F437516

General Info

Members Datasets Scaffolds Average Seq Length
411 230 822 142

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10000109|Ga0157378_1000010970
Length 169
Sequence VPRLRGDRTNEFFRYDSPFTSPEEIMYDERIAGPMRAELTQLGFEETRTPQEVDAVLQEKKGTVLVVVNSVCGCAAGVARPAIAMALENEVRPDRMITVFAGNDREATQRAREYFVGYRPSSPSVALFRDGELVKMIERHQIEGRAAHDIASELAMSFNQFCAKEAAVQ

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
163 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
164 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
165 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
166 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
167 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
168 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
169 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
170 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
171 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
172 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
173 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
215 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 5.84
Rhizosphere 89.78
Stem 0
Stem Tuber 0
Unclassified 19.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10000109 3300013297 Bacteria 78488
2 Ga0032354_1144683 3300003693 Unclassified 791
3 Ga0058859_11303181 3300004798 Bacteria 593
4 Ga0065714_10343657 3300005288 Unclassified 599
5 Ga0065712_10000156 3300005290 Bacteria 37789
6 Ga0065715_10001125 3300005293 Bacteria 11430
7 Ga0065707_10279574 3300005295 Unclassified 1051
8 Ga0070683_100000085 3300005329 Bacteria 62547
9 Ga0070683_100562992 3300005329 Bacteria 1090
10 Ga0070690_100812417 3300005330 Bacteria 726
11 Ga0070670_100000080 3300005331 Bacteria 92128
12 Ga0070670_100126604 3300005331 Bacteria 2205
13 Ga0070670_100488956 3300005331 Bacteria 1093
14 Ga0068869_100016319 3300005334 Bacteria 5004
15 Ga0068869_101488389 3300005334 Archaea 601
16 Ga0070682_100116004 3300005337 Bacteria 1791
17 Ga0070682_100171549 3300005337 Unclassified 1508
18 Ga0070682_101749078 3300005337 Bacteria 541
19 Ga0068868_100000206 3300005338 Bacteria 39880
20 Ga0068868_100000862 3300005338 Bacteria 20527
21 Ga0068868_100406335 3300005338 Bacteria 1176
22 Ga0068868_101566197 3300005338 Bacteria 618
23 Ga0070689_100005284 3300005340 Bacteria 8799
24 Ga0070689_100897870 3300005340 Bacteria 784
25 Ga0070687_100003380 3300005343 Bacteria 6190
26 Ga0070687_100043337 3300005343 Bacteria 2286
27 Ga0070692_10079158 3300005345 Bacteria 1766
28 Ga0070668_100064955 3300005347 Bacteria 2830
29 Ga0070669_100176659 3300005353 Bacteria 1668
30 Ga0070675_100000013 3300005354 Bacteria 206266
31 Ga0070675_100069233 3300005354 Bacteria 2923
32 Ga0070675_100086765 3300005354 Bacteria 2616
33 Ga0070675_100665024 3300005354 Bacteria 947
34 Ga0070674_100439755 3300005356 Bacteria 1074
35 Ga0070674_102078861 3300005356 Bacteria 518
36 Ga0070673_100051252 3300005364 Bacteria 3231
37 Ga0070673_100227698 3300005364 Bacteria 1616
38 Ga0070673_101782269 3300005364 Bacteria 583
39 Ga0070688_100053051 3300005365 Bacteria 2535
40 Ga0070709_10894762 3300005434 Unclassified 702
41 Ga0070701_10009560 3300005438 Bacteria 4252
42 Ga0070705_100938138 3300005440 Unclassified 698
43 Ga0070708_100015602 3300005445 Bacteria 6278
44 Ga0070708_100073265 3300005445 Bacteria 3086
45 Ga0070708_100222534 3300005445 Bacteria 1770
46 Ga0070708_100659342 3300005445 Bacteria 986
47 Ga0070662_100442293 3300005457 Bacteria 1078
48 Ga0070681_10752944 3300005458 Unclassified 891
49 Ga0068867_100972963 3300005459 Bacteria 768
50 Ga0068867_101700035 3300005459 Bacteria 592
51 Ga0070685_10002070 3300005466 Bacteria 10371
52 Ga0070685_10024034 3300005466 Bacteria 3344
53 Ga0070706_100014732 3300005467 Bacteria 7224
54 Ga0070706_100018935 3300005467 Bacteria 6350
55 Ga0070707_100007053 3300005468 Bacteria 10419
56 Ga0070707_100063383 3300005468 Unclassified 3548
57 Ga0070707_100079882 3300005468 Bacteria 3157
58 Ga0070707_100173297 3300005468 Unclassified 2102
59 Ga0070698_100015507 3300005471 Bacteria 8049
60 Ga0070698_100550098 3300005471 Bacteria 1094
61 Ga0070698_100728233 3300005471 Bacteria 934
62 Ga0070698_100730260 3300005471 Unclassified 933
63 Ga0070698_101244174 3300005471 Unclassified 694
64 Ga0070699_100008724 3300005518 Bacteria 8787
65 Ga0070699_100238755 3300005518 Bacteria 1622
66 Ga0070699_100320362 3300005518 Bacteria 1393
67 Ga0070679_100330368 3300005530 Unclassified 1473
68 Ga0070684_100000071 3300005535 Bacteria 64721
69 Ga0070684_100892985 3300005535 Bacteria 832
70 Ga0070697_100025867 3300005536 Bacteria 4682
71 Ga0070697_101886363 3300005536 Unclassified 535
72 Ga0068853_100163206 3300005539 Bacteria 2012
73 Ga0068853_100347564 3300005539 Bacteria 1379
74 Ga0070672_100000375 3300005543 Bacteria 25879
75 Ga0070672_100013577 3300005543 Bacteria 5759
76 Ga0070686_100213321 3300005544 Bacteria 1391
77 Ga0070686_100354751 3300005544 Bacteria 1103
78 Ga0070696_100000071 3300005546 Bacteria 49495
79 Ga0070696_100392347 3300005546 Unclassified 1084
80 Ga0070665_100035594 3300005548 Bacteria 5007
81 Ga0070704_100660590 3300005549 Unclassified 924
82 Ga0070704_100972086 3300005549 Bacteria 767
83 Ga0070704_101087922 3300005549 Bacteria 726
84 Ga0068857_100252514 3300005577 Bacteria 1617
85 Ga0068857_101687147 3300005577 Unclassified 619
86 Ga0068854_100010306 3300005578 Bacteria 6057
87 Ga0068854_100272828 3300005578 Bacteria 1359
88 Ga0068854_100319163 3300005578 Bacteria 1262
89 Ga0070702_100194536 3300005615 Bacteria 1337
90 Ga0070702_100651454 3300005615 Unclassified 796
91 Ga0068852_100506326 3300005616 Bacteria 1203
92 Ga0068859_101393538 3300005617 Bacteria 773
93 Ga0068864_100000026 3300005618 Bacteria 243111
94 Ga0068864_100082030 3300005618 Bacteria 2829
95 Ga0068864_101055208 3300005618 Unclassified 807
96 Ga0068861_100085635 3300005719 Bacteria 2476
97 Ga0068863_100110013 3300005841 Bacteria 2623
98 Ga0068863_100134029 3300005841 Bacteria 2366
99 Ga0068858_100003230 3300005842 Bacteria 16263
100 Ga0068858_100286898 3300005842 Bacteria 1568
101 Ga0068860_100101911 3300005843 Bacteria 2739
102 Ga0068862_100681422 3300005844 Bacteria 994
103 Ga0070717_10681102 3300006028 Bacteria 934
104 Ga0070717_10741504 3300006028 Unclassified 893
105 Ga0070716_100731126 3300006173 Bacteria 759
106 Ga0070716_101005108 3300006173 Bacteria 660
107 Ga0070716_101027386 3300006173 Bacteria 653
108 Ga0075362_10062277 3300006177 Bacteria 1690
109 Ga0097621_100304444 3300006237 Bacteria 1408
110 Ga0097621_101080840 3300006237 Unclassified 752
111 Ga0068871_100059057 3300006358 Bacteria 3124
112 Ga0068871_100176019 3300006358 Bacteria 1837
113 Ga0075428_100012693 3300006844 Bacteria 9370
114 Ga0075428_100895761 3300006844 Bacteria 941
115 Ga0075431_100012577 3300006847 Bacteria 8541
116 Ga0075433_11578112 3300006852 Unclassified 566
117 Ga0075434_100102273 3300006871 Bacteria 2873
118 Ga0075434_100655481 3300006871 Bacteria 1068
119 Ga0075429_100200725 3300006880 Bacteria 1747
120 Ga0068865_100301545 3300006881 Bacteria 1282
121 Ga0075436_101150493 3300006914 Bacteria 585
122 Ga0097620_101393364 3300006931 Bacteria 773
123 Ga0075435_100043823 3300007076 Bacteria 3583
124 Ga0075435_100179096 3300007076 Bacteria 1791
125 Ga0111539_10000004 3300009094 Bacteria 751278
126 Ga0111539_11776921 3300009094 Bacteria 715
127 Ga0105245_10000005 3300009098 Bacteria 335871
128 Ga0105245_10004113 3300009098 Bacteria 12919
129 Ga0105245_10352716 3300009098 Bacteria 1458
130 Ga0105245_10364810 3300009098 Bacteria 1434
131 Ga0105245_11037093 3300009098 Unclassified 865
132 Ga0105247_10123156 3300009101 Bacteria 1682
133 Ga0114129_10136378 3300009147 Bacteria 3367
134 Ga0114129_10567148 3300009147 Bacteria 1474
135 Ga0114129_11548825 3300009147 Bacteria 813
136 Ga0105243_10028699 3300009148 Bacteria 4273
137 Ga0105243_10387553 3300009148 Bacteria 1294
138 Ga0105241_10077012 3300009174 Bacteria 2602
139 Ga0105241_10269360 3300009174 Bacteria 1450
140 Ga0105242_10148883 3300009176 Bacteria 2039
141 Ga0105248_10080627 3300009177 Bacteria 3658
142 Ga0105248_10104872 3300009177 Bacteria 3187
143 Ga0105238_10000029 3300009551 Bacteria 182309
144 Ga0105249_10032354 3300009553 Bacteria 4731
145 Ga0105249_11470679 3300009553 Bacteria 753
146 Ga0105239_10423518 3300010375 Unclassified 1508
147 Ga0105239_11858008 3300010375 Bacteria 698
148 Ga0105246_11093905 3300011119 Bacteria 727
149 Ga0157369_10000232 3300013105 Bacteria 77009
150 Ga0157374_10000008 3300013296 Bacteria 588863
151 Ga0157374_10262183 3300013296 Bacteria 1702
152 Ga0157378_10000013 3300013297 Bacteria 151930
153 Ga0157378_10018563 3300013297 Bacteria 6113
154 Ga0157378_10456610 3300013297 Bacteria 1269
155 Ga0163162_10295703 3300013306 Bacteria 1751
156 Ga0157372_13153801 3300013307 Unclassified 526
157 Ga0157375_10000022 3300013308 Bacteria 239765
158 Ga0157375_10000032 3300013308 Bacteria 187931
159 Ga0157375_10004303 3300013308 Bacteria 12349
160 Ga0157375_10009559 3300013308 Bacteria 8512
161 Ga0157375_10302882 3300013308 Bacteria 1762
162 Ga0157375_11986814 3300013308 Unclassified 691
163 Ga0157375_12364662 3300013308 Unclassified 634
164 Ga0163163_10373517 3300014325 Unclassified 1483
165 Ga0163163_11358824 3300014325 Bacteria 772
166 Ga0157380_10591145 3300014326 Bacteria 1096
167 Ga0157377_10000012 3300014745 Bacteria 274497
168 Ga0157377_10223891 3300014745 Unclassified 1206
169 Ga0157377_10580295 3300014745 Bacteria 797
170 Ga0157379_10199798 3300014968 Bacteria 1808
171 Ga0157379_11120352 3300014968 Bacteria 754
172 Ga0157376_10000013 3300014969 Bacteria 304287
173 Ga0157376_10342702 3300014969 Unclassified 1428
174 Ga0163161_10005969 3300017792 Bacteria 8443
175 Ga0213873_10000001 3300021358 Bacteria 1657979
176 Ga0213876_10000002 3300021384 Bacteria 1168769
177 Ga0213876_10003270 3300021384 Bacteria 9301
178 Ga0213876_10004005 3300021384 Bacteria 8295
179 Ga0213875_10257163 3300021388 Bacteria 824
180 Ga0207653_10031733 3300025885 Bacteria 1707
181 Ga0207642_10735501 3300025899 Bacteria 624
182 Ga0207710_10003108 3300025900 Bacteria 7437
183 Ga0207680_10048786 3300025903 Bacteria 2517
184 Ga0207647_10092641 3300025904 Bacteria 1801
185 Ga0207647_10133882 3300025904 Bacteria 1455
186 Ga0207643_11086408 3300025908 Bacteria 516
187 Ga0207684_10027996 3300025910 Bacteria 4801
188 Ga0207684_10122298 3300025910 Bacteria 2232
189 Ga0207684_10250702 3300025910 Bacteria 1527
190 Ga0207654_10231679 3300025911 Unclassified 1230
191 Ga0207654_10581524 3300025911 Bacteria 798
192 Ga0207707_10601402 3300025912 Bacteria 931
193 Ga0207662_10059061 3300025918 Bacteria 2298
194 Ga0207662_10117838 3300025918 Bacteria 1662
195 Ga0207662_10209154 3300025918 Unclassified 1266
196 Ga0207662_10474935 3300025918 Bacteria 858
197 Ga0207652_10532489 3300025921 Unclassified 1057
198 Ga0207652_11369483 3300025921 Unclassified 611
199 Ga0207646_10012149 3300025922 Bacteria 8285
200 Ga0207646_10033956 3300025922 Bacteria 4610
201 Ga0207646_10713412 3300025922 Bacteria 896
202 Ga0207681_10089444 3300025923 Bacteria 2195
203 Ga0207694_10000002 3300025924 Bacteria 1165763
204 Ga0207694_10000003 3300025924 Bacteria 1165533
205 Ga0207650_10000026 3300025925 Bacteria 264152
206 Ga0207650_10000028 3300025925 Bacteria 236867
207 Ga0207650_10664061 3300025925 Bacteria 879
208 Ga0207650_10745387 3300025925 Bacteria 829
209 Ga0207650_10784175 3300025925 Unclassified 807
210 Ga0207659_10000068 3300025926 Bacteria 65892
211 Ga0207659_10043658 3300025926 Bacteria 3150
212 Ga0207687_10000005 3300025927 Bacteria 770649
213 Ga0207687_10006157 3300025927 Bacteria 7938
214 Ga0207687_10152974 3300025927 Bacteria 1762
215 Ga0207644_10206792 3300025931 Bacteria 1550
216 Ga0207644_10576499 3300025931 Unclassified 933
217 Ga0207644_10810648 3300025931 Bacteria 783
218 Ga0207644_11228634 3300025931 Bacteria 630
219 Ga0207706_10123705 3300025933 Bacteria 2275
220 Ga0207706_10344015 3300025933 Unclassified 1297
221 Ga0207686_10084359 3300025934 Bacteria 2081
222 Ga0207686_10457916 3300025934 Unclassified 982
223 Ga0207686_10576574 3300025934 Unclassified 883
224 Ga0207709_10083151 3300025935 Bacteria 2069
225 Ga0207709_10386702 3300025935 Bacteria 1066
226 Ga0207709_11378355 3300025935 Bacteria 584
227 Ga0207670_10010009 3300025936 Bacteria 5439
228 Ga0207670_10095709 3300025936 Bacteria 2110
229 Ga0207670_10262830 3300025936 Bacteria 1338
230 Ga0207670_10892139 3300025936 Bacteria 744
231 Ga0207669_10165241 3300025937 Bacteria 1569
232 Ga0207704_10031829 3300025938 Bacteria 2977
233 Ga0207704_10164068 3300025938 Bacteria 1584
234 Ga0207704_10448483 3300025938 Bacteria 1029
235 Ga0207704_11084438 3300025938 Bacteria 680
236 Ga0207665_10206242 3300025939 Bacteria 1434
237 Ga0207665_11080854 3300025939 Bacteria 639
238 Ga0207691_10000551 3300025940 Bacteria 37577
239 Ga0207691_10110850 3300025940 Bacteria 2440
240 Ga0207691_10141432 3300025940 Unclassified 2120
241 Ga0207691_10176234 3300025940 Bacteria 1870
242 Ga0207711_10113121 3300025941 Bacteria 2416
243 Ga0207711_10681918 3300025941 Unclassified 958
244 Ga0207711_11788220 3300025941 Unclassified 558
245 Ga0207689_10003043 3300025942 Bacteria 15448
246 Ga0207689_10988777 3300025942 Bacteria 710
247 Ga0207689_11162246 3300025942 Bacteria 650
248 Ga0207689_11304800 3300025942 Archaea 610
249 Ga0207661_10000022 3300025944 Bacteria 198514
250 Ga0207661_10321948 3300025944 Bacteria 1390
251 Ga0207661_10545145 3300025944 Unclassified 1062
252 Ga0207679_10387608 3300025945 Bacteria 1226
253 Ga0207679_10644726 3300025945 Unclassified 958
254 Ga0207679_10896316 3300025945 Unclassified 811
255 Ga0207651_10009580 3300025960 Bacteria 5315
256 Ga0207651_10021287 3300025960 Bacteria 3938
257 Ga0207651_10147912 3300025960 Unclassified 1824
258 Ga0207651_10151317 3300025960 Bacteria 1807
259 Ga0207651_10295165 3300025960 Bacteria 1346
260 Ga0207651_11245264 3300025960 Bacteria 668
261 Ga0207651_11432342 3300025960 Bacteria 622
262 Ga0207712_10039512 3300025961 Bacteria 3233
263 Ga0207668_10088591 3300025972 Bacteria 2267
264 Ga0207640_10001424 3300025981 Bacteria 12950
265 Ga0207640_10141731 3300025981 Bacteria 1753
266 Ga0207640_11738302 3300025981 Unclassified 563
267 Ga0207677_10000048 3300026023 Bacteria 101555
268 Ga0207677_10000121 3300026023 Bacteria 64050
269 Ga0207677_10158360 3300026023 Bacteria 1756
270 Ga0207677_12092431 3300026023 Bacteria 526
271 Ga0207703_10000034 3300026035 Bacteria 184136
272 Ga0207703_10122493 3300026035 Bacteria 2234
273 Ga0207703_10256635 3300026035 Unclassified 1578
274 Ga0207703_10501389 3300026035 Bacteria 1139
275 Ga0207703_11401372 3300026035 Unclassified 672
276 Ga0207703_11403104 3300026035 Bacteria 672
277 Ga0207639_10100627 3300026041 Bacteria 2335
278 Ga0207639_10285365 3300026041 Bacteria 1453
279 Ga0207639_11029179 3300026041 Unclassified 772
280 Ga0207678_10636986 3300026067 Bacteria 936
281 Ga0207641_10067124 3300026088 Bacteria 3072
282 Ga0207641_10267793 3300026088 Bacteria 1602
283 Ga0207641_11152261 3300026088 Unclassified 774
284 Ga0207648_10197306 3300026089 Bacteria 1785
285 Ga0207648_10199012 3300026089 Unclassified 1777
286 Ga0207676_10000011 3300026095 Bacteria 382648
287 Ga0207676_10045952 3300026095 Bacteria 3376
288 Ga0207676_10585659 3300026095 Unclassified 1070
289 Ga0207674_10101387 3300026116 Bacteria 2860
290 Ga0207675_100233383 3300026118 Unclassified 1776
291 Ga0207675_100269003 3300026118 Bacteria 1654
292 Ga0207675_100909155 3300026118 Bacteria 897
293 Ga0207683_10018467 3300026121 Bacteria 5952
294 Ga0207683_10412948 3300026121 Unclassified 1242
295 Ga0207698_11061566 3300026142 Bacteria 822
296 Ga0207428_10000025 3300027907 Bacteria 259620
297 Ga0268266_10130387 3300028379 Bacteria 2248
298 Ga0268265_10783562 3300028380 Unclassified 928
299 Ga0268265_11124529 3300028380 Unclassified 781
300 Ga0268264_10014544 3300028381 Bacteria 6465
301 Ga0268264_10093808 3300028381 Unclassified 2594
302 Ga0268264_10149671 3300028381 Unclassified 2091
303 Ga0268264_11186633 3300028381 Unclassified 773
304 Ga0307511_10020270 3300030521 Bacteria 6298
305 Ga0265325_10360347 3300031241 Bacteria 641
306 Ga0307412_11894855 3300031911 Bacteria 550
307 Ga0307416_100710995 3300032002 Bacteria 1095
308 Ga0373934_0102899 3300035086 Bacteria 1155
309 Ga0373940_0045013 3300035088 Bacteria 1224
310 Ga0373944_0066194 3300035089 Bacteria 1168
311 Ga0373932_0000115 3300035112 Bacteria 22238
312 Ga0373941_0007734 3300035115 Bacteria 2641
313 Ga0373954_0625006 3300035118 Bacteria 534
314 Ga0373957_0362369 3300035120 Bacteria 620
315 Ga0373943_0060244 3300035170 Bacteria 1894
316 Ga0373946_0077843 3300035171 Unclassified 1446
317 Ga0373947_0301026 3300035725 Bacteria 1069
318 Ga0373937_0048980 3300036401 Unclassified 3869
319 Ga0436364_1178622 3300037853 Bacteria 1876
320 Ga0436365_0169042 3300039437 Bacteria 856
321 Ga0436365_0703007 3300039437 Bacteria 34772
322 Ga0436365_0816620 3300039437 Bacteria 11480
323 Ga0436365_0862132 3300039437 Bacteria 257735
324 Ga0436365_1330752 3300039437 Bacteria 1217
325 Ga0436365_1852133 3300039437 Bacteria 2777
326 Ga0436362_0842419 3300039453 Bacteria 317447
327 Ga0451837_0407641 3300041494 Bacteria 588
328 Ga0451845_0006255 3300041501 Bacteria 875
329 Ga0439457_114890 3300042014 Bacteria 634
330 Ga0450920_072288 3300042122 Bacteria 702
331 Ga0450897_018096 3300042128 Bacteria 737
332 Ga0450894_031948 3300042131 Bacteria 736
333 Ga0450895_004709 3300042132 Bacteria 1082
334 Ga0450896_004311 3300042133 Bacteria 1927
335 Ga0450908_018617 3300042184 Bacteria 1226
336 Ga0439435_0072688 3300042436 Bacteria 1020
337 Ga0439464_0039976 3300042439 Bacteria 1335
338 Ga0439464_0239776 3300042439 Unclassified 584
339 Ga0450918_002700 3300042531 Bacteria 3333
340 Ga0451577_0003887 3300042876 Bacteria 16171
341 Ga0451577_0142261 3300042876 Bacteria 2156
342 Ga0453683_0108722 3300044673 Bacteria 1743
343 Ga0453684_1936318 3300044712 Unclassified 595
344 Ga0451576_2151493 3300045051 Bacteria 573
345 Ga0466967_1759706 3300045976 Unclassified 617
346 Ga0495590_0148187 3300046457 Unclassified 850
347 Ga0495629_0595163 3300046459 Unclassified 740
348 Ga0495629_0803327 3300046459 Bacteria 620
349 Ga0495608_0916433 3300046511 Bacteria 512
350 Ga0495620_0001133 3300046515 Bacteria 16259
351 Ga0495652_1063993 3300046529 Bacteria 527
352 Ga0495586_0611486 3300046535 Bacteria 630
353 Ga0495587_0405166 3300046536 Bacteria 758
354 Ga0495598_0119021 3300046537 Unclassified 894
355 Ga0495634_0075486 3300046642 Unclassified 2214
356 Ga0495657_0442028 3300046675 Bacteria 762
357 Ga0495658_0180154 3300046683 Bacteria 1311
358 Ga0495613_0121430 3300046689 Bacteria 1876
359 Ga0495604_0525957 3300047317 Bacteria 765
360 Ga0495636_0571060 3300047318 Bacteria 551
361 Ga0495674_0375340 3300047319 Bacteria 1151
362 Ga0495672_0242199 3300047320 Unclassified 880
363 Ga0495680_0493695 3300047322 Bacteria 832
364 Ga0496100_0097326 3300048903 Bacteria 2021
365 Ga0496101_0324017 3300048904 Unclassified 1209
366 Ga0496101_1386960 3300048904 Bacteria 548
367 Ga0496102_0826506 3300048905 Bacteria 849
368 Ga0496103_0192879 3300048906 Bacteria 1310
369 Ga0496104_0027085 3300048907 Bacteria 5301
370 Ga0496104_0116227 3300048907 Bacteria 2567
371 Ga0496105_0265780 3300048908 Unclassified 1386
372 Ga0496106_0118774 3300048909 Bacteria 2065
373 Ga0496107_0065793 3300048910 Bacteria 2628
374 Ga0496107_1000219 3300048910 Unclassified 607
375 Ga0496108_0020778 3300048911 Bacteria 5397
376 Ga0496108_0042345 3300048911 Bacteria 3801
377 Ga0496109_0001763 3300048912 Bacteria 17979
378 Ga0496109_0688682 3300048912 Bacteria 959
379 Ga0496111_0178116 3300048914 Bacteria 1580
380 Ga0496111_0230512 3300048914 Bacteria 1376
381 Ga0496112_0001651 3300048915 Bacteria 17324
382 Ga0496112_0758646 3300048915 Bacteria 896
383 Ga0496113_0251989 3300048916 Bacteria 1410
384 Ga0496114_0045407 3300048917 Bacteria 3649
385 Ga0496114_0056289 3300048917 Bacteria 3281
386 Ga0496114_1127590 3300048917 Unclassified 669
387 Ga0496115_0251805 3300048918 Unclassified 1454
388 Ga0501071_0753545 3300049587 Unclassified 750
389 Ga0501073_0004921 3300049589 Bacteria 10029
390 Ga0501074_0957403 3300049590 Bacteria 602
391 Ga0501217_205209 3300049661 Unclassified 616
392 Ga0501235_041769 3300049669 Unclassified 1050
393 Ga0501080_0031036 3300049742 Bacteria 4979
394 Ga0501081_1176682 3300049743 Unclassified 581
395 nmdc:mga03683_31998_c1 3300050489 Bacteria 2113
396 nmdc:mga05p37_1481193_c1 3300050507 Unclassified 677
397 nmdc:mga05p37_293139_c1 3300050507 Bacteria 1936
398 nmdc:mga06r32_27269_c1 3300050510 Bacteria 5334
399 nmdc:mga08y16_5_c1 3300050511 Bacteria 751284
400 nmdc:mga0n895_238781_c1 3300050512 Bacteria 1844
401 nmdc:mga0n895_875974_c1 3300050512 Unclassified 884
402 nmdc:mga0rr50_40122_c1 3300050513 Bacteria 3401
403 nmdc:mga0rr50_7437_c1 3300050513 Bacteria 6757
404 nmdc:mga08x19_319980_c1 3300050514 Unclassified 1079
405 nmdc:mga0a205_939914_c1 3300050515 Unclassified 711
406 Ga0495601_0029004 3300053077 Bacteria 3430
407 Ga0495601_0281021 3300053077 Bacteria 1085
408 Ga0495612_0044435 3300053078 Bacteria 1818
409 Ga0495595_0183692 3300053084 Bacteria 1037
410 Ga0495619_0004057 3300053085 Bacteria 9383
411 Ga0500566_0270685 3300053094 Bacteria 815
412 Ga0157378_10000109
413 Ga0032354_1144683
414 Ga0058859_11303181
415 Ga0065714_10343657
416 Ga0065712_10000156
417 Ga0065715_10001125
418 Ga0065707_10279574
419 Ga0070683_100000085
420 Ga0070683_100562992
421 Ga0070690_100812417
422 Ga0070670_100000080
423 Ga0070670_100126604
424 Ga0070670_100488956
425 Ga0068869_100016319
426 Ga0068869_101488389
427 Ga0070682_100116004
428 Ga0070682_100171549
429 Ga0070682_101749078
430 Ga0068868_100000206
431 Ga0068868_100000862
432 Ga0068868_100406335
433 Ga0068868_101566197
434 Ga0070689_100005284
435 Ga0070689_100897870
436 Ga0070687_100003380
437 Ga0070687_100043337
438 Ga0070692_10079158
439 Ga0070668_100064955
440 Ga0070669_100176659
441 Ga0070675_100000013
442 Ga0070675_100069233
443 Ga0070675_100086765
444 Ga0070675_100665024
445 Ga0070674_100439755
446 Ga0070674_102078861
447 Ga0070673_100051252
448 Ga0070673_100227698
449 Ga0070673_101782269
450 Ga0070688_100053051
451 Ga0070709_10894762
452 Ga0070701_10009560
453 Ga0070705_100938138
454 Ga0070708_100015602
455 Ga0070708_100073265
456 Ga0070708_100222534
457 Ga0070708_100659342
458 Ga0070662_100442293
459 Ga0070681_10752944
460 Ga0068867_100972963
461 Ga0068867_101700035
462 Ga0070685_10002070
463 Ga0070685_10024034
464 Ga0070706_100014732
465 Ga0070706_100018935
466 Ga0070707_100007053
467 Ga0070707_100063383
468 Ga0070707_100079882
469 Ga0070707_100173297
470 Ga0070698_100015507
471 Ga0070698_100550098
472 Ga0070698_100728233
473 Ga0070698_100730260
474 Ga0070698_101244174
475 Ga0070699_100008724
476 Ga0070699_100238755
477 Ga0070699_100320362
478 Ga0070679_100330368
479 Ga0070684_100000071
480 Ga0070684_100892985
481 Ga0070697_100025867
482 Ga0070697_101886363
483 Ga0068853_100163206
484 Ga0068853_100347564
485 Ga0070672_100000375
486 Ga0070672_100013577
487 Ga0070686_100213321
488 Ga0070686_100354751
489 Ga0070696_100000071
490 Ga0070696_100392347
491 Ga0070665_100035594
492 Ga0070704_100660590
493 Ga0070704_100972086
494 Ga0070704_101087922
495 Ga0068857_100252514
496 Ga0068857_101687147
497 Ga0068854_100010306
498 Ga0068854_100272828
499 Ga0068854_100319163
500 Ga0070702_100194536
501 Ga0070702_100651454
502 Ga0068852_100506326
503 Ga0068859_101393538
504 Ga0068864_100000026
505 Ga0068864_100082030
506 Ga0068864_101055208
507 Ga0068861_100085635
508 Ga0068863_100110013
509 Ga0068863_100134029
510 Ga0068858_100003230
511 Ga0068858_100286898
512 Ga0068860_100101911
513 Ga0068862_100681422
514 Ga0070717_10681102
515 Ga0070717_10741504
516 Ga0070716_100731126
517 Ga0070716_101005108
518 Ga0070716_101027386
519 Ga0075362_10062277
520 Ga0097621_100304444
521 Ga0097621_101080840
522 Ga0068871_100059057
523 Ga0068871_100176019
524 Ga0075428_100012693
525 Ga0075428_100895761
526 Ga0075431_100012577
527 Ga0075433_11578112
528 Ga0075434_100102273
529 Ga0075434_100655481
530 Ga0075429_100200725
531 Ga0068865_100301545
532 Ga0075436_101150493
533 Ga0097620_101393364
534 Ga0075435_100043823
535 Ga0075435_100179096
536 Ga0111539_10000004
537 Ga0111539_11776921
538 Ga0105245_10000005
539 Ga0105245_10004113
540 Ga0105245_10352716
541 Ga0105245_10364810
542 Ga0105245_11037093
543 Ga0105247_10123156
544 Ga0114129_10136378
545 Ga0114129_10567148
546 Ga0114129_11548825
547 Ga0105243_10028699
548 Ga0105243_10387553
549 Ga0105241_10077012
550 Ga0105241_10269360
551 Ga0105242_10148883
552 Ga0105248_10080627
553 Ga0105248_10104872
554 Ga0105238_10000029
555 Ga0105249_10032354
556 Ga0105249_11470679
557 Ga0105239_10423518
558 Ga0105239_11858008
559 Ga0105246_11093905
560 Ga0157369_10000232
561 Ga0157374_10000008
562 Ga0157374_10262183
563 Ga0157378_10000013
564 Ga0157378_10018563
565 Ga0157378_10456610
566 Ga0163162_10295703
567 Ga0157372_13153801
568 Ga0157375_10000022
569 Ga0157375_10000032
570 Ga0157375_10004303
571 Ga0157375_10009559
572 Ga0157375_10302882
573 Ga0157375_11986814
574 Ga0157375_12364662
575 Ga0163163_10373517
576 Ga0163163_11358824
577 Ga0157380_10591145
578 Ga0157377_10000012
579 Ga0157377_10223891
580 Ga0157377_10580295
581 Ga0157379_10199798
582 Ga0157379_11120352
583 Ga0157376_10000013
584 Ga0157376_10342702
585 Ga0163161_10005969
586 Ga0213873_10000001
587 Ga0213876_10000002
588 Ga0213876_10003270
589 Ga0213876_10004005
590 Ga0213875_10257163
591 Ga0207653_10031733
592 Ga0207642_10735501
593 Ga0207710_10003108
594 Ga0207680_10048786
595 Ga0207647_10092641
596 Ga0207647_10133882
597 Ga0207643_11086408
598 Ga0207684_10027996
599 Ga0207684_10122298
600 Ga0207684_10250702
601 Ga0207654_10231679
602 Ga0207654_10581524
603 Ga0207707_10601402
604 Ga0207662_10059061
605 Ga0207662_10117838
606 Ga0207662_10209154
607 Ga0207662_10474935
608 Ga0207652_10532489
609 Ga0207652_11369483
610 Ga0207646_10012149
611 Ga0207646_10033956
612 Ga0207646_10713412
613 Ga0207681_10089444
614 Ga0207694_10000002
615 Ga0207694_10000003
616 Ga0207650_10000026
617 Ga0207650_10000028
618 Ga0207650_10664061
619 Ga0207650_10745387
620 Ga0207650_10784175
621 Ga0207659_10000068
622 Ga0207659_10043658
623 Ga0207687_10000005
624 Ga0207687_10006157
625 Ga0207687_10152974
626 Ga0207644_10206792
627 Ga0207644_10576499
628 Ga0207644_10810648
629 Ga0207644_11228634
630 Ga0207706_10123705
631 Ga0207706_10344015
632 Ga0207686_10084359
633 Ga0207686_10457916
634 Ga0207686_10576574
635 Ga0207709_10083151
636 Ga0207709_10386702
637 Ga0207709_11378355
638 Ga0207670_10010009
639 Ga0207670_10095709
640 Ga0207670_10262830
641 Ga0207670_10892139
642 Ga0207669_10165241
643 Ga0207704_10031829
644 Ga0207704_10164068
645 Ga0207704_10448483
646 Ga0207704_11084438
647 Ga0207665_10206242
648 Ga0207665_11080854
649 Ga0207691_10000551
650 Ga0207691_10110850
651 Ga0207691_10141432
652 Ga0207691_10176234
653 Ga0207711_10113121
654 Ga0207711_10681918
655 Ga0207711_11788220
656 Ga0207689_10003043
657 Ga0207689_10988777
658 Ga0207689_11162246
659 Ga0207689_11304800
660 Ga0207661_10000022
661 Ga0207661_10321948
662 Ga0207661_10545145
663 Ga0207679_10387608
664 Ga0207679_10644726
665 Ga0207679_10896316
666 Ga0207651_10009580
667 Ga0207651_10021287
668 Ga0207651_10147912
669 Ga0207651_10151317
670 Ga0207651_10295165
671 Ga0207651_11245264
672 Ga0207651_11432342
673 Ga0207712_10039512
674 Ga0207668_10088591
675 Ga0207640_10001424
676 Ga0207640_10141731
677 Ga0207640_11738302
678 Ga0207677_10000048
679 Ga0207677_10000121
680 Ga0207677_10158360
681 Ga0207677_12092431
682 Ga0207703_10000034
683 Ga0207703_10122493
684 Ga0207703_10256635
685 Ga0207703_10501389
686 Ga0207703_11401372
687 Ga0207703_11403104
688 Ga0207639_10100627
689 Ga0207639_10285365
690 Ga0207639_11029179
691 Ga0207678_10636986
692 Ga0207641_10067124
693 Ga0207641_10267793
694 Ga0207641_11152261
695 Ga0207648_10197306
696 Ga0207648_10199012
697 Ga0207676_10000011
698 Ga0207676_10045952
699 Ga0207676_10585659
700 Ga0207674_10101387
701 Ga0207675_100233383
702 Ga0207675_100269003
703 Ga0207675_100909155
704 Ga0207683_10018467
705 Ga0207683_10412948
706 Ga0207698_11061566
707 Ga0207428_10000025
708 Ga0268266_10130387
709 Ga0268265_10783562
710 Ga0268265_11124529
711 Ga0268264_10014544
712 Ga0268264_10093808
713 Ga0268264_10149671
714 Ga0268264_11186633
715 Ga0307511_10020270
716 Ga0265325_10360347
717 Ga0307412_11894855
718 Ga0307416_100710995
719 Ga0373934_0102899
720 Ga0373940_0045013
721 Ga0373944_0066194
722 Ga0373932_0000115
723 Ga0373941_0007734
724 Ga0373954_0625006
725 Ga0373957_0362369
726 Ga0373943_0060244
727 Ga0373946_0077843
728 Ga0373947_0301026
729 Ga0373937_0048980
730 Ga0436364_1178622
731 Ga0436365_0169042
732 Ga0436365_0703007
733 Ga0436365_0816620
734 Ga0436365_0862132
735 Ga0436365_1330752
736 Ga0436365_1852133
737 Ga0436362_0842419
738 Ga0451837_0407641
739 Ga0451845_0006255
740 Ga0439457_114890
741 Ga0450920_072288
742 Ga0450897_018096
743 Ga0450894_031948
744 Ga0450895_004709
745 Ga0450896_004311
746 Ga0450908_018617
747 Ga0439435_0072688
748 Ga0439464_0039976
749 Ga0439464_0239776
750 Ga0450918_002700
751 Ga0451577_0003887
752 Ga0451577_0142261
753 Ga0453683_0108722
754 Ga0453684_1936318
755 Ga0451576_2151493
756 Ga0466967_1759706
757 Ga0495590_0148187
758 Ga0495629_0595163
759 Ga0495629_0803327
760 Ga0495608_0916433
761 Ga0495620_0001133
762 Ga0495652_1063993
763 Ga0495586_0611486
764 Ga0495587_0405166
765 Ga0495598_0119021
766 Ga0495634_0075486
767 Ga0495657_0442028
768 Ga0495658_0180154
769 Ga0495613_0121430
770 Ga0495604_0525957
771 Ga0495636_0571060
772 Ga0495674_0375340
773 Ga0495672_0242199
774 Ga0495680_0493695
775 Ga0496100_0097326
776 Ga0496101_0324017
777 Ga0496101_1386960
778 Ga0496102_0826506
779 Ga0496103_0192879
780 Ga0496104_0027085
781 Ga0496104_0116227
782 Ga0496105_0265780
783 Ga0496106_0118774
784 Ga0496107_0065793
785 Ga0496107_1000219
786 Ga0496108_0020778
787 Ga0496108_0042345
788 Ga0496109_0001763
789 Ga0496109_0688682
790 Ga0496111_0178116
791 Ga0496111_0230512
792 Ga0496112_0001651
793 Ga0496112_0758646
794 Ga0496113_0251989
795 Ga0496114_0045407
796 Ga0496114_0056289
797 Ga0496114_1127590
798 Ga0496115_0251805
799 Ga0501071_0753545
800 Ga0501073_0004921
801 Ga0501074_0957403
802 Ga0501217_205209
803 Ga0501235_041769
804 Ga0501080_0031036
805 Ga0501081_1176682
806 nmdc:mga03683_31998_c1
807 nmdc:mga05p37_1481193_c1
808 nmdc:mga05p37_293139_c1
809 nmdc:mga06r32_27269_c1
810 nmdc:mga08y16_5_c1
811 nmdc:mga0n895_238781_c1
812 nmdc:mga0n895_875974_c1
813 nmdc:mga0rr50_40122_c1
814 nmdc:mga0rr50_7437_c1
815 nmdc:mga08x19_319980_c1
816 nmdc:mga0a205_939914_c1
817 Ga0495601_0029004
818 Ga0495601_0281021
819 Ga0495612_0044435
820 Ga0495595_0183692
821 Ga0495619_0004057
822 Ga0500566_0270685

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06491

Disulph_isomer

Disulphide isomerase

27

162

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fhk-assembly1.cif.gz_A crystal structure of apc1446, b.subtilis yphp disulfide isomerase 0.9588 4 137
7rzb-assembly1.cif.gz_A-2 brxa from staphylococcus aureus with bacillithiol mixed disulfide 0.9453 3 138
7rzb-assembly1.cif.gz_A-2 brxa from staphylococcus aureus with bacillithiol mixed disulfide 0.9256 3 138
3fhk-assembly1.cif.gz_A crystal structure of apc1446, b.subtilis yphp disulfide isomerase 0.9002 4 137
3iv4-assembly1.cif.gz_A a putative oxidoreductase with a thioredoxin fold 0.8224 19 134
ID Description Score Start End Superfamily
af_Q2FY55_25_142_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9657 20 137 3.40.30.10
af_Q2FY55_25_142_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9499 20 137 3.40.30.10
af_Q2FYK4_24_144_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9263 19 137 3.40.30.10
af_Q2FYK4_24_144_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9047 19 137 3.40.30.10
af_I1NE04_569_675_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8069 19 136 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3M2C6P9-F1-model_v4 BrxA/BrxB family bacilliredoxin 0.9827 2 137
AF-A0A2V9WJV3-F1-model_v4 BrxA/BrxB family bacilliredoxin 0.9809 1 142
AF-A0A2E6NKF6-F1-model_v4 BrxA/BrxB family bacilliredoxin 0.9803 1 142
AF-A0A2E3A8F5-F1-model_v4 BrxA/BrxB family bacilliredoxin 0.9772 2 139
AF-A0A7C4Y0K2-F1-model_v4 BrxA/BrxB family bacilliredoxin 0.9772 54 138

Map