F437514

General Info

Members Datasets Scaffolds Average Seq Length
411 175 822 165

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10021326|Ga0157374_100213261
Length 157
Sequence MSRSTELEEIAGRMESSQEKSGIPGIQFVDHVAIAVRPGELDGQVKAYEMLGFREVHREEVLGADQVREVLLQVGNGSNLIQMIAKNGGYGGLAHVAFRVEDARAAFDSMQSKGFKIIDDAPRRGSRGTTVFFVHPKSKEESPFGVLIEIVEDPAGK

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
120 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
121 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
126 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.92
Rhizosphere 96.35
Stem 0
Stem Tuber 0
Unclassified 14.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10021326 3300013296 Bacteria 5763
2 rootH2_10206639 3300003320 Unclassified 1581
3 rootH1_10272665 3300003323 Bacteria 1263
4 rootH1_10313564 3300003323 Bacteria 2867
5 Ga0070658_10125706 3300005327 Unclassified 2134
6 Ga0070658_10183065 3300005327 Bacteria 1763
7 Ga0070676_10003609 3300005328 Bacteria 8087
8 Ga0070683_100000194 3300005329 Bacteria 40623
9 Ga0070683_100027000 3300005329 Bacteria 5175
10 Ga0070683_100240942 3300005329 Unclassified 1720
11 Ga0070683_101032355 3300005329 Bacteria 789
12 Ga0070670_100031726 3300005331 Bacteria 4551
13 Ga0070670_100059485 3300005331 Bacteria 3280
14 Ga0068869_100000920 3300005334 Bacteria 16956
15 Ga0068869_100057056 3300005334 Bacteria 2849
16 Ga0068869_101247451 3300005334 Unclassified 654
17 Ga0070666_10010513 3300005335 Bacteria 5790
18 Ga0070666_10155989 3300005335 Bacteria 1594
19 Ga0070682_100347669 3300005337 Bacteria 1104
20 Ga0068868_100000046 3300005338 Bacteria 68441
21 Ga0068868_100006738 3300005338 Bacteria 8156
22 Ga0068868_100398461 3300005338 Bacteria 1187
23 Ga0070660_100008026 3300005339 Bacteria 7378
24 Ga0070661_100159829 3300005344 Bacteria 1706
25 Ga0070668_100013958 3300005347 Bacteria 6006
26 Ga0070675_100175264 3300005354 Bacteria 1851
27 Ga0070671_100017976 3300005355 Bacteria 5736
28 Ga0070671_100085060 3300005355 Bacteria 2645
29 Ga0070667_100001013 3300005367 Bacteria 25735
30 Ga0070714_100016444 3300005435 Bacteria 5974
31 Ga0070713_100768962 3300005436 Bacteria 922
32 Ga0070710_10346300 3300005437 Unclassified 982
33 Ga0070663_100040147 3300005455 Bacteria 3275
34 Ga0070678_100007442 3300005456 Bacteria 6497
35 Ga0070662_100006039 3300005457 Bacteria 7773
36 Ga0070681_10080629 3300005458 Bacteria 3210
37 Ga0068867_100034655 3300005459 Bacteria 3660
38 Ga0070679_100031434 3300005530 Bacteria 5244
39 Ga0070684_100000439 3300005535 Bacteria 28569
40 Ga0070684_100003404 3300005535 Bacteria 11935
41 Ga0070684_100054954 3300005535 Bacteria 3469
42 Ga0070684_101495902 3300005535 Unclassified 636
43 Ga0068853_100001986 3300005539 Bacteria 15095
44 Ga0068853_100047670 3300005539 Bacteria 3677
45 Ga0068853_100094947 3300005539 Bacteria 2629
46 Ga0070672_100008565 3300005543 Bacteria 7005
47 Ga0070665_100020098 3300005548 Bacteria 6704
48 Ga0070665_100146066 3300005548 Bacteria 2368
49 Ga0068855_100000368 3300005563 Bacteria 55842
50 Ga0068855_100005772 3300005563 Bacteria 15107
51 Ga0068855_100010445 3300005563 Bacteria 11200
52 Ga0068855_100018364 3300005563 Bacteria 8401
53 Ga0068855_100118563 3300005563 Bacteria 3031
54 Ga0068855_100462414 3300005563 Unclassified 1383
55 Ga0068855_101418395 3300005563 Unclassified 715
56 Ga0070664_100037352 3300005564 Bacteria 4084
57 Ga0070664_100141605 3300005564 Unclassified 2118
58 Ga0070664_100181489 3300005564 Bacteria 1871
59 Ga0070664_100736977 3300005564 Bacteria 919
60 Ga0068857_100000726 3300005577 Bacteria 24578
61 Ga0068857_100001198 3300005577 Bacteria 20233
62 Ga0068857_100345799 3300005577 Unclassified 1376
63 Ga0068854_100024801 3300005578 Bacteria 4110
64 Ga0068856_100000660 3300005614 Bacteria 37333
65 Ga0068856_100015139 3300005614 Bacteria 7451
66 Ga0068856_100016835 3300005614 Bacteria 7084
67 Ga0068856_100029926 3300005614 Bacteria 5322
68 Ga0068856_100030425 3300005614 Bacteria 5277
69 Ga0068856_101044998 3300005614 Bacteria 835
70 Ga0068852_100000063 3300005616 Bacteria 72990
71 Ga0068852_100002099 3300005616 Bacteria 13629
72 Ga0068852_100012788 3300005616 Bacteria 6394
73 Ga0068852_100047072 3300005616 Bacteria 3677
74 Ga0068852_100124225 3300005616 Bacteria 2367
75 Ga0068852_100177568 3300005616 Unclassified 2000
76 Ga0068852_100300077 3300005616 Bacteria 1555
77 Ga0068859_100016742 3300005617 Bacteria 7360
78 Ga0068859_101089807 3300005617 Bacteria 878
79 Ga0068864_100000782 3300005618 Bacteria 26736
80 Ga0068864_100019281 3300005618 Bacteria 5702
81 Ga0068866_10118095 3300005718 Bacteria 1490
82 Ga0068861_100793047 3300005719 Bacteria 888
83 Ga0068851_10007438 3300005834 Bacteria 5029
84 Ga0068851_10089842 3300005834 Bacteria 1616
85 Ga0068851_10096271 3300005834 Bacteria 1565
86 Ga0068863_100000689 3300005841 Bacteria 33976
87 Ga0068863_100078142 3300005841 Bacteria 3134
88 Ga0068858_100000792 3300005842 Bacteria 33008
89 Ga0068858_100130580 3300005842 Bacteria 2355
90 Ga0068860_100000486 3300005843 Bacteria 48996
91 Ga0068860_100150451 3300005843 Bacteria 2241
92 Ga0068860_100437720 3300005843 Bacteria 1298
93 Ga0068862_100606837 3300005844 Bacteria 1051
94 Ga0070717_10297959 3300006028 Bacteria 1433
95 Ga0097621_100000219 3300006237 Bacteria 38067
96 Ga0097621_100010433 3300006237 Bacteria 6802
97 Ga0097621_100019090 3300006237 Bacteria 5257
98 Ga0068871_100000318 3300006358 Bacteria 33510
99 Ga0068871_100010413 3300006358 Bacteria 6785
100 Ga0068871_100021277 3300006358 Bacteria 4983
101 Ga0068871_100621016 3300006358 Unclassified 984
102 Ga0068865_100003353 3300006881 Bacteria 9595
103 Ga0097620_100016741 3300006931 Bacteria 7360
104 Ga0097620_101089963 3300006931 Bacteria 878
105 Ga0105240_10000187 3300009093 Bacteria 126042
106 Ga0105240_10000663 3300009093 Bacteria 63262
107 Ga0105240_10003591 3300009093 Bacteria 24042
108 Ga0105240_10068951 3300009093 Bacteria 4379
109 Ga0105240_10097214 3300009093 Bacteria 3588
110 Ga0105240_10346389 3300009093 Bacteria 1686
111 Ga0105245_10002037 3300009098 Bacteria 18333
112 Ga0105245_10003511 3300009098 Bacteria 14025
113 Ga0105245_10008128 3300009098 Bacteria 9173
114 Ga0105245_10737359 3300009098 Unclassified 1020
115 Ga0105247_10010337 3300009101 Bacteria 5643
116 Ga0105243_10121738 3300009148 Bacteria 2201
117 Ga0105241_10000190 3300009174 Bacteria 46161
118 Ga0105241_10000698 3300009174 Bacteria 25353
119 Ga0105241_10001082 3300009174 Bacteria 20762
120 Ga0105241_10010000 3300009174 Bacteria 6968
121 Ga0105241_10043247 3300009174 Bacteria 3411
122 Ga0105241_10064219 3300009174 Bacteria 2834
123 Ga0105241_10304335 3300009174 Bacteria 1369
124 Ga0105248_10001220 3300009177 Bacteria 28689
125 Ga0105248_10010565 3300009177 Bacteria 10172
126 Ga0105248_10160084 3300009177 Bacteria 2540
127 Ga0105248_10252395 3300009177 Unclassified 1985
128 Ga0105248_10354846 3300009177 Bacteria 1651
129 Ga0105237_10005272 3300009545 Bacteria 14624
130 Ga0105237_10008269 3300009545 Bacteria 11299
131 Ga0105237_10070212 3300009545 Unclassified 3498
132 Ga0105237_10094827 3300009545 Bacteria 2973
133 Ga0105237_10226605 3300009545 Bacteria 1869
134 Ga0105237_10227172 3300009545 Unclassified 1867
135 Ga0105238_10000445 3300009551 Bacteria 43401
136 Ga0105238_10000473 3300009551 Bacteria 42097
137 Ga0105238_10001995 3300009551 Bacteria 20562
138 Ga0105238_10006225 3300009551 Bacteria 11855
139 Ga0105238_10296784 3300009551 Unclassified 1599
140 Ga0105238_11004819 3300009551 Bacteria 855
141 Ga0105239_10005087 3300010375 Bacteria 15522
142 Ga0105239_10015391 3300010375 Bacteria 8475
143 Ga0105239_10148830 3300010375 Bacteria 2612
144 Ga0105239_10809649 3300010375 Bacteria 1073
145 Ga0105246_10002011 3300011119 Bacteria 12282
146 Ga0105246_10622749 3300011119 Bacteria 935
147 Ga0157373_10033145 3300013100 Bacteria 3718
148 Ga0157373_10413396 3300013100 Bacteria 968
149 Ga0157373_10425658 3300013100 Bacteria 953
150 Ga0157370_10000066 3300013104 Bacteria 113884
151 Ga0157370_11318605 3300013104 Unclassified 650
152 Ga0157369_10000792 3300013105 Bacteria 40499
153 Ga0157369_10005595 3300013105 Bacteria 14590
154 Ga0157369_10005937 3300013105 Bacteria 14179
155 Ga0157369_10013634 3300013105 Bacteria 9194
156 Ga0157369_10019095 3300013105 Bacteria 7673
157 Ga0157369_10055069 3300013105 Bacteria 4294
158 Ga0157369_10107896 3300013105 Bacteria 2962
159 Ga0157369_10111058 3300013105 Bacteria 2914
160 Ga0157369_10190031 3300013105 Bacteria 2158
161 Ga0157374_10006030 3300013296 Bacteria 10258
162 Ga0157374_10011303 3300013296 Bacteria 7721
163 Ga0157374_10024539 3300013296 Bacteria 5407
164 Ga0157374_10414073 3300013296 Bacteria 1346
165 Ga0157378_10007344 3300013297 Bacteria 9627
166 Ga0157378_10010964 3300013297 Bacteria 7929
167 Ga0157378_10059812 3300013297 Bacteria 3400
168 Ga0157378_10067862 3300013297 Bacteria 3197
169 Ga0157378_10184905 3300013297 Unclassified 1962
170 Ga0163162_10025806 3300013306 Bacteria 5808
171 Ga0163162_10253722 3300013306 Bacteria 1891
172 Ga0163162_11281931 3300013306 Bacteria 832
173 Ga0157372_10000114 3300013307 Bacteria 85156
174 Ga0157372_10002824 3300013307 Bacteria 18764
175 Ga0157372_10006804 3300013307 Bacteria 12157
176 Ga0157372_10015560 3300013307 Bacteria 8153
177 Ga0157372_10051559 3300013307 Bacteria 4580
178 Ga0157372_10053974 3300013307 Bacteria 4481
179 Ga0157372_10245159 3300013307 Bacteria 2079
180 Ga0157372_10319608 3300013307 Unclassified 1807
181 Ga0157375_10008565 3300013308 Bacteria 8958
182 Ga0157375_10024346 3300013308 Bacteria 5601
183 Ga0157375_11171137 3300013308 Bacteria 901
184 Ga0163163_10000351 3300014325 Bacteria 44325
185 Ga0157377_10234279 3300014745 Bacteria 1182
186 Ga0157379_10000479 3300014968 Bacteria 32411
187 Ga0157379_10012771 3300014968 Bacteria 7345
188 Ga0157379_10711128 3300014968 Unclassified 943
189 Ga0157376_10000204 3300014969 Bacteria 40935
190 Ga0157376_10015789 3300014969 Bacteria 5714
191 Ga0157376_10142910 3300014969 Bacteria 2149
192 Ga0207697_10028885 3300025315 Bacteria 2269
193 Ga0207656_10068657 3300025321 Bacteria 1571
194 Ga0207642_10093678 3300025899 Bacteria 1490
195 Ga0207710_10002186 3300025900 Bacteria 9187
196 Ga0207680_10015721 3300025903 Bacteria 3957
197 Ga0207680_10160528 3300025903 Bacteria 1507
198 Ga0207647_10019034 3300025904 Bacteria 4625
199 Ga0207645_10005768 3300025907 Bacteria 8928
200 Ga0207705_10241775 3300025909 Unclassified 1375
201 Ga0207654_10000158 3300025911 Bacteria 43419
202 Ga0207654_10000582 3300025911 Bacteria 20666
203 Ga0207654_10000636 3300025911 Bacteria 19832
204 Ga0207654_10053768 3300025911 Unclassified 2326
205 Ga0207654_10068921 3300025911 Bacteria 2094
206 Ga0207654_10151225 3300025911 Bacteria 1490
207 Ga0207707_10132034 3300025912 Bacteria 2184
208 Ga0207695_10000052 3300025913 Bacteria 398089
209 Ga0207695_10000108 3300025913 Bacteria 252306
210 Ga0207695_10000253 3300025913 Bacteria 139044
211 Ga0207695_10007791 3300025913 Bacteria 13563
212 Ga0207695_10022822 3300025913 Bacteria 7090
213 Ga0207695_11056470 3300025913 Unclassified 692
214 Ga0207671_10000081 3300025914 Bacteria 148476
215 Ga0207671_10000611 3300025914 Bacteria 47143
216 Ga0207671_10032458 3300025914 Bacteria 3887
217 Ga0207671_10059860 3300025914 Bacteria 2825
218 Ga0207671_10066144 3300025914 Bacteria 2690
219 Ga0207671_10170974 3300025914 Unclassified 1687
220 Ga0207671_10583238 3300025914 Unclassified 891
221 Ga0207657_10007493 3300025919 Bacteria 11185
222 Ga0207649_10007506 3300025920 Bacteria 5929
223 Ga0207652_10164457 3300025921 Unclassified 1989
224 Ga0207694_10000108 3300025924 Bacteria 87457
225 Ga0207694_10000264 3300025924 Bacteria 49940
226 Ga0207694_10001583 3300025924 Bacteria 19282
227 Ga0207694_10095183 3300025924 Bacteria 2354
228 Ga0207694_10496961 3300025924 Bacteria 1021
229 Ga0207650_10021344 3300025925 Bacteria 4576
230 Ga0207650_10080163 3300025925 Bacteria 2474
231 Ga0207659_10245204 3300025926 Bacteria 1451
232 Ga0207687_10000440 3300025927 Bacteria 28259
233 Ga0207687_10005704 3300025927 Bacteria 8234
234 Ga0207687_10129288 3300025927 Bacteria 1901
235 Ga0207687_10318649 3300025927 Bacteria 1258
236 Ga0207700_10032492 3300025928 Unclassified 3723
237 Ga0207700_11177598 3300025928 Unclassified 684
238 Ga0207644_10022928 3300025931 Bacteria 4270
239 Ga0207644_10033751 3300025931 Bacteria 3579
240 Ga0207644_10065141 3300025931 Bacteria 2649
241 Ga0207644_10793709 3300025931 Bacteria 792
242 Ga0207706_10005478 3300025933 Bacteria 11833
243 Ga0207686_10104656 3300025934 Bacteria 1896
244 Ga0207704_10040567 3300025938 Bacteria 2722
245 Ga0207691_10001227 3300025940 Bacteria 25547
246 Ga0207711_10005422 3300025941 Bacteria 10787
247 Ga0207711_10039580 3300025941 Bacteria 4010
248 Ga0207711_10104772 3300025941 Bacteria 2507
249 Ga0207711_10243038 3300025941 Bacteria 1651
250 Ga0207711_10396551 3300025941 Unclassified 1282
251 Ga0207689_10001260 3300025942 Bacteria 24401
252 Ga0207689_10015778 3300025942 Bacteria 6395
253 Ga0207661_10000467 3300025944 Bacteria 26132
254 Ga0207661_10052150 3300025944 Bacteria 3267
255 Ga0207661_10193495 3300025944 Bacteria 1784
256 Ga0207661_10449096 3300025944 Unclassified 1174
257 Ga0207679_10124103 3300025945 Bacteria 2061
258 Ga0207667_10004868 3300025949 Bacteria 16399
259 Ga0207667_10006221 3300025949 Bacteria 14485
260 Ga0207667_10015226 3300025949 Bacteria 8745
261 Ga0207667_10021857 3300025949 Bacteria 7081
262 Ga0207667_10090891 3300025949 Bacteria 3155
263 Ga0207667_11880124 3300025949 Unclassified 561
264 Ga0207640_10022146 3300025981 Bacteria 3798
265 Ga0207658_10000569 3300025986 Bacteria 33424
266 Ga0207677_10000025 3300026023 Bacteria 127400
267 Ga0207677_10007369 3300026023 Bacteria 6081
268 Ga0207677_10058768 3300026023 Bacteria 2650
269 Ga0207677_10505218 3300026023 Bacteria 1046
270 Ga0207703_10000963 3300026035 Bacteria 27829
271 Ga0207703_10063131 3300026035 Bacteria 3036
272 Ga0207639_10000417 3300026041 Bacteria 29519
273 Ga0207639_10039233 3300026041 Bacteria 3527
274 Ga0207639_10154798 3300026041 Unclassified 1924
275 Ga0207639_11061504 3300026041 Unclassified 759
276 Ga0207678_10037503 3300026067 Bacteria 4215
277 Ga0207702_10002081 3300026078 Bacteria 19334
278 Ga0207702_10003410 3300026078 Bacteria 14543
279 Ga0207702_10008827 3300026078 Bacteria 8498
280 Ga0207702_10031243 3300026078 Bacteria 4438
281 Ga0207702_10045709 3300026078 Bacteria 3683
282 Ga0207702_10137778 3300026078 Bacteria 2204
283 Ga0207702_10260565 3300026078 Bacteria 1632
284 Ga0207702_10983155 3300026078 Bacteria 837
285 Ga0207641_10001020 3300026088 Bacteria 28415
286 Ga0207648_10109284 3300026089 Bacteria 2427
287 Ga0207676_10000514 3300026095 Bacteria 32542
288 Ga0207676_10129916 3300026095 Bacteria 2140
289 Ga0207674_10000459 3300026116 Bacteria 53315
290 Ga0207674_10001149 3300026116 Bacteria 34310
291 Ga0207674_10190771 3300026116 Unclassified 1999
292 Ga0207674_10492467 3300026116 Bacteria 1185
293 Ga0207675_100130981 3300026118 Bacteria 2378
294 Ga0207683_10000432 3300026121 Bacteria 38828
295 Ga0207698_10000007 3300026142 Bacteria 289457
296 Ga0207698_10000137 3300026142 Bacteria 46167
297 Ga0207698_10043275 3300026142 Bacteria 3372
298 Ga0207698_10082973 3300026142 Bacteria 2592
299 Ga0207698_10111396 3300026142 Unclassified 2294
300 Ga0207698_10819087 3300026142 Unclassified 934
301 Ga0268266_10098857 3300028379 Bacteria 2568
302 Ga0268265_10598388 3300028380 Bacteria 1053
303 Ga0268264_10000671 3300028381 Bacteria 40092
304 Ga0268264_10220320 3300028381 Bacteria 1746
305 Ga0265319_1149956 3300028563 Unclassified 722
306 Ga0265318_10027977 3300028577 Bacteria 2210
307 Ga0265336_10007957 3300028666 Bacteria 3743
308 Ga0265338_10002772 3300028800 Bacteria 25646
309 Ga0265338_10029255 3300028800 Bacteria 5464
310 Ga0265338_10111284 3300028800 Unclassified 2205
311 Ga0265338_11006090 3300028800 Unclassified 564
312 Ga0265770_1140436 3300030878 Unclassified 523
313 Ga0265760_10020881 3300031090 Bacteria 1892
314 Ga0265330_10000245 3300031235 Bacteria 40990
315 Ga0265330_10000613 3300031235 Bacteria 23004
316 Ga0265330_10008388 3300031235 Bacteria 4976
317 Ga0265330_10108226 3300031235 Bacteria 1188
318 Ga0265330_10144318 3300031235 Bacteria 1012
319 Ga0265328_10054875 3300031239 Bacteria 1462
320 Ga0265325_10000517 3300031241 Bacteria 27967
321 Ga0265325_10003736 3300031241 Bacteria 9831
322 Ga0265325_10008429 3300031241 Bacteria 6084
323 Ga0265325_10073028 3300031241 Bacteria 1718
324 Ga0265325_10083165 3300031241 Bacteria 1588
325 Ga0265329_10022921 3300031242 Bacteria 2084
326 Ga0265340_10003696 3300031247 Bacteria 8614
327 Ga0265340_10010882 3300031247 Bacteria 4854
328 Ga0265340_10040594 3300031247 Bacteria 2292
329 Ga0265339_10028445 3300031249 Bacteria 3178
330 Ga0265339_10052696 3300031249 Bacteria 2215
331 Ga0265339_10113260 3300031249 Bacteria 1401
332 Ga0265339_10193381 3300031249 Unclassified 1007
333 Ga0265316_10000775 3300031344 Bacteria 35281
334 Ga0265316_10002414 3300031344 Bacteria 19436
335 Ga0265316_10008054 3300031344 Bacteria 9832
336 Ga0265316_10021973 3300031344 Bacteria 5391
337 Ga0265316_10048322 3300031344 Bacteria 3360
338 Ga0265316_10195371 3300031344 Bacteria 1502
339 Ga0265316_10218634 3300031344 Unclassified 1407
340 Ga0265313_10002682 3300031595 Bacteria 15080
341 Ga0265313_10005989 3300031595 Bacteria 8786
342 Ga0265313_10064062 3300031595 Unclassified 1711
343 Ga0265313_10150195 3300031595 Bacteria 996
344 Ga0265314_10000552 3300031711 Bacteria 47809
345 Ga0265314_10002382 3300031711 Bacteria 19341
346 Ga0265314_10010271 3300031711 Bacteria 7826
347 Ga0265314_10016736 3300031711 Bacteria 5778
348 Ga0265314_10381988 3300031711 Unclassified 766
349 Ga0265342_10000928 3300031712 Bacteria 29122
350 Ga0265342_10006604 3300031712 Bacteria 8620
351 Ga0265342_10008675 3300031712 Bacteria 7256
352 Ga0265342_10022461 3300031712 Bacteria 4010
353 Ga0265342_10043923 3300031712 Bacteria 2695
354 Ga0265342_10068670 3300031712 Unclassified 2071
355 Ga0265342_10238876 3300031712 Unclassified 973
356 Ga0373953_0146708 3300035117 Unclassified 1010
357 Ga0373955_0076231 3300035172 Bacteria 1886
358 Ga0373933_0071382 3300035724 Bacteria 2114
359 Ga0373937_0004211 3300036401 Bacteria 12203
360 Ga0373937_0526738 3300036401 Bacteria 1123
361 Ga0373937_0773949 3300036401 Bacteria 907
362 Ga0466963_0035872 3300044694 Bacteria 3231
363 Ga0453684_0787992 3300044712 Unclassified 1026
364 Ga0466967_0000205 3300045976 Bacteria 24844
365 Ga0466967_0127501 3300045976 Bacteria 2359
366 Ga0495629_0031497 3300046459 Bacteria 3755
367 Ga0495651_0382831 3300046462 Unclassified 922
368 Ga0495651_0862477 3300046462 Unclassified 556
369 Ga0495653_0208929 3300046463 Unclassified 1320
370 Ga0495580_0071448 3300046472 Bacteria 2425
371 Ga0495580_0340494 3300046472 Bacteria 1017
372 Ga0495662_0235864 3300046476 Unclassified 902
373 Ga0495664_0111402 3300046477 Bacteria 1652
374 Ga0495652_0314758 3300046529 Bacteria 1133
375 Ga0495665_0111909 3300046531 Bacteria 1432
376 Ga0495586_0645906 3300046535 Bacteria 611
377 Ga0495587_0055048 3300046536 Bacteria 2344
378 Ga0495587_0234281 3300046536 Bacteria 1034
379 Ga0495645_0003858 3300046543 Bacteria 10203
380 Ga0495645_0051237 3300046543 Bacteria 3004
381 Ga0495635_0299803 3300046663 Unclassified 1078
382 Ga0495599_0059961 3300046678 Bacteria 2380
383 Ga0495623_0069644 3300046679 Bacteria 2192
384 Ga0495623_0184682 3300046679 Bacteria 1209
385 Ga0495669_0174800 3300046684 Bacteria 1022
386 Ga0495613_0044207 3300046689 Bacteria 3296
387 Ga0495600_0158121 3300046809 Bacteria 1466
388 Ga0495581_0056233 3300047315 Bacteria 2271
389 Ga0495581_0057074 3300047315 Bacteria 2254
390 Ga0495581_0533762 3300047315 Unclassified 681
391 Ga0495675_0045372 3300047444 Bacteria 2799
392 Ga0495675_0233810 3300047444 Bacteria 1108
393 Ga0495679_154248 3300047446 Unclassified 616
394 Ga0496100_0382653 3300048903 Bacteria 1069
395 Ga0496101_0091180 3300048904 Bacteria 2268
396 Ga0496102_0261444 3300048905 Bacteria 1632
397 Ga0496104_0360201 3300048907 Bacteria 1367
398 Ga0496105_0312697 3300048908 Bacteria 1261
399 Ga0496106_0098002 3300048909 Bacteria 2271
400 Ga0496109_1363279 3300048912 Unclassified 645
401 Ga0496112_0382315 3300048915 Bacteria 1349
402 Ga0496114_0426545 3300048917 Bacteria 1175
403 Ga0496115_0021202 3300048918 Bacteria 5017
404 Ga0496115_0237433 3300048918 Unclassified 1503
405 Ga0496115_0835022 3300048918 Unclassified 715
406 nmdc:mga0n895_6263_c1 3300050512 Bacteria 10083
407 nmdc:mga0a205_62491_c1 3300050515 Bacteria 3598
408 Ga0495601_0131068 3300053077 Bacteria 1633
409 Ga0495601_0162079 3300053077 Bacteria 1462
410 Ga0495619_0507871 3300053085 Unclassified 829
411 Ga0495619_0726103 3300053085 Unclassified 675
412 Ga0157374_10021326
413 rootH2_10206639
414 rootH1_10272665
415 rootH1_10313564
416 Ga0070658_10125706
417 Ga0070658_10183065
418 Ga0070676_10003609
419 Ga0070683_100000194
420 Ga0070683_100027000
421 Ga0070683_100240942
422 Ga0070683_101032355
423 Ga0070670_100031726
424 Ga0070670_100059485
425 Ga0068869_100000920
426 Ga0068869_100057056
427 Ga0068869_101247451
428 Ga0070666_10010513
429 Ga0070666_10155989
430 Ga0070682_100347669
431 Ga0068868_100000046
432 Ga0068868_100006738
433 Ga0068868_100398461
434 Ga0070660_100008026
435 Ga0070661_100159829
436 Ga0070668_100013958
437 Ga0070675_100175264
438 Ga0070671_100017976
439 Ga0070671_100085060
440 Ga0070667_100001013
441 Ga0070714_100016444
442 Ga0070713_100768962
443 Ga0070710_10346300
444 Ga0070663_100040147
445 Ga0070678_100007442
446 Ga0070662_100006039
447 Ga0070681_10080629
448 Ga0068867_100034655
449 Ga0070679_100031434
450 Ga0070684_100000439
451 Ga0070684_100003404
452 Ga0070684_100054954
453 Ga0070684_101495902
454 Ga0068853_100001986
455 Ga0068853_100047670
456 Ga0068853_100094947
457 Ga0070672_100008565
458 Ga0070665_100020098
459 Ga0070665_100146066
460 Ga0068855_100000368
461 Ga0068855_100005772
462 Ga0068855_100010445
463 Ga0068855_100018364
464 Ga0068855_100118563
465 Ga0068855_100462414
466 Ga0068855_101418395
467 Ga0070664_100037352
468 Ga0070664_100141605
469 Ga0070664_100181489
470 Ga0070664_100736977
471 Ga0068857_100000726
472 Ga0068857_100001198
473 Ga0068857_100345799
474 Ga0068854_100024801
475 Ga0068856_100000660
476 Ga0068856_100015139
477 Ga0068856_100016835
478 Ga0068856_100029926
479 Ga0068856_100030425
480 Ga0068856_101044998
481 Ga0068852_100000063
482 Ga0068852_100002099
483 Ga0068852_100012788
484 Ga0068852_100047072
485 Ga0068852_100124225
486 Ga0068852_100177568
487 Ga0068852_100300077
488 Ga0068859_100016742
489 Ga0068859_101089807
490 Ga0068864_100000782
491 Ga0068864_100019281
492 Ga0068866_10118095
493 Ga0068861_100793047
494 Ga0068851_10007438
495 Ga0068851_10089842
496 Ga0068851_10096271
497 Ga0068863_100000689
498 Ga0068863_100078142
499 Ga0068858_100000792
500 Ga0068858_100130580
501 Ga0068860_100000486
502 Ga0068860_100150451
503 Ga0068860_100437720
504 Ga0068862_100606837
505 Ga0070717_10297959
506 Ga0097621_100000219
507 Ga0097621_100010433
508 Ga0097621_100019090
509 Ga0068871_100000318
510 Ga0068871_100010413
511 Ga0068871_100021277
512 Ga0068871_100621016
513 Ga0068865_100003353
514 Ga0097620_100016741
515 Ga0097620_101089963
516 Ga0105240_10000187
517 Ga0105240_10000663
518 Ga0105240_10003591
519 Ga0105240_10068951
520 Ga0105240_10097214
521 Ga0105240_10346389
522 Ga0105245_10002037
523 Ga0105245_10003511
524 Ga0105245_10008128
525 Ga0105245_10737359
526 Ga0105247_10010337
527 Ga0105243_10121738
528 Ga0105241_10000190
529 Ga0105241_10000698
530 Ga0105241_10001082
531 Ga0105241_10010000
532 Ga0105241_10043247
533 Ga0105241_10064219
534 Ga0105241_10304335
535 Ga0105248_10001220
536 Ga0105248_10010565
537 Ga0105248_10160084
538 Ga0105248_10252395
539 Ga0105248_10354846
540 Ga0105237_10005272
541 Ga0105237_10008269
542 Ga0105237_10070212
543 Ga0105237_10094827
544 Ga0105237_10226605
545 Ga0105237_10227172
546 Ga0105238_10000445
547 Ga0105238_10000473
548 Ga0105238_10001995
549 Ga0105238_10006225
550 Ga0105238_10296784
551 Ga0105238_11004819
552 Ga0105239_10005087
553 Ga0105239_10015391
554 Ga0105239_10148830
555 Ga0105239_10809649
556 Ga0105246_10002011
557 Ga0105246_10622749
558 Ga0157373_10033145
559 Ga0157373_10413396
560 Ga0157373_10425658
561 Ga0157370_10000066
562 Ga0157370_11318605
563 Ga0157369_10000792
564 Ga0157369_10005595
565 Ga0157369_10005937
566 Ga0157369_10013634
567 Ga0157369_10019095
568 Ga0157369_10055069
569 Ga0157369_10107896
570 Ga0157369_10111058
571 Ga0157369_10190031
572 Ga0157374_10006030
573 Ga0157374_10011303
574 Ga0157374_10024539
575 Ga0157374_10414073
576 Ga0157378_10007344
577 Ga0157378_10010964
578 Ga0157378_10059812
579 Ga0157378_10067862
580 Ga0157378_10184905
581 Ga0163162_10025806
582 Ga0163162_10253722
583 Ga0163162_11281931
584 Ga0157372_10000114
585 Ga0157372_10002824
586 Ga0157372_10006804
587 Ga0157372_10015560
588 Ga0157372_10051559
589 Ga0157372_10053974
590 Ga0157372_10245159
591 Ga0157372_10319608
592 Ga0157375_10008565
593 Ga0157375_10024346
594 Ga0157375_11171137
595 Ga0163163_10000351
596 Ga0157377_10234279
597 Ga0157379_10000479
598 Ga0157379_10012771
599 Ga0157379_10711128
600 Ga0157376_10000204
601 Ga0157376_10015789
602 Ga0157376_10142910
603 Ga0207697_10028885
604 Ga0207656_10068657
605 Ga0207642_10093678
606 Ga0207710_10002186
607 Ga0207680_10015721
608 Ga0207680_10160528
609 Ga0207647_10019034
610 Ga0207645_10005768
611 Ga0207705_10241775
612 Ga0207654_10000158
613 Ga0207654_10000582
614 Ga0207654_10000636
615 Ga0207654_10053768
616 Ga0207654_10068921
617 Ga0207654_10151225
618 Ga0207707_10132034
619 Ga0207695_10000052
620 Ga0207695_10000108
621 Ga0207695_10000253
622 Ga0207695_10007791
623 Ga0207695_10022822
624 Ga0207695_11056470
625 Ga0207671_10000081
626 Ga0207671_10000611
627 Ga0207671_10032458
628 Ga0207671_10059860
629 Ga0207671_10066144
630 Ga0207671_10170974
631 Ga0207671_10583238
632 Ga0207657_10007493
633 Ga0207649_10007506
634 Ga0207652_10164457
635 Ga0207694_10000108
636 Ga0207694_10000264
637 Ga0207694_10001583
638 Ga0207694_10095183
639 Ga0207694_10496961
640 Ga0207650_10021344
641 Ga0207650_10080163
642 Ga0207659_10245204
643 Ga0207687_10000440
644 Ga0207687_10005704
645 Ga0207687_10129288
646 Ga0207687_10318649
647 Ga0207700_10032492
648 Ga0207700_11177598
649 Ga0207644_10022928
650 Ga0207644_10033751
651 Ga0207644_10065141
652 Ga0207644_10793709
653 Ga0207706_10005478
654 Ga0207686_10104656
655 Ga0207704_10040567
656 Ga0207691_10001227
657 Ga0207711_10005422
658 Ga0207711_10039580
659 Ga0207711_10104772
660 Ga0207711_10243038
661 Ga0207711_10396551
662 Ga0207689_10001260
663 Ga0207689_10015778
664 Ga0207661_10000467
665 Ga0207661_10052150
666 Ga0207661_10193495
667 Ga0207661_10449096
668 Ga0207679_10124103
669 Ga0207667_10004868
670 Ga0207667_10006221
671 Ga0207667_10015226
672 Ga0207667_10021857
673 Ga0207667_10090891
674 Ga0207667_11880124
675 Ga0207640_10022146
676 Ga0207658_10000569
677 Ga0207677_10000025
678 Ga0207677_10007369
679 Ga0207677_10058768
680 Ga0207677_10505218
681 Ga0207703_10000963
682 Ga0207703_10063131
683 Ga0207639_10000417
684 Ga0207639_10039233
685 Ga0207639_10154798
686 Ga0207639_11061504
687 Ga0207678_10037503
688 Ga0207702_10002081
689 Ga0207702_10003410
690 Ga0207702_10008827
691 Ga0207702_10031243
692 Ga0207702_10045709
693 Ga0207702_10137778
694 Ga0207702_10260565
695 Ga0207702_10983155
696 Ga0207641_10001020
697 Ga0207648_10109284
698 Ga0207676_10000514
699 Ga0207676_10129916
700 Ga0207674_10000459
701 Ga0207674_10001149
702 Ga0207674_10190771
703 Ga0207674_10492467
704 Ga0207675_100130981
705 Ga0207683_10000432
706 Ga0207698_10000007
707 Ga0207698_10000137
708 Ga0207698_10043275
709 Ga0207698_10082973
710 Ga0207698_10111396
711 Ga0207698_10819087
712 Ga0268266_10098857
713 Ga0268265_10598388
714 Ga0268264_10000671
715 Ga0268264_10220320
716 Ga0265319_1149956
717 Ga0265318_10027977
718 Ga0265336_10007957
719 Ga0265338_10002772
720 Ga0265338_10029255
721 Ga0265338_10111284
722 Ga0265338_11006090
723 Ga0265770_1140436
724 Ga0265760_10020881
725 Ga0265330_10000245
726 Ga0265330_10000613
727 Ga0265330_10008388
728 Ga0265330_10108226
729 Ga0265330_10144318
730 Ga0265328_10054875
731 Ga0265325_10000517
732 Ga0265325_10003736
733 Ga0265325_10008429
734 Ga0265325_10073028
735 Ga0265325_10083165
736 Ga0265329_10022921
737 Ga0265340_10003696
738 Ga0265340_10010882
739 Ga0265340_10040594
740 Ga0265339_10028445
741 Ga0265339_10052696
742 Ga0265339_10113260
743 Ga0265339_10193381
744 Ga0265316_10000775
745 Ga0265316_10002414
746 Ga0265316_10008054
747 Ga0265316_10021973
748 Ga0265316_10048322
749 Ga0265316_10195371
750 Ga0265316_10218634
751 Ga0265313_10002682
752 Ga0265313_10005989
753 Ga0265313_10064062
754 Ga0265313_10150195
755 Ga0265314_10000552
756 Ga0265314_10002382
757 Ga0265314_10010271
758 Ga0265314_10016736
759 Ga0265314_10381988
760 Ga0265342_10000928
761 Ga0265342_10006604
762 Ga0265342_10008675
763 Ga0265342_10022461
764 Ga0265342_10043923
765 Ga0265342_10068670
766 Ga0265342_10238876
767 Ga0373953_0146708
768 Ga0373955_0076231
769 Ga0373933_0071382
770 Ga0373937_0004211
771 Ga0373937_0526738
772 Ga0373937_0773949
773 Ga0466963_0035872
774 Ga0453684_0787992
775 Ga0466967_0000205
776 Ga0466967_0127501
777 Ga0495629_0031497
778 Ga0495651_0382831
779 Ga0495651_0862477
780 Ga0495653_0208929
781 Ga0495580_0071448
782 Ga0495580_0340494
783 Ga0495662_0235864
784 Ga0495664_0111402
785 Ga0495652_0314758
786 Ga0495665_0111909
787 Ga0495586_0645906
788 Ga0495587_0055048
789 Ga0495587_0234281
790 Ga0495645_0003858
791 Ga0495645_0051237
792 Ga0495635_0299803
793 Ga0495599_0059961
794 Ga0495623_0069644
795 Ga0495623_0184682
796 Ga0495669_0174800
797 Ga0495613_0044207
798 Ga0495600_0158121
799 Ga0495581_0056233
800 Ga0495581_0057074
801 Ga0495581_0533762
802 Ga0495675_0045372
803 Ga0495675_0233810
804 Ga0495679_154248
805 Ga0496100_0382653
806 Ga0496101_0091180
807 Ga0496102_0261444
808 Ga0496104_0360201
809 Ga0496105_0312697
810 Ga0496106_0098002
811 Ga0496109_1363279
812 Ga0496112_0382315
813 Ga0496114_0426545
814 Ga0496115_0021202
815 Ga0496115_0237433
816 Ga0496115_0835022
817 nmdc:mga0n895_6263_c1
818 nmdc:mga0a205_62491_c1
819 Ga0495601_0131068
820 Ga0495601_0162079
821 Ga0495619_0507871
822 Ga0495619_0726103

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

30

133

0.9

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

28

150

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bu2-assembly1.cif.gz_A crystal structure of methylmalonyl-coa epimerase from mycobacterium tuberculosis 0.9017 26 170
6xbt-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (q60a) in complex with 2-nitronate-propionyl-coa 0.8915 26 167
6xbv-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (s115t) in complex with 2-nitronate-propionyl-coa 0.8903 26 168
6wf7-assembly1.cif.gz_A methylmalonyl-coa epimerase in complex with methylmalonyl-coa and nh4+ 0.8901 26 168
6xbs-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa 0.89 26 167
ID Description Score Start End Superfamily
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9352 26 165 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8674 29 166 3.10.180.10
6qh4A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8543 25 166 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8487 26 165 3.10.180.10
1jc4A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8437 25 167 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A150P4A5-F1-model_v4 Glyoxalase 0.9826 24 166 GO:0004493
GO:0046491
GO:0046872
AF-A0A3N5XIU3-F1-model_v4 Glyoxalase 0.9726 56 166 GO:0004493
GO:0046491
GO:0046872
AF-A0A2P6WEB6-F1-model_v4 Glyoxalase 0.9543 19 167 GO:0004493
GO:0046491
GO:0046872
AF-A0A2D5TYN0-F1-model_v4 Glyoxalase 0.9537 61 168 GO:0004493
GO:0046491
GO:0046872
AF-A0A2E8GLT0-F1-model_v4 Glyoxalase 0.9475 18 167 GO:0004493
GO:0046491
GO:0046872

Map