F437578

General Info

Members Datasets Scaffolds Average Seq Length
411 218 822 275

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_149878|Ga0400483_149878_8710_9714
Length 334
Sequence MHHLEIGHPTKVSPAGSVRRARHDDSAACGRYSSAVTQKTAELTVHVVDGTYELFRQFFARPSHVNGDGLEIGGARGVLRSMLSLLEDGATHVGVTTDHVIESFRNDLYDGYKDGLGIDPDIKNQFQPLEDGLRSIGLATFPMVEFEADDGMASLAAMASADERVQRVLLCTPDKDLAQCVTDGRVLQFDRRNNKILGVDEVVEKYGVRPESIPDWLALVGDSADGFPGLPGWGAKSSATVLQRYGHIEQIPLAAGQWDITVRGGAKLAKTLADNLERALLFRRLATLDLDAPTAETVDELRWSGPADDIEATAKRFDAPDLVERTAALAKARA

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
167 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
168 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
208 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.7
Nodule 0
Rhizoplane 6.08
Rhizosphere 89.29
Stem 0
Stem Tuber 0
Unclassified 14.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_149878 3300039062 Bacteria 21419
2 MBSR1b_contig_10253296 2162886012 Unclassified 1164
3 MBSR1b_contig_3501100 2162886012 Bacteria 1563
4 rootH1_10119931 3300003316 Bacteria 2316
5 rootH2_10183369 3300003320 Bacteria 8823
6 rootL2_10121888 3300003322 Unclassified 1788
7 Ga0065704_10002775 3300005289 Bacteria 6229
8 Ga0065712_10069712 3300005290 Bacteria 6823
9 Ga0065707_10094948 3300005295 Bacteria 3435
10 Ga0070658_10025588 3300005327 Bacteria 4731
11 Ga0070676_10017893 3300005328 Bacteria 3923
12 Ga0070683_100019877 3300005329 Bacteria 5970
13 Ga0070683_100035608 3300005329 Bacteria 4550
14 Ga0070690_100001903 3300005330 Bacteria 11087
15 Ga0070690_100174194 3300005330 Bacteria 1483
16 Ga0070690_100188395 3300005330 Bacteria 1429
17 Ga0070670_100186962 3300005331 Bacteria 1799
18 Ga0068869_100003671 3300005334 Bacteria 9436
19 Ga0068869_100157078 3300005334 Bacteria 1768
20 Ga0068869_100336264 3300005334 Bacteria 1228
21 Ga0068869_100558821 3300005334 Bacteria 962
22 Ga0070666_10029737 3300005335 Bacteria 3594
23 Ga0070666_10066425 3300005335 Bacteria 2447
24 Ga0070680_100246900 3300005336 Unclassified 1509
25 Ga0070682_100000221 3300005337 Bacteria 41449
26 Ga0068868_100028224 3300005338 Unclassified 4288
27 Ga0068868_100039565 3300005338 Bacteria 3664
28 Ga0068868_100115156 3300005338 Bacteria 2188
29 Ga0068868_100251844 3300005338 Bacteria 1487
30 Ga0070660_100075062 3300005339 Bacteria 2647
31 Ga0070660_100156626 3300005339 Bacteria 1834
32 Ga0070660_100302018 3300005339 Bacteria 1312
33 Ga0070660_100421184 3300005339 Bacteria 1106
34 Ga0070687_100013941 3300005343 Bacteria 3598
35 Ga0070687_100031058 3300005343 Bacteria 2617
36 Ga0070687_100048465 3300005343 Unclassified 2184
37 Ga0070661_100004565 3300005344 Bacteria 9522
38 Ga0070661_100033918 3300005344 Bacteria 3700
39 Ga0070661_100380352 3300005344 Bacteria 1113
40 Ga0070692_10043827 3300005345 Unclassified 2302
41 Ga0070668_100022513 3300005347 Unclassified 4764
42 Ga0070668_100055380 3300005347 Bacteria 3061
43 Ga0070669_100069399 3300005353 Bacteria 2603
44 Ga0070675_100005265 3300005354 Bacteria 9880
45 Ga0070671_100027926 3300005355 Bacteria 4645
46 Ga0070671_100180402 3300005355 Bacteria 1787
47 Ga0070674_100243481 3300005356 Bacteria 1409
48 Ga0070673_100086140 3300005364 Bacteria 2559
49 Ga0070673_100469947 3300005364 Bacteria 1134
50 Ga0070688_100095461 3300005365 Bacteria 1952
51 Ga0070659_100005256 3300005366 Bacteria 9289
52 Ga0070659_100011123 3300005366 Bacteria 6647
53 Ga0070659_100035021 3300005366 Unclassified 3907
54 Ga0070659_100057789 3300005366 Bacteria 3060
55 Ga0070659_100091252 3300005366 Bacteria 2442
56 Ga0070667_100055203 3300005367 Bacteria 3355
57 Ga0070667_100098940 3300005367 Bacteria 2517
58 Ga0070709_10088670 3300005434 Unclassified 2035
59 Ga0070713_100176766 3300005436 Bacteria 1916
60 Ga0070710_10119321 3300005437 Bacteria 1594
61 Ga0070710_10142062 3300005437 Bacteria 1473
62 Ga0070705_100053302 3300005440 Bacteria 2367
63 Ga0070700_100066397 3300005441 Bacteria 2290
64 Ga0070700_100071019 3300005441 Unclassified 2222
65 Ga0070700_100100484 3300005441 Unclassified 1905
66 Ga0070694_100060227 3300005444 Unclassified 2588
67 Ga0070708_100094926 3300005445 Bacteria 2722
68 Ga0070663_100319746 3300005455 Bacteria 1247
69 Ga0070678_100041201 3300005456 Unclassified 3272
70 Ga0070678_100091511 3300005456 Bacteria 2334
71 Ga0070678_100454148 3300005456 Bacteria 1123
72 Ga0070662_100003539 3300005457 Bacteria 9741
73 Ga0070662_100010638 3300005457 Bacteria 6050
74 Ga0070685_10120824 3300005466 Unclassified 1627
75 Ga0070707_100010371 3300005468 Bacteria 8677
76 Ga0070707_100069198 3300005468 Bacteria 3398
77 Ga0070707_100194031 3300005468 Bacteria 1980
78 Ga0070698_100003977 3300005471 Bacteria 16259
79 Ga0070684_100005114 3300005535 Bacteria 10020
80 Ga0070684_100029622 3300005535 Bacteria 4641
81 Ga0070684_100106960 3300005535 Bacteria 2505
82 Ga0070684_100225054 3300005535 Bacteria 1712
83 Ga0068853_100006126 3300005539 Bacteria 9524
84 Ga0068853_100028618 3300005539 Unclassified 4688
85 Ga0068853_100029427 3300005539 Bacteria 4631
86 Ga0068853_100052131 3300005539 Bacteria 3524
87 Ga0068853_100111500 3300005539 Bacteria 2430
88 Ga0070672_100155743 3300005543 Bacteria 1892
89 Ga0070686_100090016 3300005544 Bacteria 2051
90 Ga0070696_100157187 3300005546 Bacteria 1673
91 Ga0070696_100190339 3300005546 Bacteria 1527
92 Ga0070693_100039879 3300005547 Bacteria 2633
93 Ga0070665_100264743 3300005548 Bacteria 1720
94 Ga0070665_100634761 3300005548 Bacteria 1081
95 Ga0070704_100044391 3300005549 Bacteria 3088
96 Ga0068855_100037650 3300005563 Bacteria 5751
97 Ga0068855_100095602 3300005563 Unclassified 3424
98 Ga0068855_100529306 3300005563 Bacteria 1278
99 Ga0070664_100006880 3300005564 Bacteria 9168
100 Ga0070664_100017488 3300005564 Bacteria 5888
101 Ga0070664_100192844 3300005564 Unclassified 1816
102 Ga0070664_100216885 3300005564 Bacteria 1711
103 Ga0070664_100322674 3300005564 Bacteria 1399
104 Ga0068857_100007975 3300005577 Bacteria 9140
105 Ga0068857_100016580 3300005577 Bacteria 6454
106 Ga0068857_100161267 3300005577 Bacteria 2035
107 Ga0068854_100054841 3300005578 Bacteria 2868
108 Ga0068854_100221001 3300005578 Bacteria 1499
109 Ga0068856_100012231 3300005614 Bacteria 8314
110 Ga0068856_100031548 3300005614 Bacteria 5185
111 Ga0068856_100500576 3300005614 Bacteria 1236
112 Ga0070702_100043561 3300005615 Bacteria 2530
113 Ga0068852_100010624 3300005616 Bacteria 6889
114 Ga0068852_100021428 3300005616 Bacteria 5160
115 Ga0068852_100025360 3300005616 Bacteria 4803
116 Ga0068852_100074873 3300005616 Bacteria 2984
117 Ga0068859_100052048 3300005617 Bacteria 4118
118 Ga0068859_100451094 3300005617 Bacteria 1382
119 Ga0068859_100639928 3300005617 Bacteria 1156
120 Ga0068859_100825774 3300005617 Unclassified 1013
121 Ga0068864_100006793 3300005618 Bacteria 9371
122 Ga0068866_10250825 3300005718 Bacteria 1083
123 Ga0068861_100007176 3300005719 Bacteria 7629
124 Ga0068861_100011217 3300005719 Bacteria 6221
125 Ga0068870_10086915 3300005840 Bacteria 1740
126 Ga0068863_100136707 3300005841 Bacteria 2342
127 Ga0068863_100267680 3300005841 Bacteria 1653
128 Ga0068858_100002040 3300005842 Bacteria 20578
129 Ga0068858_100261936 3300005842 Bacteria 1644
130 Ga0068858_100333304 3300005842 Bacteria 1451
131 Ga0068860_100004952 3300005843 Bacteria 13574
132 Ga0068860_100052207 3300005843 Bacteria 3889
133 Ga0068860_100059963 3300005843 Bacteria 3617
134 Ga0068860_100115176 3300005843 Bacteria 2571
135 Ga0068860_100475827 3300005843 Bacteria 1244
136 Ga0068862_100106858 3300005844 Bacteria 2454
137 Ga0081455_10011493 3300005937 Bacteria 8894
138 Ga0081455_10056286 3300005937 Unclassified 3340
139 Ga0081455_10143813 3300005937 Bacteria 1848
140 Ga0081540_1000899 3300005983 Bacteria 26887
141 Ga0070717_10022906 3300006028 Unclassified 4942
142 Ga0075364_10202644 3300006051 Bacteria 1345
143 Ga0070715_10000030 3300006163 Bacteria 88060
144 Ga0070716_100025959 3300006173 Bacteria 3132
145 Ga0070716_100234664 3300006173 Unclassified 1240
146 Ga0070712_100066694 3300006175 Bacteria 2559
147 Ga0070712_100183718 3300006175 Unclassified 1631
148 Ga0097621_100056484 3300006237 Bacteria 3207
149 Ga0097621_100069819 3300006237 Unclassified 2901
150 Ga0097621_100104443 3300006237 Bacteria 2387
151 Ga0097621_100188646 3300006237 Unclassified 1784
152 Ga0068871_100177442 3300006358 Bacteria 1829
153 Ga0068871_100379523 3300006358 Bacteria 1255
154 Ga0075431_100288188 3300006847 Bacteria 1662
155 Ga0075434_100145472 3300006871 Unclassified 2390
156 Ga0068865_100095287 3300006881 Bacteria 2168
157 Ga0068865_100225521 3300006881 Bacteria 1467
158 Ga0068865_100462466 3300006881 Bacteria 1051
159 Ga0075436_100442258 3300006914 Bacteria 946
160 Ga0097620_100052048 3300006931 Bacteria 4118
161 Ga0097620_100451052 3300006931 Bacteria 1382
162 Ga0097620_100639901 3300006931 Bacteria 1156
163 Ga0097620_100825820 3300006931 Unclassified 1013
164 Ga0075435_100036635 3300007076 Unclassified 3900
165 Ga0105240_10019768 3300009093 Bacteria 8995
166 Ga0105240_10057584 3300009093 Bacteria 4854
167 Ga0111539_10035936 3300009094 Bacteria 5996
168 Ga0111539_10052921 3300009094 Bacteria 4832
169 Ga0111539_10288857 3300009094 Unclassified 1908
170 Ga0105245_10080314 3300009098 Unclassified 2979
171 Ga0105245_10509421 3300009098 Bacteria 1221
172 Ga0105243_10092609 3300009148 Bacteria 2492
173 Ga0105241_10034259 3300009174 Unclassified 3814
174 Ga0105242_10028509 3300009176 Bacteria 4447
175 Ga0105242_10088216 3300009176 Bacteria 2605
176 Ga0105242_10208843 3300009176 Bacteria 1739
177 Ga0105242_10606627 3300009176 Unclassified 1058
178 Ga0105248_10012893 3300009177 Bacteria 9217
179 Ga0105248_10036072 3300009177 Bacteria 5531
180 Ga0105237_10041851 3300009545 Bacteria 4620
181 Ga0105237_10078665 3300009545 Bacteria 3287
182 Ga0105238_10010886 3300009551 Bacteria 9141
183 Ga0105238_10025188 3300009551 Bacteria 6063
184 Ga0105238_10035612 3300009551 Bacteria 5060
185 Ga0105249_10016363 3300009553 Bacteria 6579
186 Ga0105249_10236418 3300009553 Unclassified 1804
187 Ga0105239_10036240 3300010375 Bacteria 5417
188 Ga0105239_10093620 3300010375 Bacteria 3318
189 Ga0105239_10171026 3300010375 Bacteria 2430
190 Ga0105246_10014794 3300011119 Bacteria 4914
191 Ga0157373_10020376 3300013100 Bacteria 4819
192 Ga0157373_10022617 3300013100 Bacteria 4560
193 Ga0157371_10170781 3300013102 Bacteria 1554
194 Ga0157370_10111685 3300013104 Unclassified 2555
195 Ga0157369_10001548 3300013105 Bacteria 28143
196 Ga0157369_10015766 3300013105 Bacteria 8516
197 Ga0157374_10020303 3300013296 Bacteria 5893
198 Ga0157374_10046338 3300013296 Bacteria 4026
199 Ga0157374_10110628 3300013296 Unclassified 2642
200 Ga0157374_10224550 3300013296 Bacteria 1844
201 Ga0157378_10017935 3300013297 Bacteria 6214
202 Ga0157378_10018295 3300013297 Bacteria 6151
203 Ga0157378_10125896 3300013297 Bacteria 2366
204 Ga0163162_10036320 3300013306 Bacteria 4910
205 Ga0163162_10043412 3300013306 Unclassified 4501
206 Ga0163162_10044216 3300013306 Bacteria 4460
207 Ga0163162_10047769 3300013306 Bacteria 4288
208 Ga0163162_10109349 3300013306 Bacteria 2861
209 Ga0163162_10301093 3300013306 Bacteria 1735
210 Ga0157372_10001560 3300013307 Bacteria 24952
211 Ga0157372_10012754 3300013307 Bacteria 8953
212 Ga0157372_10109174 3300013307 Bacteria 3168
213 Ga0157372_10259206 3300013307 Bacteria 2019
214 Ga0157375_10004375 3300013308 Bacteria 12267
215 Ga0157375_10407768 3300013308 Bacteria 1525
216 Ga0163163_10103928 3300014325 Unclassified 2865
217 Ga0163163_10121136 3300014325 Bacteria 2650
218 Ga0163163_10595713 3300014325 Bacteria 1168
219 Ga0157380_10001347 3300014326 Bacteria 15989
220 Ga0157380_10061155 3300014326 Bacteria 3012
221 Ga0157380_10657811 3300014326 Unclassified 1046
222 Ga0157379_10000472 3300014968 Bacteria 32703
223 Ga0157379_10023858 3300014968 Bacteria 5430
224 Ga0157379_10065097 3300014968 Bacteria 3258
225 Ga0157376_10059441 3300014969 Bacteria 3205
226 Ga0163161_10020497 3300017792 Bacteria 4639
227 Ga0163161_10031473 3300017792 Bacteria 3780
228 Ga0163161_10080092 3300017792 Bacteria 2403
229 Ga0213873_10027653 3300021358 Bacteria 1385
230 Ga0207697_10154250 3300025315 Bacteria 1000
231 Ga0207656_10057388 3300025321 Bacteria 1698
232 Ga0207653_10026697 3300025885 Unclassified 1852
233 Ga0207688_10002526 3300025901 Bacteria 9869
234 Ga0207680_10025866 3300025903 Bacteria 3243
235 Ga0207699_10011037 3300025906 Bacteria 4550
236 Ga0207645_10003260 3300025907 Bacteria 12388
237 Ga0207705_10019087 3300025909 Bacteria 4904
238 Ga0207707_10292246 3300025912 Bacteria 1410
239 Ga0207671_10248262 3300025914 Bacteria 1399
240 Ga0207693_10001820 3300025915 Bacteria 18703
241 Ga0207693_10003697 3300025915 Bacteria 13040
242 Ga0207662_10005783 3300025918 Bacteria 6618
243 Ga0207662_10044139 3300025918 Bacteria 2631
244 Ga0207657_10013949 3300025919 Bacteria 7861
245 Ga0207657_10166139 3300025919 Bacteria 1790
246 Ga0207657_10363705 3300025919 Bacteria 1140
247 Ga0207657_10373214 3300025919 Bacteria 1124
248 Ga0207649_10020086 3300025920 Bacteria 3825
249 Ga0207649_10031728 3300025920 Bacteria 3143
250 Ga0207681_10070315 3300025923 Bacteria 2437
251 Ga0207681_10412802 3300025923 Bacteria 1092
252 Ga0207681_10584414 3300025923 Unclassified 922
253 Ga0207700_10515326 3300025928 Bacteria 1059
254 Ga0207664_10258254 3300025929 Bacteria 1523
255 Ga0207644_10483345 3300025931 Bacteria 1020
256 Ga0207690_10003777 3300025932 Bacteria 8966
257 Ga0207690_10024464 3300025932 Bacteria 3783
258 Ga0207690_10060953 3300025932 Bacteria 2563
259 Ga0207706_10000377 3300025933 Bacteria 48494
260 Ga0207706_10019462 3300025933 Bacteria 6108
261 Ga0207706_10228257 3300025933 Bacteria 1629
262 Ga0207706_10289787 3300025933 Unclassified 1427
263 Ga0207686_10236139 3300025934 Bacteria 1328
264 Ga0207709_10029139 3300025935 Unclassified 3198
265 Ga0207704_10094841 3300025938 Bacteria 1971
266 Ga0207704_10249689 3300025938 Bacteria 1331
267 Ga0207704_10379788 3300025938 Unclassified 1109
268 Ga0207665_10044869 3300025939 Bacteria 2958
269 Ga0207691_10034804 3300025940 Bacteria 4680
270 Ga0207711_10056927 3300025941 Unclassified 3360
271 Ga0207711_10175884 3300025941 Bacteria 1944
272 Ga0207689_10000312 3300025942 Bacteria 44850
273 Ga0207689_10142503 3300025942 Bacteria 1975
274 Ga0207689_10320603 3300025942 Unclassified 1286
275 Ga0207661_10008518 3300025944 Bacteria 7330
276 Ga0207661_10051632 3300025944 Bacteria 3281
277 Ga0207679_10005600 3300025945 Bacteria 7873
278 Ga0207679_10136457 3300025945 Bacteria 1976
279 Ga0207679_10352510 3300025945 Bacteria 1283
280 Ga0207667_10261177 3300025949 Bacteria 1771
281 Ga0207712_10045585 3300025961 Bacteria 3037
282 Ga0207640_10039070 3300025981 Bacteria 3000
283 Ga0207658_10071432 3300025986 Bacteria 2628
284 Ga0207677_10200232 3300026023 Bacteria 1587
285 Ga0207703_10001235 3300026035 Bacteria 23932
286 Ga0207703_10062539 3300026035 Bacteria 3049
287 Ga0207703_10095626 3300026035 Unclassified 2506
288 Ga0207639_10007833 3300026041 Bacteria 7295
289 Ga0207639_10013417 3300026041 Bacteria 5736
290 Ga0207639_10025263 3300026041 Bacteria 4307
291 Ga0207639_10104507 3300026041 Bacteria 2296
292 Ga0207639_10111274 3300026041 Bacteria 2232
293 Ga0207639_10165954 3300026041 Bacteria 1865
294 Ga0207639_10243421 3300026041 Bacteria 1565
295 Ga0207678_10008603 3300026067 Bacteria 8993
296 Ga0207678_10009936 3300026067 Bacteria 8349
297 Ga0207708_10007484 3300026075 Bacteria 8072
298 Ga0207708_10107587 3300026075 Unclassified 2162
299 Ga0207708_10146217 3300026075 Unclassified 1858
300 Ga0207702_10016894 3300026078 Bacteria 6039
301 Ga0207641_10093519 3300026088 Bacteria 2635
302 Ga0207641_10173638 3300026088 Bacteria 1969
303 Ga0207676_10008839 3300026095 Bacteria 7167
304 Ga0207676_10082930 3300026095 Unclassified 2609
305 Ga0207676_10367668 3300026095 Bacteria 1335
306 Ga0207674_10008744 3300026116 Bacteria 11658
307 Ga0207674_10013293 3300026116 Bacteria 9143
308 Ga0207674_10022798 3300026116 Bacteria 6718
309 Ga0207674_10113514 3300026116 Bacteria 2682
310 Ga0207675_100000484 3300026118 Bacteria 38611
311 Ga0207675_100008017 3300026118 Bacteria 9952
312 Ga0207675_100012390 3300026118 Bacteria 7965
313 Ga0207683_10009017 3300026121 Bacteria 8499
314 Ga0207683_10013161 3300026121 Bacteria 7059
315 Ga0207698_10034468 3300026142 Bacteria 3690
316 Ga0207698_10047140 3300026142 Bacteria 3261
317 Ga0207698_10140735 3300026142 Bacteria 2078
318 Ga0207698_10409123 3300026142 Unclassified 1299
319 Ga0209966_1006771 3300027695 Bacteria 1997
320 Ga0207428_10183755 3300027907 Bacteria 1578
321 Ga0268266_10260769 3300028379 Bacteria 1606
322 Ga0268266_10342882 3300028379 Bacteria 1403
323 Ga0268265_10042735 3300028380 Bacteria 3365
324 Ga0268264_10001405 3300028381 Bacteria 22506
325 Ga0268264_10236111 3300028381 Bacteria 1691
326 Ga0268264_10448666 3300028381 Bacteria 1249
327 Ga0265338_10041179 3300028800 Bacteria 4325
328 Ga0265339_10032351 3300031249 Bacteria 2951
329 Ga0307409_100492666 3300031995 Bacteria 1192
330 Ga0307416_100066254 3300032002 Bacteria 2973
331 Ga0307414_10297922 3300032004 Bacteria 1363
332 Ga0373930_0039381 3300034816 Bacteria 1002
333 Ga0373929_0001050 3300035085 Bacteria 5355
334 Ga0373940_0030325 3300035088 Bacteria 1438
335 Ga0373932_0029985 3300035112 Bacteria 1505
336 Ga0373946_0180613 3300035171 Bacteria 1001
337 Ga0373955_0084306 3300035172 Bacteria 1802
338 Ga0373942_0013534 3300035207 Unclassified 1964
339 Ga0373924_0196896 3300035410 Bacteria 888
340 Ga0373931_0004648 3300035691 Bacteria 6280
341 Ga0373931_0038303 3300035691 Bacteria 2507
342 Ga0373927_0062049 3300035695 Bacteria 2417
343 Ga0400485_13147 3300038735 Bacteria 19957
344 Ga0400483_016688 3300039062 Bacteria 2261
345 Ga0400483_108521 3300039062 Bacteria 1278
346 Ga0400483_153896 3300039062 Bacteria 1594
347 Ga0400483_221044 3300039062 Bacteria 2783
348 Ga0400483_286613 3300039062 Bacteria 4781
349 Ga0436365_0230951 3300039437 Bacteria 1750
350 Ga0436360_0586828 3300039438 Bacteria 1143
351 Ga0436360_0674185 3300039438 Bacteria 2914
352 Ga0436363_0318782 3300039450 Bacteria 1767
353 Ga0436362_0035434 3300039453 Unclassified 1956
354 Ga0451577_0092750 3300042876 Unclassified 2696
355 Ga0451577_0435219 3300042876 Bacteria 1191
356 Ga0466961_0050033 3300044693 Bacteria 2670
357 Ga0466963_0413342 3300044694 Unclassified 951
358 Ga0466959_0001350 3300045049 Bacteria 14956
359 Ga0466959_0071402 3300045049 Bacteria 2514
360 Ga0451576_0003354 3300045051 Bacteria 22184
361 Ga0466967_0026739 3300045976 Bacteria 4786
362 Ga0466967_0306018 3300045976 Bacteria 1530
363 Ga0495639_0086272 3300046475 Bacteria 1468
364 Ga0495630_0090652 3300046517 Bacteria 2310
365 Ga0495588_0001153 3300046674 Bacteria 11357
366 Ga0495684_0392203 3300047471 Bacteria 977
367 Ga0496100_0085099 3300048903 Unclassified 2145
368 Ga0496102_0044019 3300048905 Bacteria 4049
369 Ga0496102_0108988 3300048905 Bacteria 2580
370 Ga0496102_0146449 3300048905 Bacteria 2217
371 Ga0496103_0195315 3300048906 Bacteria 1301
372 Ga0496104_0076057 3300048907 Unclassified 3197
373 Ga0496105_0245296 3300048908 Bacteria 1452
374 Ga0496106_0075021 3300048909 Bacteria 2590
375 Ga0496107_0019036 3300048910 Bacteria 4842
376 Ga0496107_0019816 3300048910 Bacteria 4749
377 Ga0496107_0601701 3300048910 Bacteria 812
378 Ga0496108_0023224 3300048911 Bacteria 5102
379 Ga0496108_0030051 3300048911 Bacteria 4503
380 Ga0496108_0161507 3300048911 Unclassified 1937
381 Ga0496109_0252313 3300048912 Unclassified 1661
382 Ga0496110_0016457 3300048913 Bacteria 6175
383 Ga0496110_0197704 3300048913 Bacteria 1826
384 Ga0496111_0041813 3300048914 Bacteria 3290
385 Ga0496111_0204523 3300048914 Bacteria 1467
386 Ga0496112_0211352 3300048915 Bacteria 1897
387 Ga0496113_0065490 3300048916 Unclassified 2750
388 Ga0496114_0063316 3300048917 Bacteria 3096
389 Ga0496114_0286398 3300048917 Bacteria 1453
390 Ga0496115_0051561 3300048918 Bacteria 3299
391 Ga0496115_0548204 3300048918 Bacteria 924
392 Ga0501047_0080283 3300049581 Bacteria 3135
393 Ga0501206_001328 3300049653 Bacteria 3089
394 Ga0501242_000180 3300049674 Bacteria 4864
395 nmdc:mga0k408_255165_c1 3300050493 Bacteria 1047
396 nmdc:mga0qj67_61425_c1 3300050509 Bacteria 2983
397 nmdc:mga08y16_12489_c1 3300050511 Bacteria 8935
398 nmdc:mga08y16_271932_c1 3300050511 Bacteria 1749
399 nmdc:mga08y16_349764_c1 3300050511 Bacteria 1518
400 nmdc:mga08y16_47953_c1 3300050511 Bacteria 4471
401 nmdc:mga08y16_93063_c1 3300050511 Bacteria 3141
402 nmdc:mga0n895_286086_c1 3300050512 Bacteria 1671
403 nmdc:mga0n895_516695_c1 3300050512 Bacteria 1202
404 nmdc:mga0rr50_54015_c1 3300050513 Unclassified 2991
405 nmdc:mga0a205_37784_c1 3300050515 Unclassified 4643
406 Ga0500658_0179888 3300053134 Bacteria 962
407 Ga0500568_0000192 3300053139 Bacteria 53173
408 Ga0500568_0008098 3300053139 Bacteria 5099
409 Ga0500568_0050497 3300053139 Bacteria 1639
410 Ga0500616_0058136 3300053153 Bacteria 2013
411 Ga0501082_0673086 3300060353 Bacteria 906
412 Ga0400483_149878
413 MBSR1b_contig_10253296
414 MBSR1b_contig_3501100
415 rootH1_10119931
416 rootH2_10183369
417 rootL2_10121888
418 Ga0065704_10002775
419 Ga0065712_10069712
420 Ga0065707_10094948
421 Ga0070658_10025588
422 Ga0070676_10017893
423 Ga0070683_100019877
424 Ga0070683_100035608
425 Ga0070690_100001903
426 Ga0070690_100174194
427 Ga0070690_100188395
428 Ga0070670_100186962
429 Ga0068869_100003671
430 Ga0068869_100157078
431 Ga0068869_100336264
432 Ga0068869_100558821
433 Ga0070666_10029737
434 Ga0070666_10066425
435 Ga0070680_100246900
436 Ga0070682_100000221
437 Ga0068868_100028224
438 Ga0068868_100039565
439 Ga0068868_100115156
440 Ga0068868_100251844
441 Ga0070660_100075062
442 Ga0070660_100156626
443 Ga0070660_100302018
444 Ga0070660_100421184
445 Ga0070687_100013941
446 Ga0070687_100031058
447 Ga0070687_100048465
448 Ga0070661_100004565
449 Ga0070661_100033918
450 Ga0070661_100380352
451 Ga0070692_10043827
452 Ga0070668_100022513
453 Ga0070668_100055380
454 Ga0070669_100069399
455 Ga0070675_100005265
456 Ga0070671_100027926
457 Ga0070671_100180402
458 Ga0070674_100243481
459 Ga0070673_100086140
460 Ga0070673_100469947
461 Ga0070688_100095461
462 Ga0070659_100005256
463 Ga0070659_100011123
464 Ga0070659_100035021
465 Ga0070659_100057789
466 Ga0070659_100091252
467 Ga0070667_100055203
468 Ga0070667_100098940
469 Ga0070709_10088670
470 Ga0070713_100176766
471 Ga0070710_10119321
472 Ga0070710_10142062
473 Ga0070705_100053302
474 Ga0070700_100066397
475 Ga0070700_100071019
476 Ga0070700_100100484
477 Ga0070694_100060227
478 Ga0070708_100094926
479 Ga0070663_100319746
480 Ga0070678_100041201
481 Ga0070678_100091511
482 Ga0070678_100454148
483 Ga0070662_100003539
484 Ga0070662_100010638
485 Ga0070685_10120824
486 Ga0070707_100010371
487 Ga0070707_100069198
488 Ga0070707_100194031
489 Ga0070698_100003977
490 Ga0070684_100005114
491 Ga0070684_100029622
492 Ga0070684_100106960
493 Ga0070684_100225054
494 Ga0068853_100006126
495 Ga0068853_100028618
496 Ga0068853_100029427
497 Ga0068853_100052131
498 Ga0068853_100111500
499 Ga0070672_100155743
500 Ga0070686_100090016
501 Ga0070696_100157187
502 Ga0070696_100190339
503 Ga0070693_100039879
504 Ga0070665_100264743
505 Ga0070665_100634761
506 Ga0070704_100044391
507 Ga0068855_100037650
508 Ga0068855_100095602
509 Ga0068855_100529306
510 Ga0070664_100006880
511 Ga0070664_100017488
512 Ga0070664_100192844
513 Ga0070664_100216885
514 Ga0070664_100322674
515 Ga0068857_100007975
516 Ga0068857_100016580
517 Ga0068857_100161267
518 Ga0068854_100054841
519 Ga0068854_100221001
520 Ga0068856_100012231
521 Ga0068856_100031548
522 Ga0068856_100500576
523 Ga0070702_100043561
524 Ga0068852_100010624
525 Ga0068852_100021428
526 Ga0068852_100025360
527 Ga0068852_100074873
528 Ga0068859_100052048
529 Ga0068859_100451094
530 Ga0068859_100639928
531 Ga0068859_100825774
532 Ga0068864_100006793
533 Ga0068866_10250825
534 Ga0068861_100007176
535 Ga0068861_100011217
536 Ga0068870_10086915
537 Ga0068863_100136707
538 Ga0068863_100267680
539 Ga0068858_100002040
540 Ga0068858_100261936
541 Ga0068858_100333304
542 Ga0068860_100004952
543 Ga0068860_100052207
544 Ga0068860_100059963
545 Ga0068860_100115176
546 Ga0068860_100475827
547 Ga0068862_100106858
548 Ga0081455_10011493
549 Ga0081455_10056286
550 Ga0081455_10143813
551 Ga0081540_1000899
552 Ga0070717_10022906
553 Ga0075364_10202644
554 Ga0070715_10000030
555 Ga0070716_100025959
556 Ga0070716_100234664
557 Ga0070712_100066694
558 Ga0070712_100183718
559 Ga0097621_100056484
560 Ga0097621_100069819
561 Ga0097621_100104443
562 Ga0097621_100188646
563 Ga0068871_100177442
564 Ga0068871_100379523
565 Ga0075431_100288188
566 Ga0075434_100145472
567 Ga0068865_100095287
568 Ga0068865_100225521
569 Ga0068865_100462466
570 Ga0075436_100442258
571 Ga0097620_100052048
572 Ga0097620_100451052
573 Ga0097620_100639901
574 Ga0097620_100825820
575 Ga0075435_100036635
576 Ga0105240_10019768
577 Ga0105240_10057584
578 Ga0111539_10035936
579 Ga0111539_10052921
580 Ga0111539_10288857
581 Ga0105245_10080314
582 Ga0105245_10509421
583 Ga0105243_10092609
584 Ga0105241_10034259
585 Ga0105242_10028509
586 Ga0105242_10088216
587 Ga0105242_10208843
588 Ga0105242_10606627
589 Ga0105248_10012893
590 Ga0105248_10036072
591 Ga0105237_10041851
592 Ga0105237_10078665
593 Ga0105238_10010886
594 Ga0105238_10025188
595 Ga0105238_10035612
596 Ga0105249_10016363
597 Ga0105249_10236418
598 Ga0105239_10036240
599 Ga0105239_10093620
600 Ga0105239_10171026
601 Ga0105246_10014794
602 Ga0157373_10020376
603 Ga0157373_10022617
604 Ga0157371_10170781
605 Ga0157370_10111685
606 Ga0157369_10001548
607 Ga0157369_10015766
608 Ga0157374_10020303
609 Ga0157374_10046338
610 Ga0157374_10110628
611 Ga0157374_10224550
612 Ga0157378_10017935
613 Ga0157378_10018295
614 Ga0157378_10125896
615 Ga0163162_10036320
616 Ga0163162_10043412
617 Ga0163162_10044216
618 Ga0163162_10047769
619 Ga0163162_10109349
620 Ga0163162_10301093
621 Ga0157372_10001560
622 Ga0157372_10012754
623 Ga0157372_10109174
624 Ga0157372_10259206
625 Ga0157375_10004375
626 Ga0157375_10407768
627 Ga0163163_10103928
628 Ga0163163_10121136
629 Ga0163163_10595713
630 Ga0157380_10001347
631 Ga0157380_10061155
632 Ga0157380_10657811
633 Ga0157379_10000472
634 Ga0157379_10023858
635 Ga0157379_10065097
636 Ga0157376_10059441
637 Ga0163161_10020497
638 Ga0163161_10031473
639 Ga0163161_10080092
640 Ga0213873_10027653
641 Ga0207697_10154250
642 Ga0207656_10057388
643 Ga0207653_10026697
644 Ga0207688_10002526
645 Ga0207680_10025866
646 Ga0207699_10011037
647 Ga0207645_10003260
648 Ga0207705_10019087
649 Ga0207707_10292246
650 Ga0207671_10248262
651 Ga0207693_10001820
652 Ga0207693_10003697
653 Ga0207662_10005783
654 Ga0207662_10044139
655 Ga0207657_10013949
656 Ga0207657_10166139
657 Ga0207657_10363705
658 Ga0207657_10373214
659 Ga0207649_10020086
660 Ga0207649_10031728
661 Ga0207681_10070315
662 Ga0207681_10412802
663 Ga0207681_10584414
664 Ga0207700_10515326
665 Ga0207664_10258254
666 Ga0207644_10483345
667 Ga0207690_10003777
668 Ga0207690_10024464
669 Ga0207690_10060953
670 Ga0207706_10000377
671 Ga0207706_10019462
672 Ga0207706_10228257
673 Ga0207706_10289787
674 Ga0207686_10236139
675 Ga0207709_10029139
676 Ga0207704_10094841
677 Ga0207704_10249689
678 Ga0207704_10379788
679 Ga0207665_10044869
680 Ga0207691_10034804
681 Ga0207711_10056927
682 Ga0207711_10175884
683 Ga0207689_10000312
684 Ga0207689_10142503
685 Ga0207689_10320603
686 Ga0207661_10008518
687 Ga0207661_10051632
688 Ga0207679_10005600
689 Ga0207679_10136457
690 Ga0207679_10352510
691 Ga0207667_10261177
692 Ga0207712_10045585
693 Ga0207640_10039070
694 Ga0207658_10071432
695 Ga0207677_10200232
696 Ga0207703_10001235
697 Ga0207703_10062539
698 Ga0207703_10095626
699 Ga0207639_10007833
700 Ga0207639_10013417
701 Ga0207639_10025263
702 Ga0207639_10104507
703 Ga0207639_10111274
704 Ga0207639_10165954
705 Ga0207639_10243421
706 Ga0207678_10008603
707 Ga0207678_10009936
708 Ga0207708_10007484
709 Ga0207708_10107587
710 Ga0207708_10146217
711 Ga0207702_10016894
712 Ga0207641_10093519
713 Ga0207641_10173638
714 Ga0207676_10008839
715 Ga0207676_10082930
716 Ga0207676_10367668
717 Ga0207674_10008744
718 Ga0207674_10013293
719 Ga0207674_10022798
720 Ga0207674_10113514
721 Ga0207675_100000484
722 Ga0207675_100008017
723 Ga0207675_100012390
724 Ga0207683_10009017
725 Ga0207683_10013161
726 Ga0207698_10034468
727 Ga0207698_10047140
728 Ga0207698_10140735
729 Ga0207698_10409123
730 Ga0209966_1006771
731 Ga0207428_10183755
732 Ga0268266_10260769
733 Ga0268266_10342882
734 Ga0268265_10042735
735 Ga0268264_10001405
736 Ga0268264_10236111
737 Ga0268264_10448666
738 Ga0265338_10041179
739 Ga0265339_10032351
740 Ga0307409_100492666
741 Ga0307416_100066254
742 Ga0307414_10297922
743 Ga0373930_0039381
744 Ga0373929_0001050
745 Ga0373940_0030325
746 Ga0373932_0029985
747 Ga0373946_0180613
748 Ga0373955_0084306
749 Ga0373942_0013534
750 Ga0373924_0196896
751 Ga0373931_0004648
752 Ga0373931_0038303
753 Ga0373927_0062049
754 Ga0400485_13147
755 Ga0400483_016688
756 Ga0400483_108521
757 Ga0400483_153896
758 Ga0400483_221044
759 Ga0400483_286613
760 Ga0436365_0230951
761 Ga0436360_0586828
762 Ga0436360_0674185
763 Ga0436363_0318782
764 Ga0436362_0035434
765 Ga0451577_0092750
766 Ga0451577_0435219
767 Ga0466961_0050033
768 Ga0466963_0413342
769 Ga0466959_0001350
770 Ga0466959_0071402
771 Ga0451576_0003354
772 Ga0466967_0026739
773 Ga0466967_0306018
774 Ga0495639_0086272
775 Ga0495630_0090652
776 Ga0495588_0001153
777 Ga0495684_0392203
778 Ga0496100_0085099
779 Ga0496102_0044019
780 Ga0496102_0108988
781 Ga0496102_0146449
782 Ga0496103_0195315
783 Ga0496104_0076057
784 Ga0496105_0245296
785 Ga0496106_0075021
786 Ga0496107_0019036
787 Ga0496107_0019816
788 Ga0496107_0601701
789 Ga0496108_0023224
790 Ga0496108_0030051
791 Ga0496108_0161507
792 Ga0496109_0252313
793 Ga0496110_0016457
794 Ga0496110_0197704
795 Ga0496111_0041813
796 Ga0496111_0204523
797 Ga0496112_0211352
798 Ga0496113_0065490
799 Ga0496114_0063316
800 Ga0496114_0286398
801 Ga0496115_0051561
802 Ga0496115_0548204
803 Ga0501047_0080283
804 Ga0501206_001328
805 Ga0501242_000180
806 nmdc:mga0k408_255165_c1
807 nmdc:mga0qj67_61425_c1
808 nmdc:mga08y16_12489_c1
809 nmdc:mga08y16_271932_c1
810 nmdc:mga08y16_349764_c1
811 nmdc:mga08y16_47953_c1
812 nmdc:mga08y16_93063_c1
813 nmdc:mga0n895_286086_c1
814 nmdc:mga0n895_516695_c1
815 nmdc:mga0rr50_54015_c1
816 nmdc:mga0a205_37784_c1
817 Ga0500658_0179888
818 Ga0500568_0000192
819 Ga0500568_0008098
820 Ga0500568_0050497
821 Ga0500616_0058136
822 Ga0501082_0673086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01367

5_3_exonuc

5'-3' exonuclease, C-terminal SAM fold

208

309

0.9

PF02739

5_3_exonuc_N

5'-3' exonuclease, N-terminal resolvase-like domain

44

207

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zde-assembly1.cif.gz_A potassium free structure of e. coli exoix 0.8288 2 244
3zd9-assembly1.cif.gz_A potassium bound structure of e. coli exoix in p21 0.8283 2 244
3zdc-assembly1.cif.gz_A structure of e. coli exoix in complex with the palindromic 5ov4 dna oligonucleotide, potassium and calcium 0.8225 3 243
3zda-assembly1.cif.gz_A structure of e. coli exoix in complex with a fragment of the flap1 dna oligonucleotide, potassium and magnesium 0.8208 1 244
3zdd-assembly1.cif.gz_A-2 structure of e. coli exoix in complex with the palindromic 5ov6 oligonucleotide and potassium 0.8193 1 244
ID Description Score Start End Superfamily
af_A8MQG8_313_403_1.10.150.20 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.887 171 234 1.10.150.20
af_P00582_2_172_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8773 3 165 3.40.50.1010
af_Q8I7W9_262_459_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8509 2 164 3.40.50.1010
af_Q2FXN9_173_262_1.10.150.20 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.8503 167 243 1.10.150.20
3zd8A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.8467 167 242 1.10.150.20
ID Description Score Start End GO Terms
AF-A0A534B823-F1-model_v4 Flap endonuclease 0.9903 42 270 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A7W1AN55-F1-model_v4 Flap endonuclease 0.9863 28 276 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A2V7VRU1-F1-model_v4 Flap endonuclease 0.9858 1 272 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A534DP25-F1-model_v4 deleted 0.9854 1 272
AF-A0A1P8FMY8-F1-model_v4 Flap endonuclease 0.9848 1 275 GO:0003677
GO:0008409
GO:0017108
GO:0033567

Map