F437580

General Info

Members Datasets Scaffolds Average Seq Length
411 255 822 173

Family's Representative Sequence

Representative Sequence 3300041404|Ga0439436_0004836|Ga0439436_0004836_2653_3258
Length 201
Sequence LRWHEAAANGADLLFFSPQPRLRHMTAERDFIPLRLCVLTVSDSRTLAEDSSGDYLVQSLSEAGHRLAERRLLPDDRYRLRAAVSQWIADPEIDGVLVTGGTGFTGRDSTPEALLPLLDKEMPGFGELFRSLSFEEIGTSTLQSRAFAGLANATFVFCLPGSTSACRTAWEKIIRAQLDARTRPCNLATLRPRLLEPTHKE

Samples

Sample ID Description Type Environment
1 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
43 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
46 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
50 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
56 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
57 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
58 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
59 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
99 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
100 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
101 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
122 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
123 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
124 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
125 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
126 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
127 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
128 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
129 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
130 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
131 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
132 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
133 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
134 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
135 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
138 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
139 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
140 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
141 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
142 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
143 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
144 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
145 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
146 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
157 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
166 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
188 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
207 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
208 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
209 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
213 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
214 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
215 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
221 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
222 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
223 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
226 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
227 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
228 2643221559 Lysobacter sp. Root559 Isolate Unclassified
229 2643221573 Lysobacter sp. Root604 Isolate Unclassified
230 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
231 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
232 2643221586 Lysobacter sp. Root667 Isolate Unclassified
233 2643221593 Lysobacter sp. Root690 Isolate Unclassified
234 2643221612 Lysobacter sp. Root76 Isolate Unclassified
235 2643221720 Lysobacter sp. Root916 Isolate Unclassified
236 2643221727 Lysobacter sp. Root96 Isolate Unclassified
237 2643221728 Lysobacter sp. Root983 Isolate Unclassified
238 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
239 2818991457 Xanthomonas translucens 569 Isolate Unclassified
240 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
241 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
242 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
243 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
244 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
245 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
246 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
247 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
248 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
249 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
250 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
251 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
252 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
253 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
254 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
255 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.46
Metatranscriptomes 0
Isolates 7.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.65
Nodule 0
Rhizoplane 6.33
Rhizosphere 60.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439436_0004836 3300041404 Bacteria 4133
2 SwRhRL2b_contig_3845428 2162886007 Bacteria 2488
3 SwRhRL2b_contig_440373 2162886007 Bacteria 2225
4 JGI25152J39213_1000480 3300002773 Bacteria 22834
5 JGI25150J39212_1000356 3300002774 Bacteria 22473
6 JGI25150J39212_1029777 3300002774 Bacteria 763
7 JGI25151J46595_10000676 3300003187 Bacteria 28829
8 JGI25151J46595_10000924 3300003187 Bacteria 22834
9 JGI25151J46595_10015338 3300003187 Bacteria 3380
10 JGI25151J46595_10029237 3300003187 Bacteria 2184
11 JGI25153J46596_10000050 3300003215 Bacteria 140710
12 Ga0055526_1000124 3300003771 Bacteria 68139
13 Ga0055526_1056417 3300003771 Bacteria 860
14 Ga0055526_1071251 3300003771 Bacteria 704
15 Ga0055537_1000351 3300003773 Bacteria 31332
16 Ga0055524_1000188 3300003775 Bacteria 68244
17 Ga0055524_1003485 3300003775 Bacteria 7626
18 Ga0055524_1010063 3300003775 Bacteria 3792
19 Ga0055524_1057554 3300003775 Bacteria 829
20 Ga0055536_1002108 3300003781 Bacteria 11321
21 Ga0055536_1003924 3300003781 Bacteria 7799
22 Ga0055536_1011849 3300003781 Bacteria 3293
23 Ga0055536_1022616 3300003781 Bacteria 1871
24 Ga0055534_1000108 3300003784 Bacteria 61496
25 Ga0055534_1041576 3300003784 Bacteria 675
26 Ga0055528_1000102 3300003790 Bacteria 68139
27 Ga0055530_10014200 3300003791 Bacteria 2666
28 Ga0055531_10002096 3300003794 Bacteria 13693
29 Ga0055531_10002569 3300003794 Bacteria 12052
30 Ga0055531_10011069 3300003794 Bacteria 4402
31 Ga0055531_10013553 3300003794 Bacteria 3749
32 Ga0055531_10027918 3300003794 Bacteria 1962
33 Ga0055531_10054827 3300003794 Bacteria 1019
34 Ga0058692_1000032 3300003856 Bacteria 179581
35 Ga0065714_10115774 3300005288 Bacteria 1411
36 Ga0065704_10071251 3300005289 Bacteria 12240
37 Ga0065704_10078342 3300005289 Bacteria 4460
38 Ga0070676_10221254 3300005328 Bacteria 1250
39 Ga0070670_100005259 3300005331 Bacteria 10902
40 Ga0068868_100106169 3300005338 Bacteria 2278
41 Ga0070669_100052094 3300005353 Bacteria 2993
42 Ga0070671_100028673 3300005355 Bacteria 4586
43 Ga0070671_100080063 3300005355 Bacteria 2731
44 Ga0070674_100016109 3300005356 Bacteria 4683
45 Ga0070673_100135673 3300005364 Bacteria 2071
46 Ga0070673_100238013 3300005364 Bacteria 1582
47 Ga0070667_100277547 3300005367 Bacteria 1504
48 Ga0070667_100923225 3300005367 Bacteria 813
49 Ga0068867_100096762 3300005459 Bacteria 2248
50 Ga0068853_100156106 3300005539 Bacteria 2056
51 Ga0070672_100000577 3300005543 Bacteria 21558
52 Ga0070672_100146893 3300005543 Bacteria 1948
53 Ga0070665_101168218 3300005548 Bacteria 781
54 Ga0068855_101071856 3300005563 Bacteria 844
55 Ga0068864_100864186 3300005618 Bacteria 892
56 Ga0068862_100071796 3300005844 Bacteria 2989
57 Ga0075365_10514028 3300006038 Bacteria 847
58 Ga0075364_10000625 3300006051 Bacteria 18201
59 Ga0075364_10134033 3300006051 Bacteria 1664
60 Ga0075362_10288022 3300006177 Bacteria 813
61 Ga0075366_10446475 3300006195 Bacteria 798
62 Ga0105251_10002229 3300009011 Bacteria 15465
63 Ga0105240_10029288 3300009093 Bacteria 7177
64 Ga0105243_10023660 3300009148 Bacteria 4681
65 Ga0105243_10505914 3300009148 Bacteria 1146
66 Ga0105248_10910761 3300009177 Bacteria 993
67 Ga0105237_10340468 3300009545 Bacteria 1504
68 Ga0105030_107673 3300009987 Bacteria 916
69 Ga0105035_120238 3300009988 Bacteria 631
70 Ga0105246_10086626 3300011119 Bacteria 2246
71 Ga0157318_1000915 3300012482 Bacteria 1386
72 Ga0157345_1017862 3300012498 Bacteria 695
73 Ga0157371_10920085 3300013102 Bacteria 664
74 Ga0157374_10258525 3300013296 Bacteria 1715
75 Ga0157514_112427 3300013874 Bacteria 916
76 Ga0157515_133431 3300013875 Bacteria 631
77 Ga0163163_10933929 3300014325 Bacteria 931
78 Ga0157380_10186658 3300014326 Bacteria 1827
79 Ga0182008_10103090 3300014497 Bacteria 1411
80 Ga0157376_11671538 3300014969 Bacteria 672
81 Ga0182005_1008030 3300015265 Bacteria 3131
82 Ga0183360_10001 3300015689 Bacteria 3943671
83 Ga0207425_1000117 3300025245 Bacteria 74911
84 Ga0207425_1006385 3300025245 Bacteria 3230
85 Ga0209129_1000011 3300025258 Bacteria 568657
86 Ga0209565_1000001 3300025263 Bacteria 2950419
87 Ga0209673_1000001 3300025273 Bacteria 3176258
88 Ga0209673_1005553 3300025273 Bacteria 6309
89 Ga0209673_1060509 3300025273 Bacteria 949
90 Ga0209673_1063010 3300025273 Bacteria 916
91 Ga0209130_1006144 3300025284 Bacteria 3963
92 Ga0209675_1000001 3300025291 Bacteria 2950293
93 Ga0209675_1010658 3300025291 Bacteria 3116
94 Ga0209675_1016501 3300025291 Bacteria 2147
95 Ga0209676_1000436 3300025292 Bacteria 72143
96 Ga0209676_1001557 3300025292 Bacteria 20542
97 Ga0209676_1001981 3300025292 Bacteria 16305
98 Ga0209676_1002305 3300025292 Bacteria 13899
99 Ga0209676_1002769 3300025292 Bacteria 11711
100 Ga0209676_1004360 3300025292 Bacteria 7921
101 Ga0209676_1005388 3300025292 Bacteria 6712
102 Ga0209676_1006571 3300025292 Bacteria 5699
103 Ga0209025_1000002 3300025294 Bacteria 1393142
104 Ga0209025_1000006 3300025294 Bacteria 1153444
105 Ga0209025_1000564 3300025294 Bacteria 67936
106 Ga0209025_1019266 3300025294 Bacteria 3802
107 Ga0209025_1137077 3300025294 Bacteria 700
108 Ga0209564_1000001 3300025295 Bacteria 3176258
109 Ga0209564_1047968 3300025295 Bacteria 1071
110 Ga0209564_1047969 3300025295 Bacteria 1071
111 Ga0209758_1000003 3300025297 Bacteria 1398533
112 Ga0209758_1040999 3300025297 Bacteria 1738
113 Ga0209758_1062907 3300025297 Bacteria 1212
114 Ga0209050_1005567 3300025298 Bacteria 7836
115 Ga0209050_1007405 3300025298 Bacteria 6165
116 Ga0209050_1057507 3300025298 Bacteria 940
117 Ga0209256_1000006 3300025299 Bacteria 1250310
118 Ga0209256_1002374 3300025299 Bacteria 15525
119 Ga0209256_1002733 3300025299 Bacteria 13643
120 Ga0209256_1025187 3300025299 Bacteria 1738
121 Ga0209051_1020202 3300025303 Bacteria 2877
122 Ga0209257_1000343 3300025304 Bacteria 96876
123 Ga0209257_1000567 3300025304 Bacteria 62634
124 Ga0209257_1000738 3300025304 Bacteria 49567
125 Ga0209257_1000788 3300025304 Bacteria 46352
126 Ga0209257_1002327 3300025304 Bacteria 19162
127 Ga0209257_1004934 3300025304 Bacteria 9799
128 Ga0209257_1006402 3300025304 Bacteria 7604
129 Ga0207713_1000294 3300025735 Bacteria 57476
130 Ga0207680_10394770 3300025903 Bacteria 977
131 Ga0207645_10184833 3300025907 Bacteria 1368
132 Ga0207695_10010702 3300025913 Bacteria 11200
133 Ga0207650_10013553 3300025925 Bacteria 5648
134 Ga0207650_10072802 3300025925 Bacteria 2587
135 Ga0207650_10613707 3300025925 Bacteria 915
136 Ga0207650_10646909 3300025925 Bacteria 891
137 Ga0207644_10133320 3300025931 Bacteria 1904
138 Ga0207644_10261962 3300025931 Bacteria 1383
139 Ga0207644_10378913 3300025931 Bacteria 1153
140 Ga0207709_10394515 3300025935 Bacteria 1056
141 Ga0207670_10226561 3300025936 Bacteria 1434
142 Ga0207691_10008799 3300025940 Bacteria 9681
143 Ga0207661_10118219 3300025944 Bacteria 2253
144 Ga0207668_10037422 3300025972 Bacteria 3247
145 Ga0207677_10132843 3300026023 Bacteria 1893
146 Ga0207708_10968656 3300026075 Bacteria 738
147 Ga0207676_10609300 3300026095 Bacteria 1050
148 Ga0207683_10093680 3300026121 Bacteria 2677
149 Ga0209371_1000055 3300027312 Bacteria 257599
150 Ga0209967_1032709 3300027364 Bacteria 780
151 Ga0209984_1029591 3300027424 Bacteria 772
152 Ga0209995_1016608 3300027471 Bacteria 1210
153 Ga0209999_1022095 3300027543 Bacteria 1170
154 Ga0209982_1008033 3300027552 Bacteria 1544
155 Ga0209970_1001244 3300027614 Bacteria 4502
156 Ga0210002_1052901 3300027617 Bacteria 701
157 Ga0209983_1005407 3300027665 Bacteria 2647
158 Ga0209971_1005688 3300027682 Bacteria 2956
159 Ga0268266_10837479 3300028379 Bacteria 889
160 Ga0268266_10929040 3300028379 Bacteria 842
161 Ga0268265_10044957 3300028380 Bacteria 3292
162 Ga0268256_1000054 3300030500 Bacteria 257599
163 Ga0316177_1019888 3300030731 Bacteria 3467
164 Ga0314311_1002365 3300030733 Bacteria 2551
165 Ga0316182_1085314 3300030745 Bacteria 3184
166 Ga0307513_10003461 3300031456 Bacteria 21352
167 Ga0307513_10138265 3300031456 Bacteria 2367
168 Ga0307408_100043501 3300031548 Bacteria 3196
169 Ga0307408_100097636 3300031548 Bacteria 2232
170 Ga0307408_100561274 3300031548 Bacteria 1009
171 Ga0307516_10093454 3300031730 Bacteria 2833
172 Ga0307516_10315010 3300031730 Bacteria 1237
173 Ga0307405_10296419 3300031731 Bacteria 1224
174 Ga0307413_10006589 3300031824 Bacteria 5319
175 Ga0307413_10043280 3300031824 Bacteria 2653
176 Ga0307413_10155336 3300031824 Bacteria 1600
177 Ga0307413_10447161 3300031824 Bacteria 1025
178 Ga0307410_10112774 3300031852 Bacteria 1970
179 Ga0307410_10455284 3300031852 Bacteria 1045
180 Ga0307406_10011312 3300031901 Bacteria 5062
181 Ga0307406_10013777 3300031901 Bacteria 4638
182 Ga0307406_10200612 3300031901 Bacteria 1468
183 Ga0307407_10080993 3300031903 Bacteria 1963
184 Ga0307407_10441542 3300031903 Bacteria 942
185 Ga0307412_10034205 3300031911 Bacteria 3238
186 Ga0307412_10161731 3300031911 Bacteria 1664
187 Ga0307412_10690818 3300031911 Bacteria 875
188 Ga0307412_10806268 3300031911 Bacteria 815
189 Ga0307412_11051951 3300031911 Bacteria 722
190 Ga0307409_100030243 3300031995 Bacteria 3888
191 Ga0307409_100385983 3300031995 Bacteria 1333
192 Ga0307409_100690608 3300031995 Bacteria 1019
193 Ga0307416_100055265 3300032002 Bacteria 3196
194 Ga0307416_100090621 3300032002 Bacteria 2623
195 Ga0307414_10002922 3300032004 Bacteria 9035
196 Ga0307414_10090827 3300032004 Bacteria 2268
197 Ga0307414_10136927 3300032004 Bacteria 1911
198 Ga0307414_10272551 3300032004 Bacteria 1418
199 Ga0307414_10747110 3300032004 Bacteria 889
200 Ga0307414_10776771 3300032004 Bacteria 872
201 Ga0307414_10887301 3300032004 Bacteria 817
202 Ga0307414_11071096 3300032004 Bacteria 744
203 Ga0307411_10095683 3300032005 Bacteria 2086
204 Ga0307411_10168536 3300032005 Bacteria 1649
205 Ga0307411_10614693 3300032005 Bacteria 936
206 Ga0307415_100490020 3300032126 Bacteria 1072
207 Ga0307415_100534800 3300032126 Bacteria 1031
208 Ga0307415_100548011 3300032126 Bacteria 1020
209 Ga0307415_101156192 3300032126 Bacteria 727
210 Ga0395899_0022853 3300037312 Bacteria 4738
211 Ga0395900_0028616 3300037418 Bacteria 5711
212 Ga0395898_0058673 3300037466 Bacteria 3746
213 Ga0395905_0002340 3300037471 Bacteria 21136
214 Ga0395905_0075886 3300037471 Bacteria 3150
215 Ga0395905_0118577 3300037471 Bacteria 2487
216 Ga0395901_0002043 3300038443 Bacteria 20724
217 Ga0237819_00412 3300038705 Bacteria 14816
218 Ga0237819_04909 3300038705 Bacteria 2145
219 Ga0237816_00086 3300039145 Bacteria 6647
220 Ga0439436_0046305 3300041404 Bacteria 1236
221 Ga0439436_0091977 3300041404 Bacteria 845
222 Ga0439439_0007005 3300041406 Bacteria 2625
223 Ga0439439_0024518 3300041406 Bacteria 1515
224 Ga0439439_0103971 3300041406 Bacteria 783
225 Ga0439447_002198 3300041407 Bacteria 7152
226 Ga0439461_0079168 3300041410 Bacteria 773
227 Ga0439465_0000362 3300041413 Bacteria 12994
228 Ga0439465_0005244 3300041413 Bacteria 4149
229 Ga0439465_0016272 3300041413 Bacteria 2320
230 Ga0439465_0030025 3300041413 Bacteria 1728
231 Ga0439465_0061335 3300041413 Bacteria 1246
232 Ga0439465_0143996 3300041413 Bacteria 848
233 Ga0451789_0689845 3300041443 Bacteria 1782
234 Ga0451791_0228750 3300041451 Bacteria 1935
235 Ga0451791_1101586 3300041451 Bacteria 1012
236 Ga0451797_0493669 3300041453 Bacteria 2424
237 Ga0451797_0598154 3300041453 Bacteria 1538
238 Ga0451797_0943323 3300041453 Bacteria 676
239 Ga0451797_1231087 3300041453 Bacteria 874
240 Ga0451797_1398069 3300041453 Bacteria 747
241 Ga0451797_1413463 3300041453 Bacteria 1408
242 Ga0451795_0735229 3300041456 Bacteria 1280
243 Ga0451798_0478081 3300041458 Bacteria 961
244 Ga0451800_0514176 3300041459 Bacteria 6401
245 Ga0451802_0869472 3300041460 Bacteria 2384
246 Ga0451806_112225 3300041462 Bacteria 6097
247 Ga0451804_0844979 3300041463 Bacteria 3836
248 Ga0451807_0495113 3300041486 Bacteria 1126
249 Ga0451807_1026549 3300041486 Bacteria 3848
250 Ga0451837_0624323 3300041494 Bacteria 1690
251 Ga0451837_1025625 3300041494 Bacteria 2970
252 Ga0451837_1747075 3300041494 Bacteria 2756
253 Ga0451851_0044262 3300041507 Bacteria 1196
254 Ga0451843_0988962 3300041509 Bacteria 1130
255 Ga0451843_1204059 3300041509 Bacteria 1487
256 Ga0439431_0031747 3300041997 Bacteria 1314
257 Ga0439433_0051554 3300041999 Bacteria 971
258 Ga0439445_0004816 3300042004 Bacteria 3063
259 Ga0439445_0018213 3300042004 Bacteria 1741
260 Ga0439432_005990 3300042006 Bacteria 4362
261 Ga0439432_015006 3300042006 Bacteria 2618
262 Ga0439449_0004898 3300042007 Bacteria 5156
263 Ga0439449_0007530 3300042007 Bacteria 4136
264 Ga0439449_0009677 3300042007 Bacteria 3648
265 Ga0439449_0023440 3300042007 Bacteria 2308
266 Ga0439462_0004797 3300042015 Bacteria 3316
267 Ga0439446_0049440 3300042156 Bacteria 1254
268 Ga0453684_0001075 3300044712 Bacteria 86968
269 Ga0453684_0732213 3300044712 Bacteria 1072
270 Ga0451576_0000025 3300045051 Bacteria 427980
271 Ga0495638_0036836 3300046460 Bacteria 3114
272 Ga0495650_0119572 3300046471 Bacteria 971
273 Ga0495607_0076045 3300046501 Bacteria 1858
274 Ga0495606_0360582 3300046507 Bacteria 768
275 Ga0495616_0049989 3300046513 Bacteria 2093
276 Ga0495632_0125788 3300046519 Bacteria 1195
277 Ga0495643_0153107 3300046522 Bacteria 1140
278 Ga0495663_0009500 3300046525 Bacteria 2700
279 Ga0495663_0039477 3300046525 Bacteria 1430
280 Ga0495663_0056335 3300046525 Bacteria 1227
281 Ga0495663_0097889 3300046525 Bacteria 963
282 Ga0495663_0319576 3300046525 Bacteria 561
283 Ga0495598_0086316 3300046537 Bacteria 1015
284 Ga0495621_0018448 3300046539 Bacteria 2265
285 Ga0495633_0109232 3300046558 Bacteria 1282
286 Ga0495656_0001213 3300046615 Bacteria 8395
287 Ga0495656_0011020 3300046615 Bacteria 3306
288 Ga0495656_0020511 3300046615 Bacteria 2564
289 Ga0495668_0006902 3300046616 Bacteria 7354
290 Ga0495661_0242240 3300046665 Bacteria 925
291 Ga0495670_0276885 3300046691 Bacteria 897
292 Ga0495671_0030282 3300046692 Bacteria 2772
293 Ga0495636_0001221 3300047318 Bacteria 9710
294 Ga0495636_0131705 3300047318 Bacteria 1112
295 Ga0495636_0197763 3300047318 Bacteria 917
296 Ga0495681_0028334 3300047470 Bacteria 2883
297 Ga0495686_0068036 3300047472 Bacteria 2197
298 Ga0495615_0127172 3300048090 Bacteria 742
299 Ga0496100_0029977 3300048903 Bacteria 3370
300 Ga0496100_0594769 3300048903 Bacteria 859
301 Ga0496101_0113131 3300048904 Bacteria 2045
302 Ga0496102_0678895 3300048905 Bacteria 953
303 Ga0496109_0043544 3300048912 Bacteria 4069
304 Ga0496109_0609314 3300048912 Bacteria 1028
305 Ga0496110_0613098 3300048913 Bacteria 987
306 Ga0496114_0007208 3300048917 Bacteria 8778
307 Ga0496115_0695418 3300048918 Bacteria 800
308 Ga0496116_0130572 3300048919 Bacteria 1433
309 Ga0496117_0003368 3300048920 Bacteria 18629
310 Ga0496117_0192345 3300048920 Bacteria 1161
311 Ga0496118_0013515 3300048921 Bacteria 7712
312 Ga0496118_0100692 3300048921 Bacteria 1953
313 Ga0496119_0002089 3300048922 Bacteria 22562
314 Ga0496120_0000537 3300048923 Bacteria 58209
315 Ga0496121_0002935 3300048924 Bacteria 24926
316 Ga0496122_0000859 3300048925 Bacteria 57207
317 Ga0496122_0012523 3300048925 Bacteria 8431
318 Ga0496122_0051417 3300048925 Bacteria 3131
319 Ga0496123_0000417 3300048926 Bacteria 77334
320 Ga0496123_0006439 3300048926 Bacteria 11374
321 Ga0496124_0000052 3300048927 Bacteria 252750
322 Ga0496124_0000653 3300048927 Bacteria 57229
323 Ga0496125_0090524 3300048928 Bacteria 2296
324 Ga0496126_0011689 3300048929 Bacteria 9053
325 Ga0496126_0043826 3300048929 Bacteria 4125
326 Ga0501290_002722 3300049513 Bacteria 2263
327 Ga0501300_003078 3300049523 Bacteria 2489
328 Ga0501031_0043413 3300049568 Bacteria 2934
329 Ga0501031_0091532 3300049568 Bacteria 1984
330 Ga0501032_0005929 3300049569 Bacteria 9025
331 Ga0501032_0008336 3300049569 Bacteria 7554
332 Ga0501032_0641966 3300049569 Bacteria 674
333 Ga0501033_0205509 3300049570 Bacteria 1406
334 Ga0501034_0000636 3300049571 Bacteria 54505
335 Ga0501034_0001777 3300049571 Bacteria 27560
336 Ga0501034_0004664 3300049571 Bacteria 15185
337 Ga0501034_0060996 3300049571 Bacteria 3788
338 Ga0501036_0034775 3300049572 Bacteria 4263
339 Ga0501036_0118911 3300049572 Bacteria 2231
340 Ga0501037_0003917 3300049573 Bacteria 10799
341 Ga0501037_0400426 3300049573 Bacteria 941
342 Ga0501038_0005610 3300049574 Bacteria 11648
343 Ga0501039_0306308 3300049575 Bacteria 1249
344 Ga0501039_0394886 3300049575 Bacteria 1086
345 Ga0501042_0605477 3300049578 Bacteria 797
346 Ga0501043_0001529 3300049579 Bacteria 20190
347 Ga0501043_0008837 3300049579 Bacteria 7928
348 Ga0501046_0465985 3300049580 Bacteria 907
349 Ga0501047_0215165 3300049581 Bacteria 1779
350 Ga0501047_0563726 3300049581 Bacteria 962
351 Ga0501067_0338580 3300049583 Bacteria 838
352 Ga0501069_0541772 3300049585 Bacteria 696
353 Ga0501070_0163106 3300049586 Bacteria 1837
354 Ga0501070_0225766 3300049586 Bacteria 1535
355 Ga0501073_0000635 3300049589 Bacteria 24608
356 Ga0501074_0031329 3300049590 Bacteria 3853
357 Ga0501198_059533 3300049649 Bacteria 698
358 Ga0501252_006799 3300049682 Bacteria 1281
359 Ga0501253_092088 3300049683 Bacteria 699
360 Ga0501257_118549 3300049686 Bacteria 707
361 Ga0501080_0002738 3300049742 Bacteria 15466
362 Ga0501080_0358809 3300049742 Bacteria 1315
363 Ga0501083_0007757 3300049744 Bacteria 7603
364 Ga0501263_017552 3300049760 Bacteria 941
365 Ga0501266_048234 3300049763 Bacteria 652
366 Ga0501268_044831 3300049765 Bacteria 842
367 Ga0501275_000285 3300049772 Bacteria 5737
368 Ga0501035_0021820 3300049822 Bacteria 5884
369 Ga0501044_0027480 3300049823 Bacteria 6012
370 Ga0501044_0054152 3300049823 Bacteria 4125
371 Ga0501045_0914666 3300049824 Bacteria 644
372 nmdc:mga00v17_489_c1 3300050491 Bacteria 22233
373 nmdc:mga00v17_58801_c1 3300050491 Bacteria 2356
374 nmdc:mga00v17_654138_c1 3300050491 Bacteria 676
375 nmdc:mga00v17_96870_c1 3300050491 Bacteria 1859
376 Ga0500643_131239 3300053087 Bacteria 674
377 Ga0500658_0044379 3300053134 Bacteria 1794
378 Ga0500634_0000574 3300053161 Bacteria 12167
379 Ga0500609_016803 3300053731 Bacteria 993
380 Ga0501082_0250493 3300060353 Bacteria 1541
381 2525556174 2524614729 Bacteria 3091755
382 2572254544 2571042365 Bacteria 3289345
383 2630649404 2627854209 Bacteria 3093011
384 2643815627 2643221559 Bacteria 4424915
385 2643882121 2643221573 Bacteria 4784121
386 2643907300 2643221579 Bacteria 4443405
387 2643915202 2643221581 Bacteria 3893603
388 2643938232 2643221586 Bacteria 4446529
389 2643976383 2643221593 Bacteria 6296053
390 2644079850 2643221612 Bacteria 4361984
391 2644663171 2643221720 Bacteria 4694283
392 2644695999 2643221727 Bacteria 4415595
393 2644699667 2643221728 Bacteria 4797149
394 2748018900 2747842501 Bacteria 5293829
395 2819662748 2818991457 Bacteria 5323295
396 2842781684 2842780639 Bacteria 4337790
397 2852687512 2852684882 Bacteria 5463342
398 2894414476 2894414249 Bacteria 4405451
399 2895501329 2895498888 Bacteria 5283788
400 2895514472 2895511927 Bacteria 6802080
401 2895524046 2895522137 Bacteria 3284416
402 2895527534 2895525241 Bacteria 3388457
403 2919134305 2919130084 Bacteria 5301837
404 2923519259 2923516293 Bacteria 3716336
405 2929198950 2929195423 Bacteria 5325372
406 2941490111 2941489479 Bacteria 6313767
407 2995950330 2995948881 Bacteria 6358104
408 8003015034 8003014200 Bacteria 4059994
409 8021622516 8021622325 Bacteria 4844743
410 8021627976 8021626552 Bacteria 4665214
411 8021652182 8021648035 Bacteria 4772378
412 Ga0439436_0004836
413 SwRhRL2b_contig_3845428
414 SwRhRL2b_contig_440373
415 JGI25152J39213_1000480
416 JGI25150J39212_1000356
417 JGI25150J39212_1029777
418 JGI25151J46595_10000676
419 JGI25151J46595_10000924
420 JGI25151J46595_10015338
421 JGI25151J46595_10029237
422 JGI25153J46596_10000050
423 Ga0055526_1000124
424 Ga0055526_1056417
425 Ga0055526_1071251
426 Ga0055537_1000351
427 Ga0055524_1000188
428 Ga0055524_1003485
429 Ga0055524_1010063
430 Ga0055524_1057554
431 Ga0055536_1002108
432 Ga0055536_1003924
433 Ga0055536_1011849
434 Ga0055536_1022616
435 Ga0055534_1000108
436 Ga0055534_1041576
437 Ga0055528_1000102
438 Ga0055530_10014200
439 Ga0055531_10002096
440 Ga0055531_10002569
441 Ga0055531_10011069
442 Ga0055531_10013553
443 Ga0055531_10027918
444 Ga0055531_10054827
445 Ga0058692_1000032
446 Ga0065714_10115774
447 Ga0065704_10071251
448 Ga0065704_10078342
449 Ga0070676_10221254
450 Ga0070670_100005259
451 Ga0068868_100106169
452 Ga0070669_100052094
453 Ga0070671_100028673
454 Ga0070671_100080063
455 Ga0070674_100016109
456 Ga0070673_100135673
457 Ga0070673_100238013
458 Ga0070667_100277547
459 Ga0070667_100923225
460 Ga0068867_100096762
461 Ga0068853_100156106
462 Ga0070672_100000577
463 Ga0070672_100146893
464 Ga0070665_101168218
465 Ga0068855_101071856
466 Ga0068864_100864186
467 Ga0068862_100071796
468 Ga0075365_10514028
469 Ga0075364_10000625
470 Ga0075364_10134033
471 Ga0075362_10288022
472 Ga0075366_10446475
473 Ga0105251_10002229
474 Ga0105240_10029288
475 Ga0105243_10023660
476 Ga0105243_10505914
477 Ga0105248_10910761
478 Ga0105237_10340468
479 Ga0105030_107673
480 Ga0105035_120238
481 Ga0105246_10086626
482 Ga0157318_1000915
483 Ga0157345_1017862
484 Ga0157371_10920085
485 Ga0157374_10258525
486 Ga0157514_112427
487 Ga0157515_133431
488 Ga0163163_10933929
489 Ga0157380_10186658
490 Ga0182008_10103090
491 Ga0157376_11671538
492 Ga0182005_1008030
493 Ga0183360_10001
494 Ga0207425_1000117
495 Ga0207425_1006385
496 Ga0209129_1000011
497 Ga0209565_1000001
498 Ga0209673_1000001
499 Ga0209673_1005553
500 Ga0209673_1060509
501 Ga0209673_1063010
502 Ga0209130_1006144
503 Ga0209675_1000001
504 Ga0209675_1010658
505 Ga0209675_1016501
506 Ga0209676_1000436
507 Ga0209676_1001557
508 Ga0209676_1001981
509 Ga0209676_1002305
510 Ga0209676_1002769
511 Ga0209676_1004360
512 Ga0209676_1005388
513 Ga0209676_1006571
514 Ga0209025_1000002
515 Ga0209025_1000006
516 Ga0209025_1000564
517 Ga0209025_1019266
518 Ga0209025_1137077
519 Ga0209564_1000001
520 Ga0209564_1047968
521 Ga0209564_1047969
522 Ga0209758_1000003
523 Ga0209758_1040999
524 Ga0209758_1062907
525 Ga0209050_1005567
526 Ga0209050_1007405
527 Ga0209050_1057507
528 Ga0209256_1000006
529 Ga0209256_1002374
530 Ga0209256_1002733
531 Ga0209256_1025187
532 Ga0209051_1020202
533 Ga0209257_1000343
534 Ga0209257_1000567
535 Ga0209257_1000738
536 Ga0209257_1000788
537 Ga0209257_1002327
538 Ga0209257_1004934
539 Ga0209257_1006402
540 Ga0207713_1000294
541 Ga0207680_10394770
542 Ga0207645_10184833
543 Ga0207695_10010702
544 Ga0207650_10013553
545 Ga0207650_10072802
546 Ga0207650_10613707
547 Ga0207650_10646909
548 Ga0207644_10133320
549 Ga0207644_10261962
550 Ga0207644_10378913
551 Ga0207709_10394515
552 Ga0207670_10226561
553 Ga0207691_10008799
554 Ga0207661_10118219
555 Ga0207668_10037422
556 Ga0207677_10132843
557 Ga0207708_10968656
558 Ga0207676_10609300
559 Ga0207683_10093680
560 Ga0209371_1000055
561 Ga0209967_1032709
562 Ga0209984_1029591
563 Ga0209995_1016608
564 Ga0209999_1022095
565 Ga0209982_1008033
566 Ga0209970_1001244
567 Ga0210002_1052901
568 Ga0209983_1005407
569 Ga0209971_1005688
570 Ga0268266_10837479
571 Ga0268266_10929040
572 Ga0268265_10044957
573 Ga0268256_1000054
574 Ga0316177_1019888
575 Ga0314311_1002365
576 Ga0316182_1085314
577 Ga0307513_10003461
578 Ga0307513_10138265
579 Ga0307408_100043501
580 Ga0307408_100097636
581 Ga0307408_100561274
582 Ga0307516_10093454
583 Ga0307516_10315010
584 Ga0307405_10296419
585 Ga0307413_10006589
586 Ga0307413_10043280
587 Ga0307413_10155336
588 Ga0307413_10447161
589 Ga0307410_10112774
590 Ga0307410_10455284
591 Ga0307406_10011312
592 Ga0307406_10013777
593 Ga0307406_10200612
594 Ga0307407_10080993
595 Ga0307407_10441542
596 Ga0307412_10034205
597 Ga0307412_10161731
598 Ga0307412_10690818
599 Ga0307412_10806268
600 Ga0307412_11051951
601 Ga0307409_100030243
602 Ga0307409_100385983
603 Ga0307409_100690608
604 Ga0307416_100055265
605 Ga0307416_100090621
606 Ga0307414_10002922
607 Ga0307414_10090827
608 Ga0307414_10136927
609 Ga0307414_10272551
610 Ga0307414_10747110
611 Ga0307414_10776771
612 Ga0307414_10887301
613 Ga0307414_11071096
614 Ga0307411_10095683
615 Ga0307411_10168536
616 Ga0307411_10614693
617 Ga0307415_100490020
618 Ga0307415_100534800
619 Ga0307415_100548011
620 Ga0307415_101156192
621 Ga0395899_0022853
622 Ga0395900_0028616
623 Ga0395898_0058673
624 Ga0395905_0002340
625 Ga0395905_0075886
626 Ga0395905_0118577
627 Ga0395901_0002043
628 Ga0237819_00412
629 Ga0237819_04909
630 Ga0237816_00086
631 Ga0439436_0046305
632 Ga0439436_0091977
633 Ga0439439_0007005
634 Ga0439439_0024518
635 Ga0439439_0103971
636 Ga0439447_002198
637 Ga0439461_0079168
638 Ga0439465_0000362
639 Ga0439465_0005244
640 Ga0439465_0016272
641 Ga0439465_0030025
642 Ga0439465_0061335
643 Ga0439465_0143996
644 Ga0451789_0689845
645 Ga0451791_0228750
646 Ga0451791_1101586
647 Ga0451797_0493669
648 Ga0451797_0598154
649 Ga0451797_0943323
650 Ga0451797_1231087
651 Ga0451797_1398069
652 Ga0451797_1413463
653 Ga0451795_0735229
654 Ga0451798_0478081
655 Ga0451800_0514176
656 Ga0451802_0869472
657 Ga0451806_112225
658 Ga0451804_0844979
659 Ga0451807_0495113
660 Ga0451807_1026549
661 Ga0451837_0624323
662 Ga0451837_1025625
663 Ga0451837_1747075
664 Ga0451851_0044262
665 Ga0451843_0988962
666 Ga0451843_1204059
667 Ga0439431_0031747
668 Ga0439433_0051554
669 Ga0439445_0004816
670 Ga0439445_0018213
671 Ga0439432_005990
672 Ga0439432_015006
673 Ga0439449_0004898
674 Ga0439449_0007530
675 Ga0439449_0009677
676 Ga0439449_0023440
677 Ga0439462_0004797
678 Ga0439446_0049440
679 Ga0453684_0001075
680 Ga0453684_0732213
681 Ga0451576_0000025
682 Ga0495638_0036836
683 Ga0495650_0119572
684 Ga0495607_0076045
685 Ga0495606_0360582
686 Ga0495616_0049989
687 Ga0495632_0125788
688 Ga0495643_0153107
689 Ga0495663_0009500
690 Ga0495663_0039477
691 Ga0495663_0056335
692 Ga0495663_0097889
693 Ga0495663_0319576
694 Ga0495598_0086316
695 Ga0495621_0018448
696 Ga0495633_0109232
697 Ga0495656_0001213
698 Ga0495656_0011020
699 Ga0495656_0020511
700 Ga0495668_0006902
701 Ga0495661_0242240
702 Ga0495670_0276885
703 Ga0495671_0030282
704 Ga0495636_0001221
705 Ga0495636_0131705
706 Ga0495636_0197763
707 Ga0495681_0028334
708 Ga0495686_0068036
709 Ga0495615_0127172
710 Ga0496100_0029977
711 Ga0496100_0594769
712 Ga0496101_0113131
713 Ga0496102_0678895
714 Ga0496109_0043544
715 Ga0496109_0609314
716 Ga0496110_0613098
717 Ga0496114_0007208
718 Ga0496115_0695418
719 Ga0496116_0130572
720 Ga0496117_0003368
721 Ga0496117_0192345
722 Ga0496118_0013515
723 Ga0496118_0100692
724 Ga0496119_0002089
725 Ga0496120_0000537
726 Ga0496121_0002935
727 Ga0496122_0000859
728 Ga0496122_0012523
729 Ga0496122_0051417
730 Ga0496123_0000417
731 Ga0496123_0006439
732 Ga0496124_0000052
733 Ga0496124_0000653
734 Ga0496125_0090524
735 Ga0496126_0011689
736 Ga0496126_0043826
737 Ga0501290_002722
738 Ga0501300_003078
739 Ga0501031_0043413
740 Ga0501031_0091532
741 Ga0501032_0005929
742 Ga0501032_0008336
743 Ga0501032_0641966
744 Ga0501033_0205509
745 Ga0501034_0000636
746 Ga0501034_0001777
747 Ga0501034_0004664
748 Ga0501034_0060996
749 Ga0501036_0034775
750 Ga0501036_0118911
751 Ga0501037_0003917
752 Ga0501037_0400426
753 Ga0501038_0005610
754 Ga0501039_0306308
755 Ga0501039_0394886
756 Ga0501042_0605477
757 Ga0501043_0001529
758 Ga0501043_0008837
759 Ga0501046_0465985
760 Ga0501047_0215165
761 Ga0501047_0563726
762 Ga0501067_0338580
763 Ga0501069_0541772
764 Ga0501070_0163106
765 Ga0501070_0225766
766 Ga0501073_0000635
767 Ga0501074_0031329
768 Ga0501198_059533
769 Ga0501252_006799
770 Ga0501253_092088
771 Ga0501257_118549
772 Ga0501080_0002738
773 Ga0501080_0358809
774 Ga0501083_0007757
775 Ga0501263_017552
776 Ga0501266_048234
777 Ga0501268_044831
778 Ga0501275_000285
779 Ga0501035_0021820
780 Ga0501044_0027480
781 Ga0501044_0054152
782 Ga0501045_0914666
783 nmdc:mga00v17_489_c1
784 nmdc:mga00v17_58801_c1
785 nmdc:mga00v17_654138_c1
786 nmdc:mga00v17_96870_c1
787 Ga0500643_131239
788 Ga0500658_0044379
789 Ga0500634_0000574
790 Ga0500609_016803
791 Ga0501082_0250493
792 2525556174
793 2572254544
794 2630649404
795 2643815627
796 2643882121
797 2643907300
798 2643915202
799 2643938232
800 2643976383
801 2644079850
802 2644663171
803 2644695999
804 2644699667
805 2748018900
806 2819662748
807 2842781684
808 2852687512
809 2894414476
810 2895501329
811 2895514472
812 2895524046
813 2895527534
814 2919134305
815 2923519259
816 2929198950
817 2941490111
818 2995950330
819 8003015034
820 8021622516
821 8021627976
822 8021652182

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

37

180

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mkz-assembly1.cif.gz_A crystal structure of moab protein at 1.6 a resolution. 0.9831 5 165
1r2k-assembly1.cif.gz_B crystal structure of moab from escherichia coli 0.981 5 165
1y5e-assembly1.cif.gz_C crystal structure of molybdenum cofactor biosynthesis protein b 0.9372 8 170
1r2k-assembly1.cif.gz_B crystal structure of moab from escherichia coli 0.9352 5 165
1mkz-assembly1.cif.gz_A crystal structure of moab protein at 1.6 a resolution. 0.9263 5 165
ID Description Score Start End Superfamily
1r2kA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9628 5 172 3.40.980.10
1r2kA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9402 5 172 3.40.980.10
1y5eB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9337 8 172 3.40.980.10
af_P39205_1_179_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9316 9 151 3.40.980.10
1y5eB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.911 8 172 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A0K2ZJ77-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9895 1 172 GO:0005829
GO:0006777
AF-A0A2S7DUJ2-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9895 1 172 GO:0005829
GO:0006777
AF-A0A5E7BI58-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9879 5 164 GO:0005829
GO:0006777
AF-A0A391NH38-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9876 5 165 GO:0005829
GO:0006777
AF-A0A661DIQ2-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9873 4 162 GO:0005829
GO:0006777

Map