3300025919 Bacteria 9827
202 Ga0207657_10010147 3300025919 Bacteria 9413
203 Ga0207657_10036902 3300025919 Bacteria 4371
204 Ga0207649_10000158 3300025920 Bacteria 55609
205 Ga0207649_10022700 3300025920 Bacteria 3626
206 Ga0207649_10069176 3300025920 Bacteria 2247
207 Ga0207649_10238154 3300025920 Bacteria 1305
208 Ga0207652_10103256 3300025921 Bacteria 2520
209 Ga0207681_10004274 3300025923 Bacteria 8818
210 Ga0207694_10056766 3300025924 Bacteria 3042
211 Ga0207650_10007030 3300025925 Bacteria 7674
212 Ga0207650_10035924 3300025925 Bacteria 3602
213 Ga0207650_10055340 3300025925 Bacteria 2945
214 Ga0207650_10212949 3300025925 Bacteria 1552
215 Ga0207650_10533394 3300025925 Bacteria 983
216 Ga0207659_10079781 3300025926 Bacteria 2416
217 Ga0207659_10085399 3300025926 Bacteria 2345
218 Ga0207687_10000745 3300025927 Bacteria 21993
219 Ga0207664_10186671 3300025929 Bacteria 1783
220 Ga0207644_10014155 3300025931 Bacteria 5335
221 Ga0207690_10001410 3300025932 Bacteria 15127
222 Ga0207690_10005347 3300025932 Bacteria 7567
223 Ga0207690_10006807 3300025932 Bacteria 6779
224 Ga0207690_10009277 3300025932 Bacteria 5846
225 Ga0207690_10012196 3300025932 Bacteria 5143
226 Ga0207690_10061001 3300025932 Bacteria 2562
227 Ga0207690_10439077 3300025932 Bacteria 1047
228 Ga0207706_10000041 3300025933 Bacteria 130090
229 Ga0207706_10000426 3300025933 Bacteria 45291
230 Ga0207706_10009215 3300025933 Bacteria 9068
231 Ga0207706_10296958 3300025933 Bacteria 1408
232 Ga0207709_10081304 3300025935 Bacteria 2089
233 Ga0207669_10150285 3300025937 Bacteria 1630
234 Ga0207704_10008562 3300025938 Bacteria 4898
235 Ga0207691_10000563 3300025940 Bacteria 37125
236 Ga0207691_10036319 3300025940 Bacteria 4565
237 Ga0207711_10387692 3300025941 Bacteria 1297
238 Ga0207689_10000128 3300025942 Bacteria 64122
239 Ga0207661_10002967 3300025944 Bacteria 11736
240 Ga0207661_10062691 3300025944 Bacteria 3008
241 Ga0207679_10003505 3300025945 Bacteria 9706
242 Ga0207679_10009869 3300025945 Bacteria 6130
243 Ga0207679_10199466 3300025945 Bacteria 1670
244 Ga0207667_10002008 3300025949 Bacteria 25533
245 Ga0207667_10012442 3300025949 Bacteria 9805
246 Ga0207667_10029689 3300025949 Bacteria 5926
247 Ga0207667_10309687 3300025949 Bacteria 1613
248 Ga0207651_10009399 3300025960 Bacteria 5349
249 Ga0207651_10244472 3300025960 Bacteria 1464
250 Ga0207668_10081042 3300025972 Bacteria 2353
251 Ga0207640_10000791 3300025981 Bacteria 17974
252 Ga0207640_10033277 3300025981 Bacteria 3206
253 Ga0207640_10229117 3300025981 Bacteria 1428
254 Ga0207658_10006868 3300025986 Bacteria 7753
255 Ga0207658_10059695 3300025986 Bacteria 2842
256 Ga0207658_10162842 3300025986 Bacteria 1830
257 Ga0207658_10413477 3300025986 Bacteria 1188
258 Ga0207658_10459869 3300025986 Unclassified 1128
259 Ga0207677_10007597 3300026023 Bacteria 6013
260 Ga0207703_10016065 3300026035 Bacteria 5839
261 Ga0207703_10087439 3300026035 Bacteria 2613
262 Ga0207639_10009793 3300026041 Bacteria 6621
263 Ga0207639_10126298 3300026041 Bacteria 2110
264 Ga0207639_10135239 3300026041 Bacteria 2046
265 Ga0207639_10155784 3300026041 Bacteria 1919
266 Ga0207639_10210548 3300026041 Bacteria 1673
267 Ga0207678_10004407 3300026067 Bacteria 12660
268 Ga0207678_10005554 3300026067 Bacteria 11268
269 Ga0207678_10015630 3300026067 Bacteria 6673
270 Ga0207678_10029713 3300026067 Bacteria 4772
271 Ga0207678_10055631 3300026067 Bacteria 3408
272 Ga0207678_10497668 3300026067 Bacteria 1062
273 Ga0207702_10003674 3300026078 Bacteria 13889
274 Ga0207702_10008508 3300026078 Bacteria 8652
275 Ga0207702_10052679 3300026078 Bacteria 3444
276 Ga0207702_10233701 3300026078 Bacteria 1719
277 Ga0207641_10036013 3300026088 Bacteria 4128
278 Ga0207648_10003077 3300026089 Bacteria 17625
279 Ga0207648_10006572 3300026089 Bacteria 11545
280 Ga0207676_10001069 3300026095 Bacteria 20852
281 Ga0207676_10032734 3300026095 Bacteria 3921
282 Ga0207676_10051296 3300026095 Bacteria 3220
283 Ga0207674_10000086 3300026116 Bacteria 100722
284 Ga0207674_10000531 3300026116 Bacteria 49979
285 Ga0207674_10001687 3300026116 Bacteria 28359
286 Ga0207674_10001715 3300026116 Bacteria 28037
287 Ga0207674_10004612 3300026116 Bacteria 16545
288 Ga0207674_10005367 3300026116 Bacteria 15246
289 Ga0207674_10145971 3300026116 Bacteria 2324
290 Ga0207675_100017776 3300026118 Bacteria 6633
291 Ga0207683_10180294 3300026121 Bacteria 1915
292 Ga0207698_10001441 3300026142 Bacteria 13822
293 Ga0207698_10025207 3300026142 Bacteria 4185
294 Ga0207698_10028911 3300026142 Bacteria 3961
295 Ga0207698_10040073 3300026142 Bacteria 3476
296 Ga0207698_10056284 3300026142 Bacteria 3036
297 Ga0207698_10201539 3300026142 Bacteria 1782
298 Ga0207698_10813418 3300026142 Bacteria 937
299 Ga0268266_10182109 3300028379 Bacteria 1913
300 Ga0268264_10002856 3300028381 Bacteria 15052
301 Ga0268264_10264380 3300028381 Bacteria 1604
302 Ga0268264_10533908 3300028381 Bacteria 1148
303 Ga0373923_0299781 3300035111 Unclassified 760
304 Ga0373957_0065706 3300035120 Bacteria 1412
305 Ga0373946_0244536 3300035171 Bacteria 873
306 Ga0373955_0130359 3300035172 Bacteria 1467
307 Ga0373961_0043599 3300035241 Bacteria 1305
308 Ga0373931_0008000 3300035691 Bacteria 5003
309 Ga0373937_0195014 3300036401 Bacteria 1903
310 Ga0395899_0000302 3300037312 Bacteria 63367
311 Ga0395899_0004923 3300037312 Bacteria 10387
312 Ga0395899_0006981 3300037312 Bacteria 8749
313 Ga0395899_0042187 3300037312 Bacteria 3406
314 Ga0395899_0062515 3300037312 Bacteria 2742
315 Ga0395899_0076095 3300037312 Bacteria 2450
316 Ga0395899_0098289 3300037312 Bacteria 2115
317 Ga0395899_0299517 3300037312 Bacteria 1088
318 Ga0395899_0303887 3300037312 Unclassified 1079
319 Ga0395900_0004490 3300037418 Bacteria 14773
320 Ga0395900_0012172 3300037418 Bacteria 8795
321 Ga0395900_0014297 3300037418 Bacteria 8102
322 Ga0395900_0016744 3300037418 Bacteria 7479
323 Ga0395900_0031945 3300037418 Bacteria 5411
324 Ga0395900_0045765 3300037418 Bacteria 4507
325 Ga0395900_0082279 3300037418 Bacteria 3307
326 Ga0395900_0109824 3300037418 Bacteria 2833
327 Ga0395900_0129170 3300037418 Bacteria 2590
328 Ga0395900_0192963 3300037418 Bacteria 2065
329 Ga0395900_0208471 3300037418 Bacteria 1974
330 Ga0395900_0234598 3300037418 Unclassified 1843
331 Ga0395900_0395333 3300037418 Bacteria 1348
332 Ga0395900_0538475 3300037418 Bacteria 1114
333 Ga0395900_0684361 3300037418 Bacteria 960
334 Ga0395898_0000054 3300037466 Bacteria 279561
335 Ga0395898_0002701 3300037466 Bacteria 20519
336 Ga0395898_0010003 3300037466 Bacteria 9930
337 Ga0395898_0176111 3300037466 Bacteria 2044
338 Ga0395898_0176623 3300037466 Bacteria 2041
339 Ga0395898_0252662 3300037466 Bacteria 1681
340 Ga0395898_0264659 3300037466 Unclassified 1640
341 Ga0395898_0311781 3300037466 Bacteria 1501
342 Ga0395898_0417195 3300037466 Bacteria 1279
343 Ga0395898_0541028 3300037466 Bacteria 1106
344 Ga0395905_0000046 3300037471 Bacteria 240463
345 Ga0395905_0003223 3300037471 Bacteria 17551
346 Ga0395905_0008041 3300037471 Bacteria 10420
347 Ga0395905_0011911 3300037471 Bacteria 8387
348 Ga0395905_0014089 3300037471 Bacteria 7644
349 Ga0395905_0027561 3300037471 Bacteria 5357
350 Ga0395905_0030456 3300037471 Bacteria 5085
351 Ga0395905_0037798 3300037471 Bacteria 4531
352 Ga0395905_0043892 3300037471 Bacteria 4195
353 Ga0395905_0072172 3300037471 Bacteria 3236
354 Ga0395905_0079251 3300037471 Bacteria 3078
355 Ga0395905_0093281 3300037471 Bacteria 2823
356 Ga0395905_0293218 3300037471 Bacteria 1513
357 Ga0395905_0569958 3300037471 Bacteria 1033
358 Ga0436364_0834683 3300037853 Unclassified 1239
359 Ga0395901_0000375 3300038443 Bacteria 53750
360 Ga0395901_0002307 3300038443 Bacteria 19441
361 Ga0395901_0005438 3300038443 Bacteria 12892
362 Ga0395901_0006240 3300038443 Bacteria 12082
363 Ga0395901_0012705 3300038443 Bacteria 8541
364 Ga0395901_0049375 3300038443 Bacteria 4371
365 Ga0395901_0057638 3300038443 Bacteria 4040
366 Ga0395901_0070253 3300038443 Bacteria 3648
367 Ga0395901_0110468 3300038443 Bacteria 2886
368 Ga0395901_0123870 3300038443 Bacteria 2716
369 Ga0395901_0128414 3300038443 Bacteria 2664
370 Ga0395901_0190719 3300038443 Bacteria 2149
371 Ga0395901_0434505 3300038443 Bacteria 1344
372 Ga0466969_0165663 3300044656 Bacteria 1014
373 Ga0466965_0160049 3300044683 Bacteria 1180
374 Ga0466961_0164936 3300044693 Bacteria 1380
375 Ga0466963_0049141 3300044694 Bacteria 2789
376 Ga0466963_0131298 3300044694 Bacteria 1730
377 Ga0466963_0215962 3300044694 Bacteria 1342
378 Ga0466964_0008952 3300044706 Bacteria 3766
379 Ga0466964_0016475 3300044706 Bacteria 2823
380 Ga0466970_0009442 3300044765 Bacteria 4931
381 Ga0466970_0012120 3300044765 Bacteria 4402
382 Ga0466957_0012152 3300044842 Bacteria 4981
383 Ga0466960_0032729 3300044901 Bacteria 2410
384 Ga0466959_0036243 3300045049 Bacteria 3644
385 Ga0466959_0068370 3300045049 Bacteria 2574
386 Ga0466958_0016344 3300045836 Bacteria 4272
387 Ga0466958_0034867 3300045836 Bacteria 3003
388 Ga0466958_0048167 3300045836 Bacteria 2575
389 Ga0466967_0002087 3300045976 Bacteria 12237
390 Ga0466967_0019275 3300045976 Bacteria 5482
391 Ga0466967_0054900 3300045976 Bacteria 3508
392 Ga0466967_0152179 3300045976 Bacteria 2163
393 Ga0466967_0400436 3300045976 Bacteria 1335
394 Ga0466967_0625400 3300045976 Bacteria 1063
395 Ga0466967_0779542 3300045976 Unclassified 949
396 Ga0495623_0119267 3300046679 Bacteria 1590
397 Ga0496100_0191006 3300048903 Bacteria 1487
398 Ga0496102_0022374 3300048905 Bacteria 5601
399 Ga0496103_0031204 3300048906 Bacteria 3246
400 Ga0496106_0269354 3300048909 Bacteria 1363
401 Ga0496107_0042345 3300048910 Bacteria 3270
402 Ga0496109_0023599 3300048912 Bacteria 5460
403 Ga0496110_0324488 3300048913 Bacteria 1402
404 Ga0496111_0039667 3300048914 Bacteria 3377
405 Ga0496111_0714966 3300048914 Bacteria 728
406 Ga0496112_0000950 3300048915 Bacteria 21045
407 Ga0496112_0056604 3300048915 Bacteria 3859
408 Ga0496112_0278102 3300048915 Bacteria 1622
409 Ga0496113_0000977 3300048916 Bacteria 15240
410 Ga0496113_0114074 3300048916 Bacteria 2106
411 nmdc:mga0k408_267144_c1 3300050493 Unclassified 1021
412 Ga0157370_10458885
413 JGI24752J21851_1009606
414 JGI24740J21852_10000442
415 JGI24740J21852_10003212
416 JGI24739J22299_10000307
417 JGI24737J22298_10000206
418 JGI24737J22298_10000252
419 JGI24738J21930_10000885
420 Ga0070658_10000374
421 Ga0070658_10234221
422 Ga0070676_10007504
423 Ga0070683_100004192
424 Ga0070683_100091962
425 Ga0070690_100194437
426 Ga0070670_100148762
427 Ga0068869_100163275
428 Ga0070666_10046219
429 Ga0070680_100058253
430 Ga0070682_100043402
431 Ga0070682_100280308
432 Ga0068868_100001128
433 Ga0070660_100000209
434 Ga0070660_100068086
435 Ga0070660_100222197
436 Ga0070660_100279560
437 Ga0070660_100476090
438 Ga0070691_10017346
439 Ga0070661_100032636
440 Ga0070661_100085764
441 Ga0070692_10046140
442 Ga0070668_100007947
443 Ga0070669_100001511
444 Ga0070669_100149851
445 Ga0070675_100092185
446 Ga0070675_100171501
447 Ga0070671_100008331
448 Ga0070671_100015829
449 Ga0070674_100196452
450 Ga0070673_100002049
451 Ga0070673_100404988
452 Ga0070673_100407038
453 Ga0070659_100000565
454 Ga0070659_100007554
455 Ga0070659_100028961
456 Ga0070659_100075531
457 Ga0070659_100127386
458 Ga0070659_100317251
459 Ga0070659_100365248
460 Ga0070667_100001792
461 Ga0070667_100151191
462 Ga0070667_100158360
463 Ga0070667_100256718
464 Ga0070714_100028574
465 Ga0070714_100123453
466 Ga0070663_100014574
467 Ga0070663_100035009
468 Ga0070663_100039702
469 Ga0070678_100098004
470 Ga0070662_100000012
471 Ga0070662_100000854
472 Ga0070662_100323892
473 Ga0070681_10127401
474 Ga0068867_100000662
475 Ga0068867_100003278
476 Ga0070679_100119696
477 Ga0070679_100218021
478 Ga0070684_100026091
479 Ga0070684_100082577
480 Ga0070684_100507901
481 Ga0068853_100002629
482 Ga0068853_100045219
483 Ga0068853_100260724
484 Ga0068853_100272406
485 Ga0070672_100000558
486 Ga0070672_100068098
487 Ga0070693_100172350
488 Ga0070665_100026709
489 Ga0070665_100353984
490 Ga0068855_100000591
491 Ga0068855_100024315
492 Ga0068855_100050704
493 Ga0068855_100824487
494 Ga0068855_100824488
495 Ga0070664_100002849
496 Ga0070664_100038934
497 Ga0070664_100055645
498 Ga0070664_100059468
499 Ga0070664_100265622
500 Ga0070664_100723989
501 Ga0068857_100003855
502 Ga0068857_100030612
503 Ga0068857_100215003
504 Ga0068857_100319179
505 Ga0068854_100004086
506 Ga0068854_100006478
507 Ga0068854_100030779
508 Ga0068854_100065629
509 Ga0068854_100106929
510 Ga0068856_100000190
511 Ga0068856_101130020
512 Ga0068852_100000395
513 Ga0068852_100008050
514 Ga0068852_100033583
515 Ga0068852_100038247
516 Ga0068852_100777761
517 Ga0068859_100003615
518 Ga0068859_100040131
519 Ga0068864_100003050
520 Ga0068864_100014893
521 Ga0068864_100092522
522 Ga0068861_100007538
523 Ga0068861_100079615
524 Ga0068851_10009379
525 Ga0068851_10058749
526 Ga0068851_10210792
527 Ga0068863_100007016
528 Ga0068863_100026328
529 Ga0068863_100193014
530 Ga0068858_100011989
531 Ga0068858_100238813
532 Ga0068860_100002873
533 Ga0068860_100080459
534 Ga0068860_100428066
535 Ga0068862_100011149
536 Ga0075366_10399725
537 Ga0097621_100007674
538 Ga0097621_100047899
539 Ga0068871_100086882
540 Ga0068871_100320466
541 Ga0097620_100003615
542 Ga0097620_100040129
543 Ga0075435_100202712
544 Ga0105251_10048416
545 Ga0105240_10131645
546 Ga0105240_10689078
547 Ga0105245_10002121
548 Ga0105243_10088307
549 Ga0105241_10058462
550 Ga0105241_11016169
551 Ga0105248_10000083
552 Ga0105248_10001592
553 Ga0105248_11206301
554 Ga0105237_10027386
555 Ga0105237_10125346
556 Ga0105238_10060953
557 Ga0105238_10150193
558 Ga0105239_10012707
559 Ga0105239_10504831
560 Ga0157373_10014518
561 Ga0157373_10027921
562 Ga0157373_10101879
563 Ga0157373_10448692
564 Ga0157371_10008908
565 Ga0157371_10013378
566 Ga0157371_10051752
567 Ga0157371_10127961
568 Ga0157371_10306408
569 Ga0157370_10005277
570 Ga0157370_10072675
571 Ga0157369_10331056
572 Ga0157369_11018104
573 Ga0157374_10025193
574 Ga0157374_10131121
575 Ga0157374_10279882
576 Ga0157378_10000154
577 Ga0163162_10087181
578 Ga0157372_10042514
579 Ga0157372_10113320
580 Ga0157372_10905372
581 Ga0157375_10577897
582 Ga0163163_10000364
583 Ga0163163_10095748
584 Ga0163163_10209021
585 Ga0157379_10005320
586 Ga0197907_10545280
587 Ga0207697_10000059
588 Ga0207656_10080149
589 Ga0207688_10001805
590 Ga0207688_10051977
591 Ga0207680_10022148
592 Ga0207680_10090791
593 Ga0207647_10001983
594 Ga0207647_10003750
595 Ga0207647_10005744
596 Ga0207647_10034868
597 Ga0207647_10190981
598 Ga0207647_10192723
599 Ga0207645_10008346
600 Ga0207705_10000072
601 Ga0207705_10025156
602 Ga0207705_10062574
603 Ga0207654_10033330
604 Ga0207654_10544103
605 Ga0207707_10114422
606 Ga0207695_10005583
607 Ga0207671_10062809
608 Ga0207671_10383211
609 Ga0207660_10056156
610 Ga0207657_10000496
611 Ga0207657_10007401
612 Ga0207657_10009405
613 Ga0207657_10010147
614 Ga0207657_10036902
615 Ga0207649_10000158
616 Ga0207649_10022700
617 Ga0207649_10069176
618 Ga0207649_10238154
619 Ga0207652_10103256
620 Ga0207681_10004274
621 Ga0207694_10056766
622 Ga0207650_10007030
623 Ga0207650_10035924
624 Ga0207650_10055340
625 Ga0207650_10212949
626 Ga0207650_10533394
627 Ga0207659_10079781
628 Ga0207659_10085399
629 Ga0207687_10000745
630 Ga0207664_10186671
631 Ga0207644_10014155
632 Ga0207690_10001410
633 Ga0207690_10005347
634 Ga0207690_10006807
635 Ga0207690_10009277
636 Ga0207690_10012196
637 Ga0207690_10061001
638 Ga0207690_10439077
639 Ga0207706_10000041
640 Ga0207706_10000426
641 Ga0207706_10009215
642 Ga0207706_10296958
643 Ga0207709_10081304
644 Ga0207669_10150285
645 Ga0207704_10008562
646 Ga0207691_10000563
647 Ga0207691_10036319
648 Ga0207711_10387692
649 Ga0207689_10000128
650 Ga0207661_10002967
651 Ga0207661_10062691
652 Ga0207679_10003505
653 Ga0207679_10009869
654 Ga0207679_10199466
655 Ga0207667_10002008
656 Ga0207667_10012442
657 Ga0207667_10029689
658 Ga0207667_10309687
659 Ga0207651_10009399
660 Ga0207651_10244472
661 Ga0207668_10081042
662 Ga0207640_10000791
663 Ga0207640_10033277
664 Ga0207640_10229117
665 Ga0207658_10006868
666 Ga0207658_10059695
667 Ga0207658_10162842
668 Ga0207658_10413477
669 Ga0207658_10459869
670 Ga0207677_10007597
671 Ga0207703_10016065
672 Ga0207703_10087439
673 Ga0207639_10009793
674 Ga0207639_10126298
675 Ga0207639_10135239
676 Ga0207639_10155784
677 Ga0207639_10210548
678 Ga0207678_10004407
679 Ga0207678_10005554
680 Ga0207678_10015630
681 Ga0207678_10029713
682 Ga0207678_10055631
683 Ga0207678_10497668
684 Ga0207702_10003674
685 Ga0207702_10008508
686 Ga0207702_10052679
687 Ga0207702_10233701
688 Ga0207641_10036013
689 Ga0207648_10003077
690 Ga0207648_10006572
691 Ga0207676_10001069
692 Ga0207676_10032734
693 Ga0207676_10051296
694 Ga0207674_10000086
695 Ga0207674_10000531
696 Ga0207674_10001687
697 Ga0207674_10001715
698 Ga0207674_10004612
699 Ga0207674_10005367
700 Ga0207674_10145971
701 Ga0207675_100017776
702 Ga0207683_10180294
703 Ga0207698_10001441
704 Ga0207698_10025207
705 Ga0207698_10028911
706 Ga0207698_10040073
707 Ga0207698_10056284
708 Ga0207698_10201539
709 Ga0207698_10813418
710 Ga0268266_10182109
711 Ga0268264_10002856
712 Ga0268264_10264380
713 Ga0268264_10533908
714 Ga0373923_0299781
715 Ga0373957_0065706
716 Ga0373946_0244536
717 Ga0373955_0130359
718 Ga0373961_0043599
719 Ga0373931_0008000
720 Ga0373937_0195014
721 Ga0395899_0000302
722 Ga0395899_0004923
723 Ga0395899_0006981
724 Ga0395899_0042187
725 Ga0395899_0062515
726 Ga0395899_0076095
727 Ga0395899_0098289
728 Ga0395899_0299517
729 Ga0395899_0303887
730 Ga0395900_0004490
731 Ga0395900_0012172
732 Ga0395900_0014297
733 Ga0395900_0016744
734 Ga0395900_0031945
735 Ga0395900_0045765
736 Ga0395900_0082279
737 Ga0395900_0109824
738 Ga0395900_0129170
739 Ga0395900_0192963
740 Ga0395900_0208471
741 Ga0395900_0234598
742 Ga0395900_0395333
743 Ga0395900_0538475
744 Ga0395900_0684361
745 Ga0395898_0000054
746 Ga0395898_0002701
747 Ga0395898_0010003
748 Ga0395898_0176111
749 Ga0395898_0176623
750 Ga0395898_0252662
751 Ga0395898_0264659
752 Ga0395898_0311781
753 Ga0395898_0417195
754 Ga0395898_0541028
755 Ga0395905_0000046
756 Ga0395905_0003223
757 Ga0395905_0008041
758 Ga0395905_0011911
759 Ga0395905_0014089
760 Ga0395905_0027561
761 Ga0395905_0030456
762 Ga0395905_0037798
763 Ga0395905_0043892
764 Ga0395905_0072172
765 Ga0395905_0079251
766 Ga0395905_0093281
767 Ga0395905_0293218
768 Ga0395905_0569958
769 Ga0436364_0834683
770 Ga0395901_0000375
771 Ga0395901_0002307
772 Ga0395901_0005438
773 Ga0395901_0006240
774 Ga0395901_0012705
775 Ga0395901_0049375
776 Ga0395901_0057638
777 Ga0395901_0070253
778 Ga0395901_0110468
779 Ga0395901_0123870
780 Ga0395901_0128414
781 Ga0395901_0190719
782 Ga0395901_0434505
783 Ga0466969_0165663
784 Ga0466965_0160049
785 Ga0466961_0164936
786 Ga0466963_0049141
787 Ga0466963_0131298
788 Ga0466963_0215962
789 Ga0466964_0008952
790 Ga0466964_0016475
791 Ga0466970_0009442
792 Ga0466970_0012120
793 Ga0466957_0012152
794 Ga0466960_0032729
795 Ga0466959_0036243
796 Ga0466959_0068370
797 Ga0466958_0016344
798 Ga0466958_0034867
799 Ga0466958_0048167
800 Ga0466967_0002087
801 Ga0466967_0019275
802 Ga0466967_0054900
803 Ga0466967_0152179
804 Ga0466967_0400436
805 Ga0466967_0625400
806 Ga0466967_0779542
807 Ga0495623_0119267
808 Ga0496100_0191006
809 Ga0496102_0022374
810 Ga0496103_0031204
811 Ga0496106_0269354
812 Ga0496107_0042345
813 Ga0496109_0023599
814 Ga0496110_0324488
815 Ga0496111_0039667
816 Ga0496111_0714966
817 Ga0496112_0000950
818 Ga0496112_0056604
819 Ga0496112_0278102
820 Ga0496113_0000977
821 Ga0496113_0114074
822 nmdc:mga0k408_267144_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.8767 112 175
4u0z-assembly7.cif.gz_D eukaryotic fic domain containing protein with bound apcpp 0.8494 108 181
5jj6-assembly3.cif.gz_B fic-1 (aa134 - 508) from c. elegans 0.8487 126 183
4u04-assembly1.cif.gz_B structure of a eukaryotic fic domain containing protein 0.8483 108 182
5jj7-assembly1.cif.gz_B fic-1 (aa134 - 508 e274g) from c. elegans 0.8405 128 183
ID Description Score Start End Superfamily
af_O06917_4_76_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9093 109 171 1.25.40.10
af_Q86TZ1_263_346_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9071 93 173 1.25.40.10
af_O15050_4_90_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.893 109 175 1.25.40.10
af_A4I5Y0_716_784_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8865 116 174 1.25.40.10
4gywC01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8856 96 174 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2W5I2R0-F1-model_v4 deleted 0.9264 91 175
AF-A0A3M0YE04-F1-model_v4 Tetratricopeptide repeat protein 0.904 86 174
AF-A0A257JAC0-F1-model_v4 Uncharacterized protein 0.8916 88 173
AF-A0A254QD01-F1-model_v4 Uncharacterized protein 0.871 90 177
AF-A0A2W5I2R0-F1-model_v4 deleted 0.8692 91 175

Map