F437604

General Info

Members Datasets Scaffolds Average Seq Length
411 341 822 322

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0074265|Ga0495580_0074265_1149_2207
Length 352
Sequence MLIAAARHRSDVFHPRRNTTMLSIFHHRPFGRAALTLVASVAFVCALAAPDSAVAQQKFVTIGTGGVTGVYYAVGGAICRLVNKDRAKHGLRCSVESTGGSVYNVNTIKAGELDFGLSQSDVQYQSYKGTGPFKEAYGDLRAVMSVHPEPFTVVARKEANIKTFADFKGKRFNVGNPGSGTRSAMDELLIGLNMKISDFALASELKADEHGPALCDNKIDGFFYGVGHPSANIQDPTTACGAKLVSLTGPAIDDLVKKNPYYAYATIPGGMYANNPDPTKTYGVLATLVTSTKVPADVVYVITKAVFDNFDEFKKLHPAFANLDPKTMVQDGLSAPLHEGAARYYKEKGWIK

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
5 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
9 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
10 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
11 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
15 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
19 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
45 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
47 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
51 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
52 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
53 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
60 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
61 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
62 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
63 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
64 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
65 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
66 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
67 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
68 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
69 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
70 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
71 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
72 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
73 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
83 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
84 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
85 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
95 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
130 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
131 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
134 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
135 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
146 2508501050 Microvirga lupini Lut6 Isolate Nodule
147 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
148 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
149 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
150 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
151 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
152 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
153 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
154 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
155 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
156 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
157 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
158 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
159 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
160 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
161 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
162 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
163 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
164 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
165 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
166 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
167 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
168 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
169 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
170 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
171 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
172 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
173 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
174 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
175 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
176 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
177 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
178 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
179 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
180 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
181 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
182 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
183 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
184 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
185 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
186 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
187 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
188 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
189 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
190 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
191 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
192 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
193 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
194 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
195 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
196 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
197 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
198 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
199 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
200 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
201 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
202 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
203 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
204 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
205 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
206 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
207 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
208 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
209 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
210 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
211 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
212 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
213 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
214 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
215 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
216 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
217 2932401849 Devosia sp. 2618 Isolate Rhizosphere
218 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
219 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
220 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
221 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
222 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
223 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
224 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
225 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
226 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
227 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
228 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
229 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
230 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
231 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
232 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
233 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
234 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
235 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
236 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
237 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
238 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
239 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
240 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
241 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
242 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
243 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
244 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
245 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
246 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
247 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
248 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
249 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
250 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
251 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
252 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
253 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
254 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
255 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
256 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
257 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
258 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
259 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
260 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
261 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
262 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
263 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
264 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
265 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
266 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
267 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
268 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
269 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
270 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
271 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
272 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
273 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
274 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
275 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
276 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
277 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
278 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
279 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
280 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
281 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
282 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
283 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
284 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
285 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
286 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
287 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
288 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
289 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
290 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
291 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
292 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
293 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
294 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
295 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
296 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
297 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
298 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
299 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
300 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
301 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
302 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
303 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
304 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
305 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
306 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
307 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
308 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
309 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
310 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
311 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
312 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
313 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
314 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
315 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
316 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
317 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
318 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
319 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
320 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
321 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
322 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
323 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
324 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
325 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
326 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
327 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
328 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
329 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
330 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
331 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
332 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
333 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
334 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
335 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
336 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
337 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
338 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
339 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
340 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
341 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.07
Metatranscriptomes 0
Isolates 47.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.33
Nodule 48.42
Rhizoplane 1.95
Rhizosphere 42.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0074265 3300046472 Bacteria 2373
2 Ga0070658_10161459 3300005327 Bacteria 1880
3 Ga0070668_100129308 3300005347 Bacteria 2026
4 Ga0070708_100011404 3300005445 Bacteria 7232
5 Ga0070663_100167063 3300005455 Bacteria 1698
6 Ga0070706_100082095 3300005467 Bacteria 2986
7 Ga0068855_100008578 3300005563 Bacteria 12358
8 Ga0068855_100106362 3300005563 Bacteria 3225
9 Ga0068859_100025284 3300005617 Bacteria 5956
10 Ga0068858_100371989 3300005842 Bacteria 1371
11 Ga0068860_100056089 3300005843 Bacteria 3747
12 Ga0068860_100516778 3300005843 Bacteria 1194
13 Ga0068862_100127534 3300005844 Bacteria 2248
14 Ga0081455_10000042 3300005937 Bacteria 133329
15 Ga0075365_10009157 3300006038 Bacteria 5673
16 Ga0075368_10022242 3300006042 Bacteria 2413
17 Ga0075368_10031205 3300006042 Bacteria 2065
18 Ga0075363_100004500 3300006048 Bacteria 6110
19 Ga0075363_100011530 3300006048 Bacteria 4235
20 Ga0075363_100014960 3300006048 Bacteria 3805
21 Ga0075364_10022692 3300006051 Bacteria 3967
22 Ga0075367_10002799 3300006178 Bacteria 8091
23 Ga0075367_10083951 3300006178 Bacteria 1930
24 Ga0075366_10120180 3300006195 Bacteria 1583
25 Ga0075366_10197214 3300006195 Bacteria 1224
26 Ga0075370_10002745 3300006353 Bacteria 8243
27 Ga0075428_100004374 3300006844 Bacteria 15594
28 Ga0075428_100103828 3300006844 Bacteria 3099
29 Ga0075431_100000021 3300006847 Bacteria 82774
30 Ga0075431_100001416 3300006847 Bacteria 22029
31 Ga0075431_100029012 3300006847 Bacteria 5691
32 Ga0075431_100079274 3300006847 Bacteria 3390
33 Ga0075433_10009462 3300006852 Bacteria 7788
34 Ga0075434_100002199 3300006871 Bacteria 16994
35 Ga0097620_100025285 3300006931 Bacteria 5956
36 Ga0105240_10003161 3300009093 Bacteria 25902
37 Ga0111539_10004677 3300009094 Bacteria 17885
38 Ga0111539_10083117 3300009094 Bacteria 3766
39 Ga0105245_10096672 3300009098 Bacteria 2726
40 Ga0114129_10000068 3300009147 Bacteria 93579
41 Ga0114129_10049204 3300009147 Bacteria 5924
42 Ga0114129_10222237 3300009147 Bacteria 2547
43 Ga0114129_10328678 3300009147 Bacteria 2031
44 Ga0105243_10031389 3300009148 Bacteria 4096
45 Ga0105238_10022264 3300009551 Bacteria 6461
46 Ga0105028_104332 3300009993 Bacteria 1478
47 Ga0157370_10090510 3300013104 Bacteria 2873
48 Ga0228710_1002119 3300022740 Bacteria 30942
49 Ga0207695_10278136 3300025913 Bacteria 1568
50 Ga0207662_10049307 3300025918 Bacteria 2498
51 Ga0207694_10154975 3300025924 Bacteria 1847
52 Ga0207709_10072567 3300025935 Bacteria 2190
53 Ga0207691_10221635 3300025940 Bacteria 1640
54 Ga0207667_10047282 3300025949 Bacteria 4554
55 Ga0207667_10135714 3300025949 Bacteria 2534
56 Ga0207712_10405421 3300025961 Bacteria 1147
57 Ga0207668_10073120 3300025972 Bacteria 2456
58 Ga0207678_10182652 3300026067 Bacteria 1791
59 Ga0207675_100051957 3300026118 Bacteria 3825
60 Ga0209281_1000111 3300027111 Bacteria 215615
61 Ga0209281_1000185 3300027111 Bacteria 144489
62 Ga0209981_1013706 3300027378 Bacteria 1129
63 Ga0209282_1000012 3300027666 Bacteria 215614
64 Ga0209813_10001117 3300027866 Bacteria 5987
65 Ga0209813_10006855 3300027866 Bacteria 2824
66 Ga0209813_10012717 3300027866 Bacteria 2232
67 Ga0207428_10001639 3300027907 Bacteria 23286
68 Ga0207428_10034478 3300027907 Bacteria 4147
69 Ga0268265_10071149 3300028380 Bacteria 2708
70 Ga0316575_10002137 3300031665 Bacteria 6594
71 Ga0316579_10000497 3300031691 Bacteria 12848
72 Ga0307413_10097292 3300031824 Bacteria 1935
73 Ga0307406_10399767 3300031901 Bacteria 1089
74 Ga0307412_10114977 3300031911 Bacteria 1928
75 Ga0307412_10164364 3300031911 Bacteria 1653
76 Ga0315914_1000007 3300031967 Bacteria 215597
77 Ga0307409_100033768 3300031995 Bacteria 3727
78 Ga0307409_100126986 3300031995 Bacteria 2171
79 Ga0307416_100021517 3300032002 Bacteria 4633
80 Ga0307416_100044003 3300032002 Bacteria 3502
81 Ga0307414_10162599 3300032004 Bacteria 1775
82 Ga0315913_1000003 3300033430 Bacteria 215608
83 Ga0315915_1000011 3300033464 Bacteria 215597
84 Ga0373938_0007198 3300034957 Bacteria 1951
85 Ga0373926_0111779 3300035083 Bacteria 1027
86 Ga0373940_0009132 3300035088 Bacteria 2297
87 Ga0373944_0037508 3300035089 Bacteria 1485
88 Ga0373932_0006856 3300035112 Bacteria 2705
89 Ga0373932_0028460 3300035112 Bacteria 1536
90 Ga0373939_0000554 3300035114 Bacteria 9348
91 Ga0373939_0037367 3300035114 Bacteria 1442
92 Ga0373945_0015011 3300035116 Bacteria 2602
93 Ga0373956_0070048 3300035119 Bacteria 1600
94 Ga0373946_0039979 3300035171 Bacteria 1917
95 Ga0373961_0045647 3300035241 Bacteria 1282
96 Ga0373962_0018221 3300035242 Bacteria 1826
97 Ga0373924_0003324 3300035410 Bacteria 5519
98 Ga0373931_0006231 3300035691 Bacteria 5560
99 Ga0373927_0017747 3300035695 Bacteria 4682
100 Ga0373947_0033118 3300035725 Bacteria 3049
101 Ga0373925_0023776 3300037068 Bacteria 4470
102 Ga0373925_0049880 3300037068 Bacteria 3121
103 Ga0373925_0064992 3300037068 Bacteria 2748
104 Ga0373925_0065530 3300037068 Bacteria 2736
105 Ga0395899_0003260 3300037312 Bacteria 12869
106 Ga0395899_0073319 3300037312 Bacteria 2504
107 Ga0395900_0006794 3300037418 Bacteria 11873
108 Ga0395898_0005852 3300037466 Bacteria 13224
109 Ga0395898_0036926 3300037466 Bacteria 4849
110 Ga0395898_0063122 3300037466 Bacteria 3595
111 Ga0395905_0000065 3300037471 Bacteria 184928
112 Ga0395905_0001297 3300037471 Bacteria 30740
113 Ga0395905_0018028 3300037471 Bacteria 6702
114 Ga0395901_0021275 3300038443 Bacteria 6643
115 Ga0395901_0070828 3300038443 Bacteria 3633
116 Ga0395901_0091345 3300038443 Bacteria 3187
117 Ga0395901_0193215 3300038443 Bacteria 2134
118 Ga0400483_002488 3300039062 Bacteria 2274
119 Ga0439445_0020350 3300042004 Bacteria 1661
120 Ga0439449_0002879 3300042007 Bacteria 6694
121 Ga0450898_023363 3300042134 Bacteria 1099
122 Ga0451577_0142889 3300042876 Bacteria 2151
123 Ga0453684_0395157 3300044712 Bacteria 1550
124 Ga0495629_0011489 3300046459 Bacteria 6432
125 Ga0495580_0025256 3300046472 Bacteria 4343
126 Ga0495582_0011092 3300046473 Bacteria 4962
127 Ga0495665_0003868 3300046531 Bacteria 8099
128 Ga0495645_0006511 3300046543 Bacteria 8108
129 Ga0495599_0128691 3300046678 Bacteria 1573
130 Ga0495613_0020574 3300046689 Bacteria 4919
131 Ga0495581_0077111 3300047315 Bacteria 1928
132 Ga0495680_0252661 3300047322 Bacteria 1249
133 Ga0495684_0011709 3300047471 Bacteria 6772
134 Ga0495602_0063258 3300048088 Bacteria 3207
135 Ga0496102_0203299 3300048905 Bacteria 1867
136 Ga0496104_0000088 3300048907 Bacteria 88904
137 Ga0496105_0027570 3300048908 Bacteria 4642
138 Ga0496108_0012115 3300048911 Bacteria 7011
139 Ga0496109_0001545 3300048912 Bacteria 19142
140 Ga0496110_0001147 3300048913 Bacteria 18763
141 Ga0496111_0003689 3300048914 Bacteria 9519
142 Ga0496113_0012652 3300048916 Bacteria 5679
143 Ga0501292_016499 3300049515 Bacteria 1162
144 Ga0501033_0084253 3300049570 Bacteria 2330
145 Ga0501033_0422474 3300049570 Bacteria 928
146 Ga0501036_0177335 3300049572 Bacteria 1795
147 Ga0501037_0044401 3300049573 Bacteria 3264
148 Ga0501038_0094454 3300049574 Bacteria 2500
149 Ga0501039_0240071 3300049575 Bacteria 1425
150 Ga0501040_0000006 3300049576 Bacteria 97170
151 Ga0501041_0043019 3300049577 Bacteria 2746
152 Ga0501042_0002135 3300049578 Bacteria 12006
153 Ga0501042_0035142 3300049578 Bacteria 3555
154 Ga0501043_0000004 3300049579 Bacteria 291085
155 Ga0501043_0018173 3300049579 Bacteria 5513
156 Ga0501046_0000050 3300049580 Bacteria 134922
157 Ga0501046_0035237 3300049580 Bacteria 4034
158 Ga0501046_0173592 3300049580 Bacteria 1616
159 Ga0501047_0000012 3300049581 Bacteria 368824
160 Ga0501047_0006487 3300049581 Bacteria 11009
161 Ga0501048_0000348 3300049582 Bacteria 31936
162 Ga0501067_0108216 3300049583 Bacteria 1545
163 Ga0501068_0045361 3300049584 Bacteria 2648
164 Ga0501070_0051020 3300049586 Bacteria 3434
165 Ga0501072_0222604 3300049588 Bacteria 1504
166 Ga0501073_0100480 3300049589 Bacteria 2008
167 Ga0501075_0047874 3300049591 Bacteria 3213
168 Ga0501075_0123883 3300049591 Bacteria 1967
169 Ga0501076_0029432 3300049592 Bacteria 4272
170 Ga0501076_0224200 3300049592 Bacteria 1536
171 Ga0501076_0633514 3300049592 Bacteria 882
172 Ga0501080_0028294 3300049742 Bacteria 5213
173 Ga0501081_0033954 3300049743 Bacteria 3469
174 Ga0501044_0014573 3300049823 Bacteria 8480
175 Ga0501044_0030038 3300049823 Bacteria 5729
176 Ga0501044_0129657 3300049823 Bacteria 2517
177 Ga0501045_0157018 3300049824 Bacteria 1693
178 nmdc:mga03n38_16188_c1 3300050490 Bacteria 2897
179 nmdc:mga03n38_37719_c1 3300050490 Bacteria 2086
180 nmdc:mga03n38_893_c1 3300050490 Bacteria 7064
181 nmdc:mga00v17_18248_c1 3300050491 Bacteria 3982
182 nmdc:mga0k408_38252_c1 3300050493 Bacteria 2754
183 nmdc:mga06z11_3984_c1 3300050494 Bacteria 5764
184 nmdc:mga06z11_6880_c1 3300050494 Bacteria 4651
185 nmdc:mga04h51_1842_c1 3300050495 Bacteria 4959
186 nmdc:mga04h51_2385_c1 3300050495 Bacteria 4452
187 nmdc:mga07m45_4935_c1 3300050496 Bacteria 6574
188 nmdc:mga05p37_122252_c1 3300050507 Bacteria 3197
189 nmdc:mga05p37_368382_c1 3300050507 Bacteria 1687
190 nmdc:mga05p37_52_c1 3300050507 Bacteria 102932
191 nmdc:mga05p37_570527_c1 3300050507 Bacteria 1284
192 nmdc:mga06r32_33175_c1 3300050510 Bacteria 4861
193 nmdc:mga06r32_379415_c1 3300050510 Bacteria 1397
194 nmdc:mga06r32_4_c1 3300050510 Bacteria 144637
195 nmdc:mga06r32_68212_c1 3300050510 Bacteria 3435
196 nmdc:mga08y16_1102_c1 3300050511 Bacteria 26611
197 nmdc:mga08y16_73544_c1 3300050511 Bacteria 3562
198 nmdc:mga08y16_822_c1 3300050511 Bacteria 29788
199 nmdc:mga0n895_30122_c1 3300050512 Bacteria 5183
200 Ga0495619_0063358 3300053085 Bacteria 2463
201 Ga0500641_0020308 3300053096 Bacteria 2521
202 Ga0501084_0512052 3300054114 Bacteria 1014
203 Ga0590071_009788 3300059421 Bacteria 2249
204 Ga0590071_013752 3300059421 Bacteria 1896
205 Ga0590071_023935 3300059421 Bacteria 1446
206 Ga0501082_0005239 3300060353 Bacteria 11267
207 Ga0501082_0095824 3300060353 Bacteria 2565
208 Ga0501082_0127987 3300060353 Bacteria 2203
209 Ga0501082_0156460 3300060353 Bacteria 1980
210 Ga0501082_0374015 3300060353 Bacteria 1243
211 Ga0530510_0039467 3300061734 Bacteria 3408
212 Ga0530510_0104114 3300061734 Bacteria 2076
213 Ga0530510_0108028 3300061734 Bacteria 2037
214 Ga0530510_0312516 3300061734 Bacteria 1177
215 2508734792 2508501050 Bacteria 9633614
216 2510303081 2510065057 Bacteria 6649661
217 2511497079 2511231052 Bacteria 6974333
218 2512529546 2512047086 Bacteria 6850303
219 2512968892 2512875026 Bacteria 6861065
220 2513582751 2513237086 Bacteria 7265287
221 2513606892 2513237089 Bacteria 6553624
222 2513882320 2513237140 Bacteria 7076289
223 2513901743 2513237143 Bacteria 6664116
224 2513910848 2513237144 Bacteria 7530820
225 2513988161 2513237156 Bacteria 6402557
226 2514006057 2513237160 Bacteria 6650282
227 2515611668 2515154107 Bacteria 6795637
228 2516895691 2516653046 Bacteria 6989037
229 2517566356 2517487022 Bacteria 7227575
230 2524449325 2524023207 Bacteria 6813453
231 2551678841 2551306084 Bacteria 8942552
232 2551682079 2551306084 Bacteria 8942552
233 2551683390 2551306085 Bacteria 7347181
234 2551690676 2551306086 Bacteria 6843938
235 2551700391 2551306087 Bacteria 7351905
236 2551712459 2551306089 Bacteria 7162724
237 2551719213 2551306090 Bacteria 7953713
238 2551726065 2551306091 Bacteria 7086830
239 2551733196 2551306092 Bacteria 6992595
240 2551745962 2551306093 Bacteria 7064773
241 2802719738 2802428858 Bacteria 6636079
242 2802727740 2802428859 Bacteria 6667919
243 2802733567 2802428860 Bacteria 6525526
244 2802738798 2802428861 Bacteria 6534206
245 2802745602 2802428862 Bacteria 6633353
246 2802751367 2802428863 Bacteria 6410669
247 2855829493 2855825444 Bacteria 6785811
248 2855844592 2855839649 Bacteria 7135830
249 2858805947 2858800743 Bacteria 6603254
250 2915982148 2915980308 Bacteria 6624279
251 2915988909 2915986958 Bacteria 6739310
252 2916000466 2915993759 Bacteria 7016183
253 2916003383 2916000859 Bacteria 6865702
254 2916007792 2916007675 Bacteria 6898660
255 2916031978 2916028427 Bacteria 6748433
256 2916037391 2916035215 Bacteria 6755766
257 2916042153 2916041962 Bacteria 6820487
258 2916048925 2916048683 Bacteria 6543552
259 2916059565 2916055098 Bacteria 6758838
260 2916062503 2916061851 Bacteria 6737736
261 2916069335 2916068649 Bacteria 6943657
262 2916078968 2916076590 Bacteria 6596108
263 2920767215 2920760137 Bacteria 7427611
264 2921203138 2921201388 Bacteria 6926299
265 2921212747 2921208531 Bacteria 6745326
266 2921242176 2921237296 Bacteria 6876710
267 2921246353 2921244191 Bacteria 6568419
268 2921256692 2921250672 Bacteria 6677771
269 2921259320 2921257292 Bacteria 6808382
270 2921269750 2921263974 Bacteria 6864552
271 2921286659 2921282425 Bacteria 6826397
272 2921293642 2921289301 Bacteria 7316391
273 2921303101 2921296804 Bacteria 7176999
274 2924148008 2924144063 Bacteria 6883928
275 2924155692 2924150972 Bacteria 7169444
276 2924161842 2924158325 Bacteria 7188855
277 2924165678 2924165586 Bacteria 7260590
278 2924176271 2924172951 Bacteria 6749356
279 2924184301 2924179722 Bacteria 6843264
280 2924186638 2924186466 Bacteria 6876637
281 2924196954 2924193448 Bacteria 6955718
282 2924200671 2924200457 Bacteria 6757188
283 2924207294 2924207177 Bacteria 6917007
284 2924216397 2924214083 Bacteria 7080103
285 2924224216 2924221636 Bacteria 7113495
286 2924229011 2924228884 Bacteria 6633132
287 2932404703 2932401849 Bacteria 4262978
288 2936997179 2936996657 Bacteria 6298727
289 2937009983 2937009748 Bacteria 6746052
290 2937020421 2937016420 Bacteria 6782579
291 2937025302 2937023124 Bacteria 6815156
292 2937033693 2937029754 Bacteria 6424026
293 2937037591 2937036028 Bacteria 6846469
294 2937048374 2937042894 Bacteria 6741576
295 2937050618 2937049772 Bacteria 6757901
296 2937060400 2937056579 Bacteria 7107896
297 2937064061 2937063883 Bacteria 7199456
298 2937071796 2937071275 Bacteria 6984483
299 2937084569 2937078374 Bacteria 6610289
300 2937091535 2937084907 Bacteria 6618516
301 2937095772 2937091812 Bacteria 6979387
302 2937100915 2937098957 Bacteria 7249374
303 2937113168 2937106411 Bacteria 6947143
304 2937119955 2937119839 Bacteria 6597547
305 2937132445 2937126314 Bacteria 6771275
306 2937844935 2937843397 Bacteria 5256375
307 2957381183 2957375807 Bacteria 6425588
308 2957382410 2957382221 Bacteria 6737050
309 2957395383 2957388812 Bacteria 6778072
310 2957400081 2957395598 Bacteria 6822399
311 2957404144 2957402308 Bacteria 6741770
312 2957414923 2957408893 Bacteria 6558585
313 2957419466 2957415311 Bacteria 6991633
314 2957429446 2957422303 Bacteria 7172205
315 2957432169 2957430029 Bacteria 7022557
316 2957439087 2957437181 Bacteria 6568994
317 2957445871 2957443900 Bacteria 6869977
318 2957450973 2957450854 Bacteria 6765715
319 2957462844 2957457609 Bacteria 6967680
320 2957465347 2957464669 Bacteria 6568877
321 2957474916 2957471148 Bacteria 6797643
322 2957478783 2957478035 Bacteria 6756658
323 2957491360 2957484790 Bacteria 6703082
324 2957496729 2957491536 Bacteria 6695180
325 2957498583 2957498199 Bacteria 7126688
326 2957505819 2957505466 Bacteria 7253085
327 2960584145 2960584000 Bacteria 6864594
328 2960596981 2960591022 Bacteria 6622873
329 2960604023 2960603979 Bacteria 6898737
330 2960611083 2960610863 Bacteria 6691244
331 2960622445 2960617483 Bacteria 6727748
332 2960625290 2960624210 Bacteria 6875384
333 2960631518 2960631154 Bacteria 6732508
334 2960640456 2960637947 Bacteria 7296468
335 2960649204 2960645483 Bacteria 7211087
336 2960657757 2960652885 Bacteria 7083688
337 2960663829 2960660292 Bacteria 7041660
338 2960667642 2960667422 Bacteria 6763020
339 2960679250 2960674078 Bacteria 6609048
340 2960682185 2960680706 Bacteria 6624464
341 2960691907 2960687367 Bacteria 6535474
342 2960698014 2960693952 Bacteria 6749742
343 2964614998 2964607997 Bacteria 7101408
344 2964620679 2964615318 Bacteria 6809089
345 2964626753 2964621998 Bacteria 6834995
346 2964629096 2964628898 Bacteria 7083044
347 2964636205 2964636051 Bacteria 7091832
348 2964653835 2964649959 Bacteria 6675118
349 2964662059 2964656573 Bacteria 7100150
350 2964663919 2964663802 Bacteria 7019362
351 2964676896 2964670856 Bacteria 6851364
352 2964678174 2964678106 Bacteria 6792020
353 2964685245 2964685014 Bacteria 6839111
354 2964694152 2964691889 Bacteria 6802758
355 2964710804 2964705432 Bacteria 7114648
356 2964716676 2964712639 Bacteria 6695970
357 2964723427 2964719344 Bacteria 7286602
358 2967666247 2967664464 Bacteria 6948836
359 2967671688 2967671571 Bacteria 7021409
360 2967681393 2967678726 Bacteria 7264382
361 2967689491 2967686174 Bacteria 6678622
362 2967698435 2967693043 Bacteria 6804451
363 2967699886 2967699805 Bacteria 6854538
364 2967708172 2967706974 Bacteria 7186053
365 2967718507 2967714385 Bacteria 7000047
366 2967721492 2967721400 Bacteria 7073753
367 2967730261 2967728569 Bacteria 6641507
368 2967737324 2967735183 Bacteria 6827012
369 2967745207 2967742019 Bacteria 6794534
370 2967749089 2967748971 Bacteria 6733771
371 2967755840 2967755722 Bacteria 6814706
372 2967762400 2967762386 Bacteria 6923502
373 2967769535 2967769361 Bacteria 6587838
374 2967776050 2967775926 Bacteria 6738189
375 2970019831 2970019648 Bacteria 7072033
376 2970028991 2970026789 Bacteria 6785236
377 2970033767 2970033650 Bacteria 7118744
378 2970043952 2970040964 Bacteria 6731123
379 2970050165 2970047711 Bacteria 7088379
380 2970055695 2970054988 Bacteria 6611507
381 2970063769 2970061556 Bacteria 7099761
382 2970068943 2970068827 Bacteria 7123112
383 2970078098 2970076120 Bacteria 6697332
384 2970084376 2970082768 Bacteria 6183754
385 2970091988 2970088815 Bacteria 6933825
386 2970095883 2970095765 Bacteria 6936963
387 2970102795 2970102677 Bacteria 6812532
388 2970111256 2970109326 Bacteria 6863976
389 2970119140 2970116247 Bacteria 6501857
390 2970125655 2970122695 Bacteria 6625855
391 2970135246 2970129317 Bacteria 6806560
392 2970136141 2970136068 Bacteria 7207982
393 2970149481 2970143518 Bacteria 6446480
394 2970152042 2970149975 Bacteria 6779706
395 2970162494 2970156795 Bacteria 7168044
396 2970165569 2970164137 Bacteria 6861252
397 2970171079 2970170962 Bacteria 6876229
398 2970180107 2970177841 Bacteria 6768001
399 2970189578 2970184632 Bacteria 7054431
400 2970191942 2970191845 Bacteria 7032787
401 2977520578 2977516862 Bacteria 6940108
402 2977525956 2977523885 Bacteria 6960446
403 2977534570 2977530762 Bacteria 6951399
404 2977539748 2977537788 Bacteria 6929320
405 2977548879 2977544691 Bacteria 6875412
406 2977556068 2977551784 Bacteria 7125765
407 2977560594 2977558990 Bacteria 6863948
408 2977573633 2977572785 Bacteria 6763888
409 2977585113 2977579622 Bacteria 6772100
410 648735603 648276728 Bacteria 6968865
411 8004004827 8003999396 Bacteria 7063185
412 Ga0495580_0074265
413 Ga0070658_10161459
414 Ga0070668_100129308
415 Ga0070708_100011404
416 Ga0070663_100167063
417 Ga0070706_100082095
418 Ga0068855_100008578
419 Ga0068855_100106362
420 Ga0068859_100025284
421 Ga0068858_100371989
422 Ga0068860_100056089
423 Ga0068860_100516778
424 Ga0068862_100127534
425 Ga0081455_10000042
426 Ga0075365_10009157
427 Ga0075368_10022242
428 Ga0075368_10031205
429 Ga0075363_100004500
430 Ga0075363_100011530
431 Ga0075363_100014960
432 Ga0075364_10022692
433 Ga0075367_10002799
434 Ga0075367_10083951
435 Ga0075366_10120180
436 Ga0075366_10197214
437 Ga0075370_10002745
438 Ga0075428_100004374
439 Ga0075428_100103828
440 Ga0075431_100000021
441 Ga0075431_100001416
442 Ga0075431_100029012
443 Ga0075431_100079274
444 Ga0075433_10009462
445 Ga0075434_100002199
446 Ga0097620_100025285
447 Ga0105240_10003161
448 Ga0111539_10004677
449 Ga0111539_10083117
450 Ga0105245_10096672
451 Ga0114129_10000068
452 Ga0114129_10049204
453 Ga0114129_10222237
454 Ga0114129_10328678
455 Ga0105243_10031389
456 Ga0105238_10022264
457 Ga0105028_104332
458 Ga0157370_10090510
459 Ga0228710_1002119
460 Ga0207695_10278136
461 Ga0207662_10049307
462 Ga0207694_10154975
463 Ga0207709_10072567
464 Ga0207691_10221635
465 Ga0207667_10047282
466 Ga0207667_10135714
467 Ga0207712_10405421
468 Ga0207668_10073120
469 Ga0207678_10182652
470 Ga0207675_100051957
471 Ga0209281_1000111
472 Ga0209281_1000185
473 Ga0209981_1013706
474 Ga0209282_1000012
475 Ga0209813_10001117
476 Ga0209813_10006855
477 Ga0209813_10012717
478 Ga0207428_10001639
479 Ga0207428_10034478
480 Ga0268265_10071149
481 Ga0316575_10002137
482 Ga0316579_10000497
483 Ga0307413_10097292
484 Ga0307406_10399767
485 Ga0307412_10114977
486 Ga0307412_10164364
487 Ga0315914_1000007
488 Ga0307409_100033768
489 Ga0307409_100126986
490 Ga0307416_100021517
491 Ga0307416_100044003
492 Ga0307414_10162599
493 Ga0315913_1000003
494 Ga0315915_1000011
495 Ga0373938_0007198
496 Ga0373926_0111779
497 Ga0373940_0009132
498 Ga0373944_0037508
499 Ga0373932_0006856
500 Ga0373932_0028460
501 Ga0373939_0000554
502 Ga0373939_0037367
503 Ga0373945_0015011
504 Ga0373956_0070048
505 Ga0373946_0039979
506 Ga0373961_0045647
507 Ga0373962_0018221
508 Ga0373924_0003324
509 Ga0373931_0006231
510 Ga0373927_0017747
511 Ga0373947_0033118
512 Ga0373925_0023776
513 Ga0373925_0049880
514 Ga0373925_0064992
515 Ga0373925_0065530
516 Ga0395899_0003260
517 Ga0395899_0073319
518 Ga0395900_0006794
519 Ga0395898_0005852
520 Ga0395898_0036926
521 Ga0395898_0063122
522 Ga0395905_0000065
523 Ga0395905_0001297
524 Ga0395905_0018028
525 Ga0395901_0021275
526 Ga0395901_0070828
527 Ga0395901_0091345
528 Ga0395901_0193215
529 Ga0400483_002488
530 Ga0439445_0020350
531 Ga0439449_0002879
532 Ga0450898_023363
533 Ga0451577_0142889
534 Ga0453684_0395157
535 Ga0495629_0011489
536 Ga0495580_0025256
537 Ga0495582_0011092
538 Ga0495665_0003868
539 Ga0495645_0006511
540 Ga0495599_0128691
541 Ga0495613_0020574
542 Ga0495581_0077111
543 Ga0495680_0252661
544 Ga0495684_0011709
545 Ga0495602_0063258
546 Ga0496102_0203299
547 Ga0496104_0000088
548 Ga0496105_0027570
549 Ga0496108_0012115
550 Ga0496109_0001545
551 Ga0496110_0001147
552 Ga0496111_0003689
553 Ga0496113_0012652
554 Ga0501292_016499
555 Ga0501033_0084253
556 Ga0501033_0422474
557 Ga0501036_0177335
558 Ga0501037_0044401
559 Ga0501038_0094454
560 Ga0501039_0240071
561 Ga0501040_0000006
562 Ga0501041_0043019
563 Ga0501042_0002135
564 Ga0501042_0035142
565 Ga0501043_0000004
566 Ga0501043_0018173
567 Ga0501046_0000050
568 Ga0501046_0035237
569 Ga0501046_0173592
570 Ga0501047_0000012
571 Ga0501047_0006487
572 Ga0501048_0000348
573 Ga0501067_0108216
574 Ga0501068_0045361
575 Ga0501070_0051020
576 Ga0501072_0222604
577 Ga0501073_0100480
578 Ga0501075_0047874
579 Ga0501075_0123883
580 Ga0501076_0029432
581 Ga0501076_0224200
582 Ga0501076_0633514
583 Ga0501080_0028294
584 Ga0501081_0033954
585 Ga0501044_0014573
586 Ga0501044_0030038
587 Ga0501044_0129657
588 Ga0501045_0157018
589 nmdc:mga03n38_16188_c1
590 nmdc:mga03n38_37719_c1
591 nmdc:mga03n38_893_c1
592 nmdc:mga00v17_18248_c1
593 nmdc:mga0k408_38252_c1
594 nmdc:mga06z11_3984_c1
595 nmdc:mga06z11_6880_c1
596 nmdc:mga04h51_1842_c1
597 nmdc:mga04h51_2385_c1
598 nmdc:mga07m45_4935_c1
599 nmdc:mga05p37_122252_c1
600 nmdc:mga05p37_368382_c1
601 nmdc:mga05p37_52_c1
602 nmdc:mga05p37_570527_c1
603 nmdc:mga06r32_33175_c1
604 nmdc:mga06r32_379415_c1
605 nmdc:mga06r32_4_c1
606 nmdc:mga06r32_68212_c1
607 nmdc:mga08y16_1102_c1
608 nmdc:mga08y16_73544_c1
609 nmdc:mga08y16_822_c1
610 nmdc:mga0n895_30122_c1
611 Ga0495619_0063358
612 Ga0500641_0020308
613 Ga0501084_0512052
614 Ga0590071_009788
615 Ga0590071_013752
616 Ga0590071_023935
617 Ga0501082_0005239
618 Ga0501082_0095824
619 Ga0501082_0127987
620 Ga0501082_0156460
621 Ga0501082_0374015
622 Ga0530510_0039467
623 Ga0530510_0104114
624 Ga0530510_0108028
625 Ga0530510_0312516
626 2508734792
627 2510303081
628 2511497079
629 2512529546
630 2512968892
631 2513582751
632 2513606892
633 2513882320
634 2513901743
635 2513910848
636 2513988161
637 2514006057
638 2515611668
639 2516895691
640 2517566356
641 2524449325
642 2551678841
643 2551682079
644 2551683390
645 2551690676
646 2551700391
647 2551712459
648 2551719213
649 2551726065
650 2551733196
651 2551745962
652 2802719738
653 2802727740
654 2802733567
655 2802738798
656 2802745602
657 2802751367
658 2855829493
659 2855844592
660 2858805947
661 2915982148
662 2915988909
663 2916000466
664 2916003383
665 2916007792
666 2916031978
667 2916037391
668 2916042153
669 2916048925
670 2916059565
671 2916062503
672 2916069335
673 2916078968
674 2920767215
675 2921203138
676 2921212747
677 2921242176
678 2921246353
679 2921256692
680 2921259320
681 2921269750
682 2921286659
683 2921293642
684 2921303101
685 2924148008
686 2924155692
687 2924161842
688 2924165678
689 2924176271
690 2924184301
691 2924186638
692 2924196954
693 2924200671
694 2924207294
695 2924216397
696 2924224216
697 2924229011
698 2932404703
699 2936997179
700 2937009983
701 2937020421
702 2937025302
703 2937033693
704 2937037591
705 2937048374
706 2937050618
707 2937060400
708 2937064061
709 2937071796
710 2937084569
711 2937091535
712 2937095772
713 2937100915
714 2937113168
715 2937119955
716 2937132445
717 2937844935
718 2957381183
719 2957382410
720 2957395383
721 2957400081
722 2957404144
723 2957414923
724 2957419466
725 2957429446
726 2957432169
727 2957439087
728 2957445871
729 2957450973
730 2957462844
731 2957465347
732 2957474916
733 2957478783
734 2957491360
735 2957496729
736 2957498583
737 2957505819
738 2960584145
739 2960596981
740 2960604023
741 2960611083
742 2960622445
743 2960625290
744 2960631518
745 2960640456
746 2960649204
747 2960657757
748 2960663829
749 2960667642
750 2960679250
751 2960682185
752 2960691907
753 2960698014
754 2964614998
755 2964620679
756 2964626753
757 2964629096
758 2964636205
759 2964653835
760 2964662059
761 2964663919
762 2964676896
763 2964678174
764 2964685245
765 2964694152
766 2964710804
767 2964716676
768 2964723427
769 2967666247
770 2967671688
771 2967681393
772 2967689491
773 2967698435
774 2967699886
775 2967708172
776 2967718507
777 2967721492
778 2967730261
779 2967737324
780 2967745207
781 2967749089
782 2967755840
783 2967762400
784 2967769535
785 2967776050
786 2970019831
787 2970028991
788 2970033767
789 2970043952
790 2970050165
791 2970055695
792 2970063769
793 2970068943
794 2970078098
795 2970084376
796 2970091988
797 2970095883
798 2970102795
799 2970111256
800 2970119140
801 2970125655
802 2970135246
803 2970136141
804 2970149481
805 2970152042
806 2970162494
807 2970165569
808 2970171079
809 2970180107
810 2970189578
811 2970191942
812 2977520578
813 2977525956
814 2977534570
815 2977539748
816 2977548879
817 2977556068
818 2977560594
819 2977573633
820 2977585113
821 648735603
822 8004004827

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16868

NMT1_3

NMT1-like family

62

349

0.98

PF09084

NMT1

NMT1/THI5 like

87

240

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1us5-assembly1.cif.gz_A putative glur0 ligand binding core with l-glutamate 0.9403 37 331
4ddd-assembly1.cif.gz_A crystal structure of an immunogenic protein from ehrlichia chaffeensis 0.9334 34 332
1us5-assembly1.cif.gz_A putative glur0 ligand binding core with l-glutamate 0.9312 37 331
4ddd-assembly1.cif.gz_A crystal structure of an immunogenic protein from ehrlichia chaffeensis 0.9275 34 332
5tpi-assembly1.cif.gz_A-2 1.47 angstrom crystal structure of the c-terminal substrate binding domain of lysr family transcriptional regulator from klebsiella pneumoniae. 0.7357 37 293
ID Description Score Start End Superfamily
4dddA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9529 127 264 3.40.190.10
1us4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9409 127 264 3.40.190.10
4dddA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9397 127 264 3.40.190.10
1us4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9279 127 264 3.40.190.10
4dddA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9167 34 332 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7W0X3T7-F1-model_v4 TAXI family TRAP transporter solute-binding subunit 0.9919 119 332
AF-A0A7W0X3T7-F1-model_v4 TAXI family TRAP transporter solute-binding subunit 0.9873 119 332
AF-A0A661RTM8-F1-model_v4 deleted 0.9854 52 331
AF-A0A3N5HZ40-F1-model_v4 TAXI family TRAP transporter solute-binding subunit 0.9852 60 331
AF-A0A2N3CLB9-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.9849 173 332

Map