F437602

General Info

Members Datasets Scaffolds Average Seq Length
411 239 822 266

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0120061|Ga0495641_0120061_262_1119
Length 285
Sequence LSLKVTLLGTGTSQGVPMIGCGCAVCQSTDPRDRRSRPSIFIEVVGELAEPLPEAASAVRHVLVDTSPDLRTQALARGIQRVDAILFTHSHADHIMGMDDVRRFNAIQGGAIPAYADERTAGDLRRAFSYVFTPPDQKGGGVPQLELSTIDGRFNVGSVGIEPVPIFHGLRPILGFRFGSFAYVTDCNRMTDAAWSILAGVDVLILGALRYRPHPTHFTVSEALQVVEALKPRQSFFTHICHDLPHAATNAALPPGVALAHDGLKFDVEVAAAFAPAEVAERKWT

Samples

Sample ID Description Type Environment
1 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
164 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
180 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
232 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
233 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
237 2773857925 Microvirga vignae BR3299 Isolate Unclassified
238 2842694124 Methylopila sp. R-72369 Isolate Unclassified
239 2909042592 Labrys sp. LIt4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0.24
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.84
Nodule 0.24
Rhizoplane 15.33
Rhizosphere 76.4
Stem 0
Stem Tuber 0
Unclassified 1.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495641_0120061 3300046461 Bacteria 1173
2 JGI24742J22300_10003737 3300002244 Bacteria 2471
3 JGI25406J46586_10009199 3300003203 Bacteria 4430
4 Ga0070676_10197258 3300005328 Bacteria 1318
5 Ga0070690_100012848 3300005330 Bacteria 4935
6 Ga0070670_100077104 3300005331 Bacteria 2864
7 Ga0070670_100251756 3300005331 Bacteria 1539
8 Ga0070680_100192312 3300005336 Bacteria 1719
9 Ga0068868_100007445 3300005338 Bacteria 7795
10 Ga0070689_100011289 3300005340 Bacteria 6395
11 Ga0070689_100362515 3300005340 Bacteria 1218
12 Ga0070687_100001322 3300005343 Bacteria 8663
13 Ga0070692_10045998 3300005345 Bacteria 2253
14 Ga0070668_100012197 3300005347 Bacteria 6401
15 Ga0070669_100023889 3300005353 Bacteria 4380
16 Ga0070675_100029570 3300005354 Bacteria 4420
17 Ga0070674_100002023 3300005356 Bacteria 11113
18 Ga0070673_100030271 3300005364 Bacteria 4047
19 Ga0070667_100006086 3300005367 Bacteria 10016
20 Ga0070667_100077143 3300005367 Bacteria 2845
21 Ga0070703_10016668 3300005406 Bacteria 2110
22 Ga0070709_10014990 3300005434 Bacteria 4400
23 Ga0070714_100000098 3300005435 Bacteria 74167
24 Ga0070714_100060306 3300005435 Bacteria 3255
25 Ga0070714_100074934 3300005435 Bacteria 2935
26 Ga0070713_100014283 3300005436 Bacteria 5891
27 Ga0070713_100332770 3300005436 Bacteria 1405
28 Ga0070710_10091423 3300005437 Bacteria 1796
29 Ga0070701_10000544 3300005438 Bacteria 12999
30 Ga0070701_10041960 3300005438 Bacteria 2333
31 Ga0070711_100047236 3300005439 Bacteria 2938
32 Ga0070705_100009336 3300005440 Bacteria 4873
33 Ga0070663_100023145 3300005455 Bacteria 4161
34 Ga0070663_100299256 3300005455 Bacteria 1287
35 Ga0070678_100135016 3300005456 Bacteria 1966
36 Ga0070662_100006609 3300005457 Bacteria 7486
37 Ga0068867_100006600 3300005459 Bacteria 8201
38 Ga0070685_10001171 3300005466 Bacteria 14029
39 Ga0070707_100227453 3300005468 Bacteria 1816
40 Ga0070707_100371401 3300005468 Unclassified 1390
41 Ga0070698_100237818 3300005471 Bacteria 1754
42 Ga0070698_100469481 3300005471 Bacteria 1195
43 Ga0070679_100158376 3300005530 Bacteria 2238
44 Ga0070684_100101853 3300005535 Bacteria 2566
45 Ga0070684_100102665 3300005535 Bacteria 2557
46 Ga0070672_100007959 3300005543 Bacteria 7240
47 Ga0070686_100035432 3300005544 Bacteria 3082
48 Ga0070664_100135186 3300005564 Bacteria 2168
49 Ga0070664_100154894 3300005564 Bacteria 2024
50 Ga0068857_100125155 3300005577 Bacteria 2316
51 Ga0068854_100028596 3300005578 Bacteria 3854
52 Ga0068856_100049795 3300005614 Bacteria 4129
53 Ga0070702_100003914 3300005615 Bacteria 6751
54 Ga0070702_100233429 3300005615 Bacteria 1237
55 Ga0068859_100602845 3300005617 Bacteria 1191
56 Ga0068864_100002387 3300005618 Bacteria 15520
57 Ga0068866_10005160 3300005718 Bacteria 5382
58 Ga0068861_100058391 3300005719 Bacteria 2950
59 Ga0068870_10001771 3300005840 Bacteria 8848
60 Ga0068863_100007012 3300005841 Bacteria 11043
61 Ga0068863_100147910 3300005841 Bacteria 2247
62 Ga0068863_100619338 3300005841 Bacteria 1072
63 Ga0068858_100005914 3300005842 Bacteria 11940
64 Ga0068860_100078622 3300005843 Bacteria 3136
65 Ga0068862_100014438 3300005844 Bacteria 6553
66 Ga0068862_100201934 3300005844 Bacteria 1793
67 Ga0081455_10000769 3300005937 Bacteria 41419
68 Ga0081455_10007568 3300005937 Bacteria 11418
69 Ga0081455_10014052 3300005937 Bacteria 7869
70 Ga0081455_10180660 3300005937 Bacteria 1598
71 Ga0081538_10006193 3300005981 Bacteria 10600
72 Ga0081538_10031838 3300005981 Bacteria 3548
73 Ga0081540_1004744 3300005983 Bacteria 10280
74 Ga0081539_10006007 3300005985 Bacteria 11928
75 Ga0075365_10015836 3300006038 Bacteria 4569
76 Ga0075365_10021113 3300006038 Bacteria 4055
77 Ga0075365_10036632 3300006038 Bacteria 3179
78 Ga0075365_10064979 3300006038 Bacteria 2445
79 Ga0075363_100100103 3300006048 Bacteria 1603
80 Ga0075364_10085610 3300006051 Bacteria 2087
81 Ga0070712_100004631 3300006175 Bacteria 8501
82 Ga0070712_100070468 3300006175 Bacteria 2498
83 Ga0070712_100071675 3300006175 Bacteria 2480
84 Ga0075362_10075657 3300006177 Bacteria 1544
85 Ga0075366_10001525 3300006195 Bacteria 11575
86 Ga0075366_10284305 3300006195 Bacteria 1011
87 Ga0097621_100030663 3300006237 Bacteria 4260
88 Ga0097621_100194365 3300006237 Bacteria 1758
89 Ga0068871_100016532 3300006358 Bacteria 5561
90 Ga0068871_100529338 3300006358 Bacteria 1065
91 Ga0075428_100001218 3300006844 Bacteria 27549
92 Ga0075428_100022676 3300006844 Bacteria 6949
93 Ga0075428_100038529 3300006844 Bacteria 5261
94 Ga0075428_100482070 3300006844 Bacteria 1327
95 Ga0075430_100000152 3300006846 Bacteria 44881
96 Ga0075430_100200171 3300006846 Bacteria 1659
97 Ga0075431_100000613 3300006847 Bacteria 30137
98 Ga0075431_100147618 3300006847 Bacteria 2423
99 Ga0075431_100165174 3300006847 Bacteria 2275
100 Ga0075431_100322363 3300006847 Bacteria 1558
101 Ga0075431_100559605 3300006847 Bacteria 1130
102 Ga0075431_100648260 3300006847 Bacteria 1037
103 Ga0075433_10277004 3300006852 Bacteria 1486
104 Ga0075434_100057828 3300006871 Bacteria 3854
105 Ga0075434_100159446 3300006871 Bacteria 2276
106 Ga0075429_100068661 3300006880 Bacteria 3085
107 Ga0075429_100119479 3300006880 Bacteria 2303
108 Ga0075429_100183680 3300006880 Bacteria 1833
109 Ga0068865_100013020 3300006881 Bacteria 5245
110 Ga0097620_100602888 3300006931 Bacteria 1191
111 Ga0099794_10003112 3300007265 Bacteria 6280
112 Ga0099795_10020860 3300007788 Bacteria 2141
113 Ga0105250_10069574 3300009092 Bacteria 1421
114 Ga0111539_10000840 3300009094 Bacteria 39968
115 Ga0111539_10041700 3300009094 Bacteria 5516
116 Ga0111539_10149694 3300009094 Bacteria 2732
117 Ga0111539_10160838 3300009094 Bacteria 2626
118 Ga0111539_10321254 3300009094 Bacteria 1801
119 Ga0111539_10653858 3300009094 Bacteria 1224
120 Ga0105245_10049519 3300009098 Bacteria 3763
121 Ga0105247_10011483 3300009101 Bacteria 5339
122 Ga0105247_10242400 3300009101 Bacteria 1229
123 Ga0114129_10000320 3300009147 Bacteria 56319
124 Ga0114129_10002097 3300009147 Bacteria 27432
125 Ga0114129_10034224 3300009147 Bacteria 7175
126 Ga0114129_10072986 3300009147 Bacteria 4782
127 Ga0114129_10267374 3300009147 Bacteria 2289
128 Ga0114129_10390717 3300009147 Bacteria 1835
129 Ga0114129_10830643 3300009147 Bacteria 1176
130 Ga0114129_10963600 3300009147 Bacteria 1077
131 Ga0105243_10060278 3300009148 Bacteria 3031
132 Ga0105243_10115614 3300009148 Bacteria 2253
133 Ga0105242_10521194 3300009176 Bacteria 1134
134 Ga0105248_10025028 3300009177 Bacteria 6635
135 Ga0105248_10058984 3300009177 Bacteria 4310
136 Ga0105248_10118323 3300009177 Bacteria 2989
137 Ga0105248_10345414 3300009177 Bacteria 1675
138 Ga0105237_10032626 3300009545 Bacteria 5272
139 Ga0105238_10114452 3300009551 Bacteria 2677
140 Ga0105249_10032441 3300009553 Bacteria 4725
141 Ga0105249_10330749 3300009553 Bacteria 1537
142 Ga0105239_10076217 3300010375 Bacteria 3688
143 Ga0105239_10173497 3300010375 Bacteria 2412
144 Ga0157369_10130337 3300013105 Bacteria 2665
145 Ga0157374_10013392 3300013296 Bacteria 7160
146 Ga0157378_10014031 3300013297 Bacteria 7014
147 Ga0163162_11058638 3300013306 Bacteria 918
148 Ga0157375_10029995 3300013308 Bacteria 5121
149 Ga0163163_10026389 3300014325 Bacteria 5552
150 Ga0157380_10003106 3300014326 Bacteria 11331
151 Ga0157380_10028029 3300014326 Bacteria 4290
152 Ga0157380_10233285 3300014326 Bacteria 1654
153 Ga0157377_10011739 3300014745 Bacteria 4381
154 Ga0157377_10197048 3300014745 Bacteria 1276
155 Ga0157379_10002037 3300014968 Bacteria 16773
156 Ga0157376_10017818 3300014969 Bacteria 5428
157 Ga0157376_10051761 3300014969 Bacteria 3412
158 Ga0163161_10005982 3300017792 Bacteria 8433
159 Ga0213876_10007625 3300021384 Bacteria 5876
160 Ga0213875_10000007 3300021388 Bacteria 562717
161 Ga0213875_10140745 3300021388 Bacteria 1129
162 Ga0224572_1002407 3300024225 Bacteria 3011
163 Ga0207653_10034021 3300025885 Bacteria 1654
164 Ga0207642_10008872 3300025899 Bacteria 3473
165 Ga0207710_10064952 3300025900 Bacteria 1663
166 Ga0207688_10000130 3300025901 Bacteria 31681
167 Ga0207647_10002385 3300025904 Bacteria 14262
168 Ga0207645_10032401 3300025907 Bacteria 3359
169 Ga0207643_10001538 3300025908 Bacteria 13167
170 Ga0207671_10038954 3300025914 Bacteria 3521
171 Ga0207693_10016124 3300025915 Bacteria 5979
172 Ga0207693_10258173 3300025915 Bacteria 1366
173 Ga0207693_10516415 3300025915 Bacteria 932
174 Ga0207663_10587863 3300025916 Bacteria 874
175 Ga0207660_10465558 3300025917 Bacteria 1023
176 Ga0207662_10009228 3300025918 Bacteria 5421
177 Ga0207662_10120031 3300025918 Bacteria 1648
178 Ga0207657_10015944 3300025919 Bacteria 7259
179 Ga0207649_10059241 3300025920 Bacteria 2401
180 Ga0207681_10017150 3300025923 Bacteria 4543
181 Ga0207650_10004418 3300025925 Bacteria 9604
182 Ga0207687_10110352 3300025927 Bacteria 2040
183 Ga0207664_10000663 3300025929 Bacteria 23701
184 Ga0207664_10045973 3300025929 Bacteria 3425
185 Ga0207664_10048956 3300025929 Bacteria 3326
186 Ga0207664_10546176 3300025929 Bacteria 1039
187 Ga0207644_10035067 3300025931 Bacteria 3513
188 Ga0207690_10080463 3300025932 Bacteria 2274
189 Ga0207706_10002801 3300025933 Bacteria 16940
190 Ga0207686_10121085 3300025934 Bacteria 1781
191 Ga0207669_10006157 3300025937 Bacteria 5457
192 Ga0207704_10003655 3300025938 Bacteria 6989
193 Ga0207665_10074411 3300025939 Bacteria 2325
194 Ga0207665_10205241 3300025939 Bacteria 1437
195 Ga0207691_10000921 3300025940 Bacteria 29187
196 Ga0207711_10246408 3300025941 Bacteria 1639
197 Ga0207711_10460192 3300025941 Bacteria 1184
198 Ga0207689_10000756 3300025942 Bacteria 31021
199 Ga0207661_10088984 3300025944 Bacteria 2568
200 Ga0207667_10222284 3300025949 Bacteria 1935
201 Ga0207651_10060456 3300025960 Bacteria 2630
202 Ga0207668_10033558 3300025972 Bacteria 3401
203 Ga0207658_10196635 3300025986 Bacteria 1680
204 Ga0207658_10207338 3300025986 Bacteria 1640
205 Ga0207677_10012844 3300026023 Bacteria 4834
206 Ga0207703_10011569 3300026035 Bacteria 6861
207 Ga0207678_10002027 3300026067 Bacteria 18385
208 Ga0207678_10349535 3300026067 Bacteria 1275
209 Ga0207708_10000567 3300026075 Bacteria 28570
210 Ga0207708_10168254 3300026075 Bacteria 1734
211 Ga0207702_10093193 3300026078 Bacteria 2641
212 Ga0207648_10009209 3300026089 Bacteria 9483
213 Ga0207648_10096051 3300026089 Bacteria 2593
214 Ga0207676_10007771 3300026095 Bacteria 7625
215 Ga0207675_100004438 3300026118 Bacteria 13564
216 Ga0207675_100457449 3300026118 Bacteria 1265
217 Ga0207683_10015749 3300026121 Bacteria 6434
218 Ga0207698_10489811 3300026142 Bacteria 1194
219 Ga0207428_10005811 3300027907 Bacteria 11439
220 Ga0207428_10078394 3300027907 Bacteria 2585
221 Ga0268266_10214311 3300028379 Bacteria 1767
222 Ga0268265_10153743 3300028380 Bacteria 1944
223 Ga0268264_10047473 3300028381 Bacteria 3570
224 Ga0265338_10041131 3300028800 Bacteria 4328
225 Ga0265338_10079787 3300028800 Bacteria 2753
226 Ga0265760_10016690 3300031090 Bacteria 2108
227 Ga0265325_10042203 3300031241 Bacteria 2386
228 Ga0265325_10108287 3300031241 Bacteria 1353
229 Ga0265339_10000074 3300031249 Bacteria 85897
230 Ga0265339_10069856 3300031249 Bacteria 1874
231 Ga0265331_10145803 3300031250 Bacteria 1076
232 Ga0265313_10000033 3300031595 Bacteria 128053
233 Ga0265342_10251746 3300031712 Bacteria 942
234 Ga0373938_0039404 3300034957 Bacteria 1045
235 Ga0373954_0191194 3300035118 Bacteria 1005
236 Ga0373931_0038354 3300035691 Bacteria 2506
237 Ga0373927_0027804 3300035695 Bacteria 3693
238 Ga0373933_0128127 3300035724 Bacteria 1594
239 Ga0373925_0280409 3300037068 Bacteria 1342
240 Ga0395900_0020998 3300037418 Bacteria 6675
241 Ga0436364_0309649 3300037853 Bacteria 36034
242 Ga0436364_1505735 3300037853 Bacteria 910
243 Ga0436365_0183648 3300039437 Bacteria 3768
244 Ga0436365_0717946 3300039437 Bacteria 1598
245 Ga0436361_0589778 3300039447 Bacteria 9307
246 Ga0439435_0012267 3300042436 Bacteria 2073
247 Ga0439459_0023390 3300042438 Bacteria 1204
248 Ga0439459_0033318 3300042438 Bacteria 1060
249 Ga0466964_0330831 3300044706 Bacteria 777
250 Ga0453684_0753472 3300044712 Bacteria 1054
251 Ga0466968_0104427 3300044735 Bacteria 1268
252 Ga0495653_0179641 3300046463 Bacteria 1454
253 Ga0495582_0216846 3300046473 Bacteria 1094
254 Ga0495664_0197343 3300046477 Bacteria 1220
255 Ga0495584_0016997 3300046491 Bacteria 3707
256 Ga0495665_0138665 3300046531 Bacteria 1272
257 Ga0495640_0158272 3300046533 Bacteria 1453
258 Ga0495598_0111295 3300046537 Unclassified 918
259 Ga0495656_0016719 3300046615 Bacteria 2788
260 Ga0495668_0096898 3300046616 Bacteria 1614
261 Ga0495659_0076888 3300046664 Bacteria 1260
262 Ga0495613_0230284 3300046689 Bacteria 1298
263 Ga0495671_0070701 3300046692 Bacteria 1715
264 Ga0495683_0116000 3300047323 Bacteria 1275
265 Ga0495684_0227989 3300047471 Bacteria 1363
266 Ga0496100_0037063 3300048903 Bacteria 3080
267 Ga0496100_0152137 3300048903 Bacteria 1651
268 Ga0496100_0297897 3300048903 Bacteria 1206
269 Ga0496100_0572196 3300048903 Bacteria 875
270 Ga0496101_0002538 3300048904 Bacteria 11215
271 Ga0496101_0107305 3300048904 Bacteria 2098
272 Ga0496102_0002933 3300048905 Bacteria 14466
273 Ga0496102_0005716 3300048905 Bacteria 10564
274 Ga0496102_0011238 3300048905 Bacteria 7714
275 Ga0496102_0013581 3300048905 Bacteria 7058
276 Ga0496103_0001124 3300048906 Bacteria 18587
277 Ga0496104_0000125 3300048907 Bacteria 71005
278 Ga0496104_0000284 3300048907 Bacteria 44754
279 Ga0496104_0010922 3300048907 Bacteria 8124
280 Ga0496104_0036538 3300048907 Bacteria 4592
281 Ga0496104_0377760 3300048907 Bacteria 1330
282 Ga0496104_0425361 3300048907 Bacteria 1240
283 Ga0496104_0588105 3300048907 Bacteria 1023
284 Ga0496105_0005555 3300048908 Bacteria 9575
285 Ga0496105_0008842 3300048908 Bacteria 7846
286 Ga0496105_0013032 3300048908 Bacteria 6589
287 Ga0496105_0015114 3300048908 Bacteria 6143
288 Ga0496105_0025177 3300048908 Bacteria 4840
289 Ga0496106_0045623 3300048909 Bacteria 3292
290 Ga0496106_0046666 3300048909 Bacteria 3257
291 Ga0496106_0157108 3300048909 Bacteria 1796
292 Ga0496106_0278343 3300048909 Bacteria 1340
293 Ga0496106_0515200 3300048909 Unclassified 960
294 Ga0496107_0001252 3300048910 Bacteria 15543
295 Ga0496107_0032079 3300048910 Bacteria 3753
296 Ga0496107_0116197 3300048910 Bacteria 1969
297 Ga0496108_0001187 3300048911 Bacteria 20358
298 Ga0496108_0011588 3300048911 Bacteria 7170
299 Ga0496108_0354115 3300048911 Bacteria 1281
300 Ga0496108_0499785 3300048911 Bacteria 1062
301 Ga0496109_0005207 3300048912 Bacteria 10863
302 Ga0496109_0015512 3300048912 Bacteria 6642
303 Ga0496109_0017308 3300048912 Bacteria 6314
304 Ga0496109_0098938 3300048912 Bacteria 2705
305 Ga0496109_0160154 3300048912 Bacteria 2108
306 Ga0496109_0707312 3300048912 Bacteria 945
307 Ga0496110_0001389 3300048913 Bacteria 17461
308 Ga0496110_0008745 3300048913 Bacteria 8155
309 Ga0496110_0012668 3300048913 Bacteria 6939
310 Ga0496110_0018219 3300048913 Bacteria 5885
311 Ga0496111_0020440 3300048914 Bacteria 4609
312 Ga0496111_0073288 3300048914 Bacteria 2493
313 Ga0496111_0123278 3300048914 Bacteria 1915
314 Ga0496112_0001346 3300048915 Bacteria 18695
315 Ga0496112_0087171 3300048915 Bacteria 3089
316 Ga0496112_0159477 3300048915 Bacteria 2222
317 Ga0496112_0550269 3300048915 Bacteria 1088
318 Ga0496112_0672120 3300048915 Bacteria 964
319 Ga0496113_0001229 3300048916 Bacteria 14079
320 Ga0496113_0034704 3300048916 Bacteria 3682
321 Ga0496113_0259044 3300048916 Bacteria 1389
322 Ga0496113_0260122 3300048916 Bacteria 1386
323 Ga0496114_0019043 3300048917 Bacteria 5562
324 Ga0496114_0280433 3300048917 Bacteria 1469
325 Ga0496114_0325211 3300048917 Bacteria 1359
326 Ga0496115_0003119 3300048918 Bacteria 11913
327 Ga0496115_0079256 3300048918 Bacteria 2673
328 Ga0496115_0414898 3300048918 Bacteria 1091
329 Ga0501032_0201531 3300049569 Bacteria 1299
330 Ga0501034_0037319 3300049571 Bacteria 4920
331 Ga0501034_0072058 3300049571 Bacteria 3464
332 Ga0501036_0192077 3300049572 Bacteria 1718
333 Ga0501036_0607226 3300049572 Bacteria 907
334 Ga0501043_0074822 3300049579 Bacteria 2661
335 Ga0501047_0024390 3300049581 Bacteria 5806
336 Ga0501047_0047771 3300049581 Bacteria 4134
337 Ga0501048_0242588 3300049582 Bacteria 1279
338 Ga0501071_0522325 3300049587 Bacteria 911
339 Ga0501072_0137655 3300049588 Bacteria 1947
340 Ga0501073_0006067 3300049589 Bacteria 9015
341 Ga0501075_0133117 3300049591 Bacteria 1894
342 Ga0501075_0181300 3300049591 Bacteria 1606
343 Ga0501075_0334028 3300049591 Unclassified 1155
344 Ga0501076_0067167 3300049592 Bacteria 2863
345 Ga0501076_0141271 3300049592 Bacteria 1956
346 Ga0501077_0073758 3300049593 Bacteria 2162
347 Ga0501077_0264796 3300049593 Bacteria 1093
348 Ga0501079_0351922 3300049741 Bacteria 1154
349 Ga0501080_0395022 3300049742 Bacteria 1245
350 Ga0501080_0657734 3300049742 Bacteria 927
351 Ga0501044_0020774 3300049823 Bacteria 7007
352 nmdc:mga03683_188266_c1 3300050489 Bacteria 943
353 nmdc:mga00v17_173759_c1 3300050491 Bacteria 1390
354 nmdc:mga00v17_52620_c1 3300050491 Bacteria 1098
355 nmdc:mga0yw44_263347_c1 3300050492 Bacteria 1149
356 nmdc:mga0yw44_36137_c1 3300050492 Bacteria 2909
357 nmdc:mga0yw44_7295_c1 3300050492 Bacteria 5426
358 nmdc:mga0k408_14517_c1 3300050493 Bacteria 4343
359 nmdc:mga06z11_114749_c1 3300050494 Bacteria 1496
360 nmdc:mga06z11_233158_c1 3300050494 Bacteria 1079
361 nmdc:mga04h51_118945_c1 3300050495 Bacteria 982
362 nmdc:mga07m45_309482_c1 3300050496 Bacteria 918
363 nmdc:mga07m45_358777_c1 3300050496 Bacteria 847
364 nmdc:mga05p37_116611_c1 3300050507 Bacteria 3282
365 nmdc:mga05p37_324279_c1 3300050507 Bacteria 1822
366 nmdc:mga05p37_374_c1 3300050507 Bacteria 48074
367 nmdc:mga05p37_391483_c1 3300050507 Bacteria 1625
368 nmdc:mga05p37_707359_c1 3300050507 Bacteria 1118
369 nmdc:mga05p37_85871_c1 3300050507 Bacteria 3878
370 nmdc:mga05p37_86368_c1 3300050507 Bacteria 3866
371 nmdc:mga09592_106552_c1 3300050508 Bacteria 2404
372 nmdc:mga09592_156224_c1 3300050508 Bacteria 1969
373 nmdc:mga09592_2601_c1 3300050508 Bacteria 14611
374 nmdc:mga09592_300863_c1 3300050508 Bacteria 1391
375 nmdc:mga0qj67_177625_c1 3300050509 Bacteria 1729
376 nmdc:mga0qj67_309770_c1 3300050509 Bacteria 1279
377 nmdc:mga0qj67_402653_c1 3300050509 Bacteria 1104
378 nmdc:mga0qj67_59_c1 3300050509 Bacteria 80290
379 nmdc:mga06r32_123743_c1 3300050510 Bacteria 1379
380 nmdc:mga06r32_233931_c1 3300050510 Bacteria 1825
381 nmdc:mga06r32_241091_c1 3300050510 Bacteria 1795
382 nmdc:mga06r32_397_c1 3300050510 Bacteria 36835
383 nmdc:mga06r32_651127_c1 3300050510 Bacteria 1022
384 nmdc:mga06r32_89680_c1 3300050510 Bacteria 3002
385 nmdc:mga08y16_174748_c1 3300050511 Bacteria 2230
386 nmdc:mga08y16_184_c1 3300050511 Bacteria 55479
387 nmdc:mga08y16_269118_c1 3300050511 Bacteria 1759
388 nmdc:mga08y16_318849_c1 3300050511 Bacteria 1600
389 nmdc:mga08y16_34932_c1 3300050511 Bacteria 5282
390 nmdc:mga0n895_199123_c1 3300050512 Bacteria 2034
391 nmdc:mga0n895_304452_c1 3300050512 Bacteria 1616
392 nmdc:mga0n895_7062_c1 3300050512 Bacteria 9596
393 nmdc:mga0rr50_218276_c1 3300050513 Bacteria 1574
394 nmdc:mga0a205_154787_c1 3300050515 Bacteria 2191
395 Ga0495601_0020571 3300053077 Bacteria 4032
396 Ga0495655_0001622 3300053083 Bacteria 3474
397 Ga0495619_0074977 3300053085 Bacteria 2270
398 Ga0495619_0112604 3300053085 Bacteria 1860
399 Ga0500643_016232 3300053087 Bacteria 2528
400 Ga0500562_013448 3300053108 Bacteria 2091
401 Ga0500593_012928 3300053117 Bacteria 3552
402 Ga0501084_0661653 3300054114 Bacteria 882
403 Ga0501082_0082760 3300060353 Bacteria 2769
404 Ga0501082_0107564 3300060353 Bacteria 2413
405 Ga0501082_0180592 3300060353 Bacteria 1835
406 Ga0501082_0454477 3300060353 Unclassified 1119
407 Ga0530510_0107158 3300061734 Bacteria 2045
408 Ga0530510_0162071 3300061734 Bacteria 1654
409 2774871623 2773857925 Bacteria 6472445
410 2842694402 2842694124 Bacteria 4063419
411 2909045943 2909042592 Bacteria 6499737
412 Ga0495641_0120061
413 JGI24742J22300_10003737
414 JGI25406J46586_10009199
415 Ga0070676_10197258
416 Ga0070690_100012848
417 Ga0070670_100077104
418 Ga0070670_100251756
419 Ga0070680_100192312
420 Ga0068868_100007445
421 Ga0070689_100011289
422 Ga0070689_100362515
423 Ga0070687_100001322
424 Ga0070692_10045998
425 Ga0070668_100012197
426 Ga0070669_100023889
427 Ga0070675_100029570
428 Ga0070674_100002023
429 Ga0070673_100030271
430 Ga0070667_100006086
431 Ga0070667_100077143
432 Ga0070703_10016668
433 Ga0070709_10014990
434 Ga0070714_100000098
435 Ga0070714_100060306
436 Ga0070714_100074934
437 Ga0070713_100014283
438 Ga0070713_100332770
439 Ga0070710_10091423
440 Ga0070701_10000544
441 Ga0070701_10041960
442 Ga0070711_100047236
443 Ga0070705_100009336
444 Ga0070663_100023145
445 Ga0070663_100299256
446 Ga0070678_100135016
447 Ga0070662_100006609
448 Ga0068867_100006600
449 Ga0070685_10001171
450 Ga0070707_100227453
451 Ga0070707_100371401
452 Ga0070698_100237818
453 Ga0070698_100469481
454 Ga0070679_100158376
455 Ga0070684_100101853
456 Ga0070684_100102665
457 Ga0070672_100007959
458 Ga0070686_100035432
459 Ga0070664_100135186
460 Ga0070664_100154894
461 Ga0068857_100125155
462 Ga0068854_100028596
463 Ga0068856_100049795
464 Ga0070702_100003914
465 Ga0070702_100233429
466 Ga0068859_100602845
467 Ga0068864_100002387
468 Ga0068866_10005160
469 Ga0068861_100058391
470 Ga0068870_10001771
471 Ga0068863_100007012
472 Ga0068863_100147910
473 Ga0068863_100619338
474 Ga0068858_100005914
475 Ga0068860_100078622
476 Ga0068862_100014438
477 Ga0068862_100201934
478 Ga0081455_10000769
479 Ga0081455_10007568
480 Ga0081455_10014052
481 Ga0081455_10180660
482 Ga0081538_10006193
483 Ga0081538_10031838
484 Ga0081540_1004744
485 Ga0081539_10006007
486 Ga0075365_10015836
487 Ga0075365_10021113
488 Ga0075365_10036632
489 Ga0075365_10064979
490 Ga0075363_100100103
491 Ga0075364_10085610
492 Ga0070712_100004631
493 Ga0070712_100070468
494 Ga0070712_100071675
495 Ga0075362_10075657
496 Ga0075366_10001525
497 Ga0075366_10284305
498 Ga0097621_100030663
499 Ga0097621_100194365
500 Ga0068871_100016532
501 Ga0068871_100529338
502 Ga0075428_100001218
503 Ga0075428_100022676
504 Ga0075428_100038529
505 Ga0075428_100482070
506 Ga0075430_100000152
507 Ga0075430_100200171
508 Ga0075431_100000613
509 Ga0075431_100147618
510 Ga0075431_100165174
511 Ga0075431_100322363
512 Ga0075431_100559605
513 Ga0075431_100648260
514 Ga0075433_10277004
515 Ga0075434_100057828
516 Ga0075434_100159446
517 Ga0075429_100068661
518 Ga0075429_100119479
519 Ga0075429_100183680
520 Ga0068865_100013020
521 Ga0097620_100602888
522 Ga0099794_10003112
523 Ga0099795_10020860
524 Ga0105250_10069574
525 Ga0111539_10000840
526 Ga0111539_10041700
527 Ga0111539_10149694
528 Ga0111539_10160838
529 Ga0111539_10321254
530 Ga0111539_10653858
531 Ga0105245_10049519
532 Ga0105247_10011483
533 Ga0105247_10242400
534 Ga0114129_10000320
535 Ga0114129_10002097
536 Ga0114129_10034224
537 Ga0114129_10072986
538 Ga0114129_10267374
539 Ga0114129_10390717
540 Ga0114129_10830643
541 Ga0114129_10963600
542 Ga0105243_10060278
543 Ga0105243_10115614
544 Ga0105242_10521194
545 Ga0105248_10025028
546 Ga0105248_10058984
547 Ga0105248_10118323
548 Ga0105248_10345414
549 Ga0105237_10032626
550 Ga0105238_10114452
551 Ga0105249_10032441
552 Ga0105249_10330749
553 Ga0105239_10076217
554 Ga0105239_10173497
555 Ga0157369_10130337
556 Ga0157374_10013392
557 Ga0157378_10014031
558 Ga0163162_11058638
559 Ga0157375_10029995
560 Ga0163163_10026389
561 Ga0157380_10003106
562 Ga0157380_10028029
563 Ga0157380_10233285
564 Ga0157377_10011739
565 Ga0157377_10197048
566 Ga0157379_10002037
567 Ga0157376_10017818
568 Ga0157376_10051761
569 Ga0163161_10005982
570 Ga0213876_10007625
571 Ga0213875_10000007
572 Ga0213875_10140745
573 Ga0224572_1002407
574 Ga0207653_10034021
575 Ga0207642_10008872
576 Ga0207710_10064952
577 Ga0207688_10000130
578 Ga0207647_10002385
579 Ga0207645_10032401
580 Ga0207643_10001538
581 Ga0207671_10038954
582 Ga0207693_10016124
583 Ga0207693_10258173
584 Ga0207693_10516415
585 Ga0207663_10587863
586 Ga0207660_10465558
587 Ga0207662_10009228
588 Ga0207662_10120031
589 Ga0207657_10015944
590 Ga0207649_10059241
591 Ga0207681_10017150
592 Ga0207650_10004418
593 Ga0207687_10110352
594 Ga0207664_10000663
595 Ga0207664_10045973
596 Ga0207664_10048956
597 Ga0207664_10546176
598 Ga0207644_10035067
599 Ga0207690_10080463
600 Ga0207706_10002801
601 Ga0207686_10121085
602 Ga0207669_10006157
603 Ga0207704_10003655
604 Ga0207665_10074411
605 Ga0207665_10205241
606 Ga0207691_10000921
607 Ga0207711_10246408
608 Ga0207711_10460192
609 Ga0207689_10000756
610 Ga0207661_10088984
611 Ga0207667_10222284
612 Ga0207651_10060456
613 Ga0207668_10033558
614 Ga0207658_10196635
615 Ga0207658_10207338
616 Ga0207677_10012844
617 Ga0207703_10011569
618 Ga0207678_10002027
619 Ga0207678_10349535
620 Ga0207708_10000567
621 Ga0207708_10168254
622 Ga0207702_10093193
623 Ga0207648_10009209
624 Ga0207648_10096051
625 Ga0207676_10007771
626 Ga0207675_100004438
627 Ga0207675_100457449
628 Ga0207683_10015749
629 Ga0207698_10489811
630 Ga0207428_10005811
631 Ga0207428_10078394
632 Ga0268266_10214311
633 Ga0268265_10153743
634 Ga0268264_10047473
635 Ga0265338_10041131
636 Ga0265338_10079787
637 Ga0265760_10016690
638 Ga0265325_10042203
639 Ga0265325_10108287
640 Ga0265339_10000074
641 Ga0265339_10069856
642 Ga0265331_10145803
643 Ga0265313_10000033
644 Ga0265342_10251746
645 Ga0373938_0039404
646 Ga0373954_0191194
647 Ga0373931_0038354
648 Ga0373927_0027804
649 Ga0373933_0128127
650 Ga0373925_0280409
651 Ga0395900_0020998
652 Ga0436364_0309649
653 Ga0436364_1505735
654 Ga0436365_0183648
655 Ga0436365_0717946
656 Ga0436361_0589778
657 Ga0439435_0012267
658 Ga0439459_0023390
659 Ga0439459_0033318
660 Ga0466964_0330831
661 Ga0453684_0753472
662 Ga0466968_0104427
663 Ga0495653_0179641
664 Ga0495582_0216846
665 Ga0495664_0197343
666 Ga0495584_0016997
667 Ga0495665_0138665
668 Ga0495640_0158272
669 Ga0495598_0111295
670 Ga0495656_0016719
671 Ga0495668_0096898
672 Ga0495659_0076888
673 Ga0495613_0230284
674 Ga0495671_0070701
675 Ga0495683_0116000
676 Ga0495684_0227989
677 Ga0496100_0037063
678 Ga0496100_0152137
679 Ga0496100_0297897
680 Ga0496100_0572196
681 Ga0496101_0002538
682 Ga0496101_0107305
683 Ga0496102_0002933
684 Ga0496102_0005716
685 Ga0496102_0011238
686 Ga0496102_0013581
687 Ga0496103_0001124
688 Ga0496104_0000125
689 Ga0496104_0000284
690 Ga0496104_0010922
691 Ga0496104_0036538
692 Ga0496104_0377760
693 Ga0496104_0425361
694 Ga0496104_0588105
695 Ga0496105_0005555
696 Ga0496105_0008842
697 Ga0496105_0013032
698 Ga0496105_0015114
699 Ga0496105_0025177
700 Ga0496106_0045623
701 Ga0496106_0046666
702 Ga0496106_0157108
703 Ga0496106_0278343
704 Ga0496106_0515200
705 Ga0496107_0001252
706 Ga0496107_0032079
707 Ga0496107_0116197
708 Ga0496108_0001187
709 Ga0496108_0011588
710 Ga0496108_0354115
711 Ga0496108_0499785
712 Ga0496109_0005207
713 Ga0496109_0015512
714 Ga0496109_0017308
715 Ga0496109_0098938
716 Ga0496109_0160154
717 Ga0496109_0707312
718 Ga0496110_0001389
719 Ga0496110_0008745
720 Ga0496110_0012668
721 Ga0496110_0018219
722 Ga0496111_0020440
723 Ga0496111_0073288
724 Ga0496111_0123278
725 Ga0496112_0001346
726 Ga0496112_0087171
727 Ga0496112_0159477
728 Ga0496112_0550269
729 Ga0496112_0672120
730 Ga0496113_0001229
731 Ga0496113_0034704
732 Ga0496113_0259044
733 Ga0496113_0260122
734 Ga0496114_0019043
735 Ga0496114_0280433
736 Ga0496114_0325211
737 Ga0496115_0003119
738 Ga0496115_0079256
739 Ga0496115_0414898
740 Ga0501032_0201531
741 Ga0501034_0037319
742 Ga0501034_0072058
743 Ga0501036_0192077
744 Ga0501036_0607226
745 Ga0501043_0074822
746 Ga0501047_0024390
747 Ga0501047_0047771
748 Ga0501048_0242588
749 Ga0501071_0522325
750 Ga0501072_0137655
751 Ga0501073_0006067
752 Ga0501075_0133117
753 Ga0501075_0181300
754 Ga0501075_0334028
755 Ga0501076_0067167
756 Ga0501076_0141271
757 Ga0501077_0073758
758 Ga0501077_0264796
759 Ga0501079_0351922
760 Ga0501080_0395022
761 Ga0501080_0657734
762 Ga0501044_0020774
763 nmdc:mga03683_188266_c1
764 nmdc:mga00v17_173759_c1
765 nmdc:mga00v17_52620_c1
766 nmdc:mga0yw44_263347_c1
767 nmdc:mga0yw44_36137_c1
768 nmdc:mga0yw44_7295_c1
769 nmdc:mga0k408_14517_c1
770 nmdc:mga06z11_114749_c1
771 nmdc:mga06z11_233158_c1
772 nmdc:mga04h51_118945_c1
773 nmdc:mga07m45_309482_c1
774 nmdc:mga07m45_358777_c1
775 nmdc:mga05p37_116611_c1
776 nmdc:mga05p37_324279_c1
777 nmdc:mga05p37_374_c1
778 nmdc:mga05p37_391483_c1
779 nmdc:mga05p37_707359_c1
780 nmdc:mga05p37_85871_c1
781 nmdc:mga05p37_86368_c1
782 nmdc:mga09592_106552_c1
783 nmdc:mga09592_156224_c1
784 nmdc:mga09592_2601_c1
785 nmdc:mga09592_300863_c1
786 nmdc:mga0qj67_177625_c1
787 nmdc:mga0qj67_309770_c1
788 nmdc:mga0qj67_402653_c1
789 nmdc:mga0qj67_59_c1
790 nmdc:mga06r32_123743_c1
791 nmdc:mga06r32_233931_c1
792 nmdc:mga06r32_241091_c1
793 nmdc:mga06r32_397_c1
794 nmdc:mga06r32_651127_c1
795 nmdc:mga06r32_89680_c1
796 nmdc:mga08y16_174748_c1
797 nmdc:mga08y16_184_c1
798 nmdc:mga08y16_269118_c1
799 nmdc:mga08y16_318849_c1
800 nmdc:mga08y16_34932_c1
801 nmdc:mga0n895_199123_c1
802 nmdc:mga0n895_304452_c1
803 nmdc:mga0n895_7062_c1
804 nmdc:mga0rr50_218276_c1
805 nmdc:mga0a205_154787_c1
806 Ga0495601_0020571
807 Ga0495655_0001622
808 Ga0495619_0074977
809 Ga0495619_0112604
810 Ga0500643_016232
811 Ga0500562_013448
812 Ga0500593_012928
813 Ga0501084_0661653
814 Ga0501082_0082760
815 Ga0501082_0107564
816 Ga0501082_0180592
817 Ga0501082_0454477
818 Ga0530510_0107158
819 Ga0530510_0162071
820 2774871623
821 2842694402
822 2909045943

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

60

240

0.92

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

57

184

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qh8-assembly1.cif.gz_A crystal structure of a beta-lactamase-like protein bound to amp from brucella melitensis, long wavelength synchrotron data 0.9851 2 262
3qh8-assembly1.cif.gz_A crystal structure of a beta-lactamase-like protein bound to amp from brucella melitensis, long wavelength synchrotron data 0.9632 2 262
6b9v-assembly1.cif.gz_A crystal structure of a new diphosphatase from the phnp family 0.9487 2 260
6b9v-assembly1.cif.gz_B crystal structure of a new diphosphatase from the phnp family 0.9429 2 264
6b9v-assembly1.cif.gz_B crystal structure of a new diphosphatase from the phnp family 0.9212 2 264
ID Description Score Start End Superfamily
3py6A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9852 2 262 3.60.15.10
3py6A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9633 2 262 3.60.15.10
af_O74545_3_299_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9197 2 262 3.60.15.10
af_C4J9M0_89_373_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9037 2 263 3.60.15.10
af_O74545_3_299_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8998 2 262 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A6J4KXZ5-F1-model_v4 Metal-dependent hydrolases of the beta-lactamase superfamily I PhnP protein 0.9974 196 262 GO:0016787
AF-A0A3M1PQR0-F1-model_v4 MBL fold metallo-hydrolase 0.9971 198 262 GO:0016787
AF-A0A527Y641-F1-model_v4 MBL fold metallo-hydrolase 0.9963 192 262 GO:0016787
AF-A0A537PAK9-F1-model_v4 YchF/TatD family DNA exonuclease 0.9957 27 263 GO:0004527
GO:0004536
GO:0005829
AF-A0A1M3NP87-F1-model_v4 Phosphoribosyl 1,2-cyclic phosphodiesterase 0.9947 20 262

Map