F437607

General Info

Members Datasets Scaffolds Average Seq Length
411 352 822 171

Family's Representative Sequence

Representative Sequence 3300046530|Ga0495654_0000231|Ga0495654_0000231_18111_18719
Length 202
Sequence MNSNKIIFKAKAREKMPLFRVQNPRQQSIVTVRTAPGNRQRAIISVDGLTIRAAIGRSGVTAFKREGDGATPIASMKLISGFARGERIRLPQTPLSMKRISADMLWCDAPEHAAYNRPVRQRPGAGFKPSHEEMMRADGLYDVCLVMDWNITSRKRNAGSAIFFHLIKPGYQPTAGCIAVHPRDMQRLLPHLRRGTVVRVLG

Samples

Sample ID Description Type Environment
1 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
32 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
39 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
46 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
47 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
49 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
50 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
51 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
52 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
58 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
59 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
60 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
61 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
62 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
63 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
64 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
65 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
66 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
67 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
68 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
69 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
70 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
71 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
72 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
73 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
74 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
75 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
76 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
77 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
78 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
79 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
80 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
81 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
84 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
85 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
86 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
87 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
88 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
89 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
90 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
91 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
92 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
93 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
94 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
95 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
96 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
97 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
98 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
99 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
102 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
103 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
106 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
107 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
108 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
114 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
117 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
118 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
119 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
120 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
121 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
122 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
123 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
124 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
125 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
128 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
132 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
133 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
134 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
135 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
136 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
137 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
138 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
139 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
140 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
141 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
142 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
143 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
144 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
145 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
146 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
147 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
148 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
149 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
150 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
151 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
152 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
153 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
154 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
155 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
156 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
157 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
158 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
160 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
161 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
162 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
163 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
164 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
165 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
166 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
167 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
168 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
169 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
170 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
171 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
172 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
173 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
174 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
175 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
176 2519899620 Rhizobium sp. Pop5 Isolate Nodule
177 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
178 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
179 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
180 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
181 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
182 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
183 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
184 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
185 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
186 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
187 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
188 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
189 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
190 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
191 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
192 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
193 2643221582 Rhizobium sp. Root651 Isolate Unclassified
194 2643221599 Rhizobium sp. Root708 Isolate Unclassified
195 2643221688 Rhizobium sp. Root482 Isolate Unclassified
196 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
197 2643221693 Rhizobium sp. Root491 Isolate Unclassified
198 2718217882 Rhizobium sp. N741 Isolate Nodule
199 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
200 2718218009 Rhizobium sp. N561 Isolate Nodule
201 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
202 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
203 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
204 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
205 2718218363 Rhizobium sp. N113 Isolate Nodule
206 2718218365 Rhizobium sp. N731 Isolate Nodule
207 2718218366 Rhizobium sp. N621 Isolate Nodule
208 2721755514 Rhizobium sp. N6212 Isolate Nodule
209 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
210 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
211 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
212 2721755810 Rhizobium sp. N871 Isolate Nodule
213 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
214 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
215 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
216 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
217 2728369365 Rhizobium sp. N1341 Isolate Nodule
218 2728369397 Rhizobium sp. N1314 Isolate Nodule
219 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
220 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
221 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
222 2791355256 Rhizobium sp. M10 Isolate Nodule
223 2791355260 Rhizobium sp. L9 Isolate Nodule
224 2791355261 Rhizobium sp. J15 Isolate Nodule
225 2791355262 Rhizobium sp. M1 Isolate Nodule
226 2791355264 Rhizobium sp. S9 Isolate Nodule
227 2791355265 Rhizobium sp. H4 Isolate Nodule
228 2802429633 Rhizobium anhuiense J3 Isolate Nodule
229 2802429634 Rhizobium anhuiense S10 Isolate Nodule
230 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
231 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
232 2802429637 Rhizobium anhuiense C15 Isolate Nodule
233 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
234 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
235 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
236 2838048938 Rhizobium pisi 27/80 Isolate Nodule
237 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
238 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
239 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
240 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
241 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
242 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
243 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
244 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
245 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
246 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
247 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
248 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
249 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
250 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
251 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
252 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
253 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
254 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
255 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
256 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
257 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
258 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
259 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
260 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
261 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
262 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
263 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
264 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
265 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
266 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
267 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
268 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
269 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
270 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
271 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
272 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
273 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
274 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
275 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
276 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
277 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
278 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
279 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
280 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
281 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
282 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
283 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
284 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
285 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
286 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
287 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
288 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
289 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
290 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
291 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
292 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
293 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
294 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
295 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
296 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
297 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
298 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
299 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
300 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
301 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
302 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
303 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
304 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
305 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
306 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
307 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
308 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
309 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
310 2933599457 Rhizobium phaseoli M3 Isolate Nodule
311 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
312 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
313 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
314 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
315 2936381700 Rhizobium chutanense C16 Isolate Unclassified
316 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
317 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
318 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
319 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
320 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
321 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
322 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
323 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
324 2996893221 Rhizobium sp. R635 Isolate Nodule
325 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
326 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
327 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
328 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
329 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
330 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
331 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
332 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
333 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
334 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
335 8005382845 Rhizobium sp. R634 Isolate Nodule
336 8005395548 Rhizobium sp. R339 Isolate Nodule
337 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
338 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
339 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
340 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
341 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
342 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
343 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
344 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
345 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
346 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
347 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
348 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
349 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
350 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
351 8056382006 Rhizobium croatiense 13T Isolate Nodule
352 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.55
Metatranscriptomes 0.24
Isolates 47.2

Biome Distribution

Category Percentage (%)
Aerial Root 1.22
Bulb 0
Endosphere 16.55
Nodule 34.79
Rhizoplane 2.43
Rhizosphere 28.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495654_0000231 3300046530 Bacteria 52162
2 JGI25155J39150_1000004 3300002704 Bacteria 269098
3 JGI25150J39212_1010161 3300002774 Bacteria 1759
4 JGI25151J46595_10013605 3300003187 Bacteria 3656
5 rootH1_10153885 3300003316 Bacteria 1599
6 rootL2_10199211 3300003322 Bacteria 1440
7 rootL2_10236953 3300003322 Bacteria 1083
8 JGI25160J50197_1010078 3300003354 Bacteria 3448
9 Ga0055526_1005398 3300003771 Bacteria 7358
10 Ga0055536_1001690 3300003781 Bacteria 13057
11 Ga0055540_1001518 3300003792 Bacteria 13685
12 Ga0058692_1004658 3300003856 Bacteria 4040
13 Ga0065165_1006475 3300005262 Bacteria 6126
14 Ga0070658_10288901 3300005327 Bacteria 1397
15 Ga0070666_10554318 3300005335 Bacteria 836
16 Ga0070668_100098384 3300005347 Bacteria 2315
17 Ga0070668_100245686 3300005347 Bacteria 1484
18 Ga0070667_100121932 3300005367 Bacteria 2268
19 Ga0070678_100902270 3300005456 Bacteria 808
20 Ga0070665_100006674 3300005548 Bacteria 11735
21 Ga0070665_100084962 3300005548 Bacteria 3170
22 Ga0075365_10002199 3300006038 Bacteria 9406
23 Ga0075365_10042567 3300006038 Bacteria 2969
24 Ga0075368_10005043 3300006042 Bacteria 4519
25 Ga0075363_100164068 3300006048 Bacteria 1259
26 Ga0075362_10183180 3300006177 Bacteria 1015
27 Ga0075367_10148564 3300006178 Bacteria 1454
28 Ga0075369_10002260 3300006186 Bacteria 6838
29 Ga0075369_10006146 3300006186 Bacteria 4530
30 Ga0075369_10094252 3300006186 Bacteria 1338
31 Ga0075366_10163908 3300006195 Bacteria 1347
32 Ga0075366_10333757 3300006195 Bacteria 929
33 Ga0075370_10075748 3300006353 Bacteria 1929
34 Ga0099826_10001615 3300006948 Bacteria 13773
35 Ga0099826_10178947 3300006948 Bacteria 1182
36 Ga0105240_10000013 3300009093 Bacteria 483458
37 Ga0105243_10039882 3300009148 Bacteria 3664
38 Ga0105249_10073845 3300009553 Bacteria 3155
39 Ga0123341_1000009 3300009765 Bacteria 122597
40 Ga0123342_1005742 3300009766 Bacteria 17739
41 Ga0105246_10065503 3300011119 Bacteria 2541
42 Ga0157373_10009908 3300013100 Bacteria 7025
43 Ga0157373_10277863 3300013100 Bacteria 1186
44 Ga0157371_10000071 3300013102 Bacteria 164088
45 Ga0157370_10000469 3300013104 Bacteria 50288
46 Ga0157369_10060753 3300013105 Bacteria 4075
47 Ga0157369_10702336 3300013105 Bacteria 1041
48 Ga0157369_10876544 3300013105 Bacteria 921
49 Ga0209129_1024774 3300025258 Bacteria 1052
50 Ga0209758_1001119 3300025297 Bacteria 34539
51 Ga0207705_10450626 3300025909 Bacteria 998
52 Ga0207681_10036206 3300025923 Bacteria 3255
53 Ga0207668_10052691 3300025972 Bacteria 2816
54 Ga0207640_10328281 3300025981 Bacteria 1221
55 Ga0209371_1000037 3300027312 Bacteria 367074
56 Ga0209371_1001614 3300027312 Bacteria 14629
57 Ga0209282_1004166 3300027666 Bacteria 8693
58 Ga0209282_1130883 3300027666 Bacteria 1240
59 Ga0209813_10003071 3300027866 Bacteria 3883
60 Ga0268266_10005017 3300028379 Bacteria 12498
61 Ga0268266_10082954 3300028379 Bacteria 2797
62 Ga0307515_10265676 3300028794 Bacteria 1445
63 Ga0268256_1000039 3300030500 Bacteria 354969
64 Ga0268256_1016426 3300030500 Bacteria 2122
65 Ga0316178_1037487 3300030735 Bacteria 1069
66 Ga0316181_1265453 3300030744 Bacteria 2928
67 Ga0316182_1427703 3300030745 Bacteria 1329
68 Ga0307405_10695881 3300031731 Bacteria 841
69 Ga0307410_10256417 3300031852 Bacteria 1362
70 Ga0307409_100359161 3300031995 Bacteria 1377
71 Ga0307416_100591538 3300032002 Bacteria 1188
72 Ga0307416_101444077 3300032002 Bacteria 794
73 Ga0307414_10358764 3300032004 Bacteria 1253
74 Ga0439436_0009011 3300041404 Bacteria 3060
75 Ga0439447_031648 3300041407 Bacteria 1327
76 Ga0439466_0233328 3300041411 Bacteria 558
77 Ga0451787_295766 3300041441 Bacteria 1238
78 Ga0451793_0563136 3300041452 Bacteria 1279
79 Ga0451797_0194495 3300041453 Bacteria 761
80 Ga0451807_1897342 3300041486 Bacteria 637
81 Ga0451833_0436083 3300041491 Bacteria 792
82 Ga0451833_0477116 3300041491 Bacteria 913
83 Ga0451837_1116898 3300041494 Bacteria 2026
84 Ga0451839_0295473 3300041496 Bacteria 1949
85 Ga0451841_1368387 3300041498 Bacteria 632
86 Ga0451845_0280731 3300041501 Bacteria 841
87 Ga0451849_0036077 3300041505 Bacteria 866
88 Ga0451843_0241487 3300041509 Bacteria 1495
89 Ga0451855_1070575 3300041511 Bacteria 1866
90 Ga0451853_0336302 3300041512 Bacteria 632
91 Ga0451853_1214367 3300041512 Bacteria 1182
92 Ga0439431_0042457 3300041997 Bacteria 1162
93 Ga0439431_0111710 3300041997 Bacteria 757
94 Ga0439449_0094371 3300042007 Bacteria 1105
95 Ga0450900_048538 3300042136 Bacteria 647
96 Ga0439434_0027563 3300042435 Bacteria 1718
97 Ga0450918_006877 3300042531 Bacteria 2022
98 Ga0495617_030731 3300046452 Bacteria 1805
99 Ga0495627_096903 3300046453 Bacteria 845
100 Ga0495590_0071608 3300046457 Bacteria 1217
101 Ga0495638_0000257 3300046460 Bacteria 71780
102 Ga0495605_0009564 3300046474 Bacteria 5442
103 Ga0495585_0036163 3300046492 Bacteria 2788
104 Ga0495585_0060484 3300046492 Bacteria 2084
105 Ga0495596_0139413 3300046500 Bacteria 941
106 Ga0495607_0068560 3300046501 Bacteria 1989
107 Ga0495607_0137850 3300046501 Bacteria 1262
108 Ga0495583_0033107 3300046506 Bacteria 2488
109 Ga0495606_0014011 3300046507 Bacteria 6287
110 Ga0495606_0170920 3300046507 Bacteria 1261
111 Ga0495610_0093999 3300046512 Bacteria 1354
112 Ga0495610_0283795 3300046512 Bacteria 644
113 Ga0495616_0292121 3300046513 Bacteria 690
114 Ga0495620_0010172 3300046515 Bacteria 4969
115 Ga0495620_0027026 3300046515 Bacteria 2691
116 Ga0495631_0007008 3300046518 Bacteria 5769
117 Ga0495643_0039150 3300046522 Bacteria 2594
118 Ga0495643_0256440 3300046522 Bacteria 814
119 Ga0495648_0291602 3300046524 Bacteria 768
120 Ga0495663_0170773 3300046525 Bacteria 750
121 Ga0495609_0089690 3300046538 Bacteria 1337
122 Ga0495597_0099608 3300046542 Bacteria 1227
123 Ga0495633_0032403 3300046558 Bacteria 2525
124 Ga0495633_0037236 3300046558 Bacteria 2328
125 Ga0495656_0075815 3300046615 Bacteria 1505
126 Ga0495668_0016678 3300046616 Bacteria 4270
127 Ga0495611_0016448 3300046648 Bacteria 3162
128 Ga0495625_0036519 3300046660 Bacteria 3611
129 Ga0495625_0160580 3300046660 Bacteria 1506
130 Ga0495625_0358032 3300046660 Bacteria 920
131 Ga0495625_0400808 3300046660 Bacteria 857
132 Ga0495625_0560894 3300046660 Bacteria 690
133 Ga0495661_0271868 3300046665 Bacteria 857
134 Ga0495588_0001500 3300046674 Bacteria 9995
135 Ga0495588_0026192 3300046674 Bacteria 2910
136 Ga0495589_0114264 3300046794 Bacteria 1302
137 Ga0495660_0044884 3300046810 Bacteria 2429
138 Ga0495672_0088146 3300047320 Bacteria 1711
139 Ga0495681_0013535 3300047470 Bacteria 4726
140 Ga0495681_0140423 3300047470 Bacteria 1021
141 Ga0495686_0135350 3300047472 Bacteria 1457
142 Ga0495626_0076566 3300048091 Bacteria 1493
143 Ga0496104_0153491 3300048907 Bacteria 2210
144 Ga0496110_1088642 3300048913 Bacteria 707
145 Ga0496116_0049514 3300048919 Bacteria 2809
146 Ga0496117_0000031 3300048920 Bacteria 381048
147 Ga0496117_0078244 3300048920 Bacteria 2184
148 Ga0496118_0003281 3300048921 Bacteria 20588
149 Ga0496118_0089732 3300048921 Bacteria 2121
150 Ga0496118_0185270 3300048921 Bacteria 1252
151 Ga0496119_0033849 3300048922 Bacteria 3379
152 Ga0496120_0001350 3300048923 Bacteria 30183
153 Ga0496121_0003408 3300048924 Bacteria 22725
154 Ga0496121_0011768 3300048924 Bacteria 9650
155 Ga0496122_0000023 3300048925 Bacteria 381035
156 Ga0496122_0000074 3300048925 Bacteria 219900
157 Ga0496122_0036374 3300048925 Bacteria 3982
158 Ga0496123_0000027 3300048926 Bacteria 306773
159 Ga0496123_0000062 3300048926 Bacteria 219882
160 Ga0496124_0000174 3300048927 Bacteria 129228
161 Ga0496124_0001510 3300048927 Bacteria 33896
162 Ga0496124_0017561 3300048927 Bacteria 6739
163 Ga0496124_0106566 3300048927 Bacteria 2263
164 Ga0496124_0269841 3300048927 Bacteria 1247
165 Ga0496125_0074926 3300048928 Bacteria 2621
166 Ga0496126_0111833 3300048929 Bacteria 2378
167 Ga0496126_0176457 3300048929 Bacteria 1817
168 Ga0495678_064068 3300049459 Bacteria 1370
169 Ga0495682_0088465 3300049460 Bacteria 1113
170 Ga0501032_0260591 3300049569 Bacteria 1124
171 nmdc:mga03683_16119_c1 3300050489 Bacteria 2801
172 nmdc:mga03n38_1679_c1 3300050490 Bacteria 6509
173 nmdc:mga03n38_170225_c1 3300050490 Bacteria 1109
174 nmdc:mga03n38_402183_c1 3300050490 Bacteria 754
175 nmdc:mga00v17_545_c1 3300050491 Bacteria 21081
176 nmdc:mga0yw44_182935_c1 3300050492 Bacteria 1380
177 nmdc:mga0yw44_226358_c1 3300050492 Bacteria 1241
178 nmdc:mga0k408_380484_c1 3300050493 Bacteria 841
179 nmdc:mga06z11_12539_c1 3300050494 Bacteria 3690
180 nmdc:mga06z11_127605_c1 3300050494 Bacteria 1425
181 nmdc:mga07m45_150910_c1 3300050496 Bacteria 1348
182 nmdc:mga0sz30_138310_c1 3300050516 Bacteria 1075
183 nmdc:mga0sz30_551_c1 3300050516 Bacteria 13992
184 Ga0500610_0180064 3300053079 Bacteria 1035
185 Ga0500643_027592 3300053087 Bacteria 1764
186 Ga0500644_0130863 3300053088 Bacteria 988
187 Ga0500583_0360643 3300053092 Bacteria 703
188 Ga0500650_0104331 3300053098 Bacteria 1325
189 Ga0500556_0133434 3300053104 Bacteria 974
190 Ga0500557_001560 3300053105 Bacteria 3809
191 Ga0500560_066889 3300053107 Bacteria 1179
192 Ga0500560_143429 3300053107 Bacteria 795
193 Ga0500562_190718 3300053108 Bacteria 556
194 Ga0500569_022651 3300053109 Bacteria 1677
195 Ga0500569_023329 3300053109 Bacteria 1661
196 Ga0500572_001922 3300053111 Bacteria 5214
197 Ga0500572_081584 3300053111 Bacteria 1014
198 Ga0500594_0012692 3300053118 Bacteria 1991
199 Ga0500594_0177331 3300053118 Bacteria 694
200 Ga0500618_001994 3300053125 Bacteria 8324
201 Ga0500618_003962 3300053125 Bacteria 4897
202 Ga0500618_004216 3300053125 Bacteria 4670
203 Ga0500618_046660 3300053125 Bacteria 986
204 Ga0500652_146860 3300053131 Bacteria 980
205 Ga0500561_0000030 3300053137 Bacteria 29291
206 Ga0500568_0011336 3300053139 Bacteria 4143
207 Ga0500588_0043424 3300053146 Bacteria 1367
208 Ga0500616_0012716 3300053153 Bacteria 4918
209 Ga0500616_0014473 3300053153 Bacteria 4532
210 Ga0500622_0196503 3300053156 Bacteria 920
211 Ga0500624_000393 3300053157 Bacteria 13789
212 Ga0500627_0217471 3300053158 Bacteria 853
213 Ga0500634_0004498 3300053161 Bacteria 6461
214 Ga0500634_0111938 3300053161 Bacteria 1345
215 Ga0500636_0000040 3300053177 Bacteria 69881
216 Ga0500636_0004567 3300053177 Bacteria 7853
217 Ga0587090_004537 3300059510 Bacteria 1689
218 2510896706 2510461076 Bacteria 8618824
219 2511184005 2510917028 Bacteria 6185411
220 2513571634 2513237084 Bacteria 7231967
221 2513578669 2513237085 Bacteria 7695351
222 2513630147 2513237093 Bacteria 7545552
223 2513711355 2513237103 Bacteria 7647401
224 2513998498 2513237159 Bacteria 6810126
225 2514019407 2513237162 Bacteria 7468464
226 2515114409 2515075009 Bacteria 7288508
227 2515635413 2515154113 Bacteria 7807172
228 2515643179 2515154114 Bacteria 7848616
229 2515657643 2515154116 Bacteria 7552979
230 2515741594 2515154134 Bacteria 7220242
231 2517038061 2516653077 Bacteria 7555578
232 2517078324 2516653085 Bacteria 7346596
233 2517097083 2517093000 Bacteria 7412387
234 2517408532 2517287029 Bacteria 6905599
235 2520376407 2519899620 Bacteria 6499161
236 2524458484 2524023209 Bacteria 6679728
237 2537873616 2537561587 Bacteria 5425293
238 2554248925 2554235003 Bacteria 5877155
239 2559296013 2558860242 Bacteria 5568029
240 2585166733 2582581283 Bacteria 6030556
241 2585257353 2582581304 Bacteria 5831370
242 2585396062 2582581866 Bacteria 6859583
243 2585526038 2585427526 Bacteria 7258840
244 2585540785 2585427528 Bacteria 6842387
245 2585820843 2585427590 Bacteria 6824633
246 2585839055 2585427593 Bacteria 7141551
247 2585997792 2585427633 Bacteria 6413184
248 2599603194 2599185210 Bacteria 5624189
249 2600373227 2600254933 Bacteria 4750527
250 2601610901 2600255279 Bacteria 5605316
251 2601747675 2600255308 Bacteria 5611129
252 2643921537 2643221582 Bacteria 5804683
253 2644002479 2643221599 Bacteria 6292121
254 2644493072 2643221688 Bacteria 5260751
255 2644499252 2643221689 Bacteria 6042950
256 2644521591 2643221693 Bacteria 5513853
257 2719182968 2718217882 Bacteria 6556348
258 2719667313 2718217997 Bacteria 6740740
259 2719733685 2718218009 Bacteria 6478651
260 2720615187 2718218232 Bacteria 6720332
261 2720621982 2718218233 Bacteria 6662049
262 2720633332 2718218235 Bacteria 6630699
263 2720777030 2718218269 Bacteria 6906114
264 2721149080 2718218363 Bacteria 6524337
265 2721160478 2718218365 Bacteria 6274507
266 2721165893 2718218366 Bacteria 6425255
267 2722842063 2721755514 Bacteria 6424414
268 2723028628 2721755556 Bacteria 6745503
269 2723562232 2721755684 Bacteria 6859907
270 2723568935 2721755685 Bacteria 6704835
271 2724046441 2721755810 Bacteria 6479005
272 2724091637 2721755819 Bacteria 6906405
273 2724106200 2721755822 Bacteria 6726041
274 2725947543 2724679232 Bacteria 7646494
275 2730109564 2728369352 Bacteria 6745171
276 2730166203 2728369365 Bacteria 6555560
277 2730300110 2728369397 Bacteria 6274511
278 2739037281 2738541333 Bacteria 7106503
279 2766064262 2765235942 Bacteria 7445910
280 2793281028 2791355253 Bacteria 5171699
281 2793295623 2791355256 Bacteria 6798008
282 2793320725 2791355260 Bacteria 6598818
283 2793327289 2791355261 Bacteria 6661293
284 2793332242 2791355262 Bacteria 6774204
285 2793346605 2791355264 Bacteria 6429314
286 2793353856 2791355265 Bacteria 6539969
287 2806047373 2802429633 Bacteria 7341974
288 2806054228 2802429634 Bacteria 7083200
289 2806060188 2802429635 Bacteria 7650140
290 2806068799 2802429636 Bacteria 7597525
291 2806076405 2802429637 Bacteria 7067217
292 2808988161 2808606387 Bacteria 5697198
293 2819561023 2818991439 Bacteria 6907412
294 2838024009 2838022645 Bacteria 6494267
295 2838050811 2838048938 Bacteria 6044578
296 2838072129 2838068647 Bacteria 6208656
297 2838678608 2838675328 Bacteria 4909118
298 2838683873 2838680041 Bacteria 6545511
299 2838690288 2838686498 Bacteria 7807632
300 2838698401 2838694306 Bacteria 6853137
301 2838711516 2838707686 Bacteria 6619912
302 2838718304 2838714209 Bacteria 5525906
303 2838722904 2838719591 Bacteria 5523910
304 2838728370 2838724970 Bacteria 4908691
305 2838732063 2838729681 Bacteria 7400765
306 2838744959 2838742623 Bacteria 7396178
307 2841845415 2841840854 Bacteria 5761912
308 2841850460 2841846520 Bacteria 5345850
309 2841856017 2841851746 Bacteria 7532261
310 2841863287 2841859092 Bacteria 5436171
311 2841867753 2841864319 Bacteria 6742987
312 2842081317 2842077413 Bacteria 6508645
313 2842116849 2842110456 Bacteria 7656360
314 2842121906 2842118031 Bacteria 7033875
315 2842129030 2842124991 Bacteria 5346824
316 2842133501 2842130223 Bacteria 4909145
317 2842145118 2842140634 Bacteria 5759631
318 2842155588 2842152218 Bacteria 4908957
319 2842161186 2842156927 Bacteria 6894975
320 2842166698 2842163707 Bacteria 6916235
321 2842174454 2842170452 Bacteria 5525737
322 2842179115 2842175837 Bacteria 4908771
323 2842184803 2842180545 Bacteria 6888678
324 2842190728 2842187318 Bacteria 5524014
325 2842201602 2842198810 Bacteria 6608673
326 2842207424 2842205361 Bacteria 6340321
327 2842214948 2842211629 Bacteria 5523832
328 2842221786 2842217011 Bacteria 7497767
329 2842227669 2842224351 Bacteria 5524473
330 2842232385 2842229732 Bacteria 7475766
331 2842240920 2842237096 Bacteria 6620661
332 2842246801 2842243621 Bacteria 7421798
333 2842261098 2842257432 Bacteria 7401195
334 2842274308 2842271015 Bacteria 7807131
335 2842280865 2842278818 Bacteria 6340002
336 2842288523 2842285085 Bacteria 6011953
337 2842294974 2842291075 Bacteria 7076806
338 2842305850 2842304105 Bacteria 7023636
339 2842346576 2842341865 Bacteria 7003929
340 2842366266 2842363717 Bacteria 6844742
341 2842375008 2842370503 Bacteria 7038661
342 2842381373 2842377471 Bacteria 7140707
343 2842388443 2842384541 Bacteria 7057858
344 2842395938 2842395702 Bacteria 6780583
345 2842406131 2842402390 Bacteria 6681310
346 2842412716 2842409023 Bacteria 6687331
347 2842419405 2842415677 Bacteria 6596907
348 2842425761 2842422224 Bacteria 6239196
349 2842519976 2842515876 Bacteria 5436280
350 2842524473 2842521101 Bacteria 6569494
351 2844457013 2844454524 Bacteria 7952546
352 2852391711 2852387548 Bacteria 8025568
353 2854901709 2854896431 Bacteria 5869725
354 2854919493 2854916844 Bacteria 5725939
355 2857519579 2857516855 Bacteria 7787325
356 2899795384 2899792073 Bacteria 4926588
357 2899849363 2899845264 Bacteria 5672268
358 2919105392 2919100787 Bacteria 7710546
359 2919118439 2919114240 Bacteria 5700270
360 2919175774 2919171160 Bacteria 6499771
361 2923559483 2923556063 Bacteria 6793593
362 2926754968 2926754445 Bacteria 5964435
363 2926762132 2926760298 Bacteria 5505990
364 2933010564 2933006813 Bacteria 4912075
365 2933015764 2933011516 Bacteria 5439334
366 2933572355 2933570622 Bacteria 7023390
367 2933593146 2933586486 Bacteria 7667493
368 2933597498 2933594066 Bacteria 5594265
369 2933603018 2933599457 Bacteria 5858799
370 2935897948 2935894831 Bacteria 6620579
371 2935903630 2935901341 Bacteria 7341747
372 2936369893 2936367885 Bacteria 7324495
373 2936379078 2936375103 Bacteria 6652732
374 2936381945 2936381700 Bacteria 7006523
375 2979092598 2979089926 Bacteria 5670289
376 2979100011 2979095461 Bacteria 5669583
377 2979104570 2979100975 Bacteria 5423623
378 2984513634 2984509177 Bacteria 5274802
379 2984522786 2984518228 Bacteria 5277463
380 2984542092 2984537506 Bacteria 5277481
381 2984590947 2984587000 Bacteria 5263363
382 2984601523 2984601300 Bacteria 5455244
383 2996896999 2996893221 Bacteria 5823108
384 3005415804 3005409236 Bacteria 7188837
385 3005455955 3005452660 Bacteria 5889319
386 639650435 639633055 Bacteria 7751309
387 650741229 650716007 Bacteria 5573770
388 8003573710 8003570095 Bacteria 5747666
389 8005286744 8005282627 Bacteria 6675747
390 8005295087 8005289223 Bacteria 6634003
391 8005305966 8005301065 Bacteria 6614431
392 8005313703 8005307578 Bacteria 7395396
393 8005381564 8005376324 Bacteria 6590079
394 8005387768 8005382845 Bacteria 6732062
395 8005400804 8005395548 Bacteria 6806915
396 8005465101 8005460587 Bacteria 7157962
397 8005497678 8005497431 Bacteria 6477605
398 8005561177 8005556819 Bacteria 6908598
399 8005565801 8005563573 Bacteria 7153261
400 8005571849 8005570704 Bacteria 6957481
401 8005669083 8005668836 Bacteria 6953162
402 8005694335 8005688590 Bacteria 6610080
403 8005695740 8005695170 Bacteria 6912330
404 8018128914 8018127388 Bacteria 7351159
405 8018165084 8018163183 Bacteria 7277977
406 8023686543 8023680758 Bacteria 7729763
407 8024484374 8024479707 Bacteria 6954785
408 8054463794 8054460903 Bacteria 4872905
409 8054560996 8054558443 Bacteria 5204801
410 8056385249 8056382006 Bacteria 6408074
411 8057879293 8057874678 Bacteria 7494653
412 Ga0495654_0000231
413 JGI25155J39150_1000004
414 JGI25150J39212_1010161
415 JGI25151J46595_10013605
416 rootH1_10153885
417 rootL2_10199211
418 rootL2_10236953
419 JGI25160J50197_1010078
420 Ga0055526_1005398
421 Ga0055536_1001690
422 Ga0055540_1001518
423 Ga0058692_1004658
424 Ga0065165_1006475
425 Ga0070658_10288901
426 Ga0070666_10554318
427 Ga0070668_100098384
428 Ga0070668_100245686
429 Ga0070667_100121932
430 Ga0070678_100902270
431 Ga0070665_100006674
432 Ga0070665_100084962
433 Ga0075365_10002199
434 Ga0075365_10042567
435 Ga0075368_10005043
436 Ga0075363_100164068
437 Ga0075362_10183180
438 Ga0075367_10148564
439 Ga0075369_10002260
440 Ga0075369_10006146
441 Ga0075369_10094252
442 Ga0075366_10163908
443 Ga0075366_10333757
444 Ga0075370_10075748
445 Ga0099826_10001615
446 Ga0099826_10178947
447 Ga0105240_10000013
448 Ga0105243_10039882
449 Ga0105249_10073845
450 Ga0123341_1000009
451 Ga0123342_1005742
452 Ga0105246_10065503
453 Ga0157373_10009908
454 Ga0157373_10277863
455 Ga0157371_10000071
456 Ga0157370_10000469
457 Ga0157369_10060753
458 Ga0157369_10702336
459 Ga0157369_10876544
460 Ga0209129_1024774
461 Ga0209758_1001119
462 Ga0207705_10450626
463 Ga0207681_10036206
464 Ga0207668_10052691
465 Ga0207640_10328281
466 Ga0209371_1000037
467 Ga0209371_1001614
468 Ga0209282_1004166
469 Ga0209282_1130883
470 Ga0209813_10003071
471 Ga0268266_10005017
472 Ga0268266_10082954
473 Ga0307515_10265676
474 Ga0268256_1000039
475 Ga0268256_1016426
476 Ga0316178_1037487
477 Ga0316181_1265453
478 Ga0316182_1427703
479 Ga0307405_10695881
480 Ga0307410_10256417
481 Ga0307409_100359161
482 Ga0307416_100591538
483 Ga0307416_101444077
484 Ga0307414_10358764
485 Ga0439436_0009011
486 Ga0439447_031648
487 Ga0439466_0233328
488 Ga0451787_295766
489 Ga0451793_0563136
490 Ga0451797_0194495
491 Ga0451807_1897342
492 Ga0451833_0436083
493 Ga0451833_0477116
494 Ga0451837_1116898
495 Ga0451839_0295473
496 Ga0451841_1368387
497 Ga0451845_0280731
498 Ga0451849_0036077
499 Ga0451843_0241487
500 Ga0451855_1070575
501 Ga0451853_0336302
502 Ga0451853_1214367
503 Ga0439431_0042457
504 Ga0439431_0111710
505 Ga0439449_0094371
506 Ga0450900_048538
507 Ga0439434_0027563
508 Ga0450918_006877
509 Ga0495617_030731
510 Ga0495627_096903
511 Ga0495590_0071608
512 Ga0495638_0000257
513 Ga0495605_0009564
514 Ga0495585_0036163
515 Ga0495585_0060484
516 Ga0495596_0139413
517 Ga0495607_0068560
518 Ga0495607_0137850
519 Ga0495583_0033107
520 Ga0495606_0014011
521 Ga0495606_0170920
522 Ga0495610_0093999
523 Ga0495610_0283795
524 Ga0495616_0292121
525 Ga0495620_0010172
526 Ga0495620_0027026
527 Ga0495631_0007008
528 Ga0495643_0039150
529 Ga0495643_0256440
530 Ga0495648_0291602
531 Ga0495663_0170773
532 Ga0495609_0089690
533 Ga0495597_0099608
534 Ga0495633_0032403
535 Ga0495633_0037236
536 Ga0495656_0075815
537 Ga0495668_0016678
538 Ga0495611_0016448
539 Ga0495625_0036519
540 Ga0495625_0160580
541 Ga0495625_0358032
542 Ga0495625_0400808
543 Ga0495625_0560894
544 Ga0495661_0271868
545 Ga0495588_0001500
546 Ga0495588_0026192
547 Ga0495589_0114264
548 Ga0495660_0044884
549 Ga0495672_0088146
550 Ga0495681_0013535
551 Ga0495681_0140423
552 Ga0495686_0135350
553 Ga0495626_0076566
554 Ga0496104_0153491
555 Ga0496110_1088642
556 Ga0496116_0049514
557 Ga0496117_0000031
558 Ga0496117_0078244
559 Ga0496118_0003281
560 Ga0496118_0089732
561 Ga0496118_0185270
562 Ga0496119_0033849
563 Ga0496120_0001350
564 Ga0496121_0003408
565 Ga0496121_0011768
566 Ga0496122_0000023
567 Ga0496122_0000074
568 Ga0496122_0036374
569 Ga0496123_0000027
570 Ga0496123_0000062
571 Ga0496124_0000174
572 Ga0496124_0001510
573 Ga0496124_0017561
574 Ga0496124_0106566
575 Ga0496124_0269841
576 Ga0496125_0074926
577 Ga0496126_0111833
578 Ga0496126_0176457
579 Ga0495678_064068
580 Ga0495682_0088465
581 Ga0501032_0260591
582 nmdc:mga03683_16119_c1
583 nmdc:mga03n38_1679_c1
584 nmdc:mga03n38_170225_c1
585 nmdc:mga03n38_402183_c1
586 nmdc:mga00v17_545_c1
587 nmdc:mga0yw44_182935_c1
588 nmdc:mga0yw44_226358_c1
589 nmdc:mga0k408_380484_c1
590 nmdc:mga06z11_12539_c1
591 nmdc:mga06z11_127605_c1
592 nmdc:mga07m45_150910_c1
593 nmdc:mga0sz30_138310_c1
594 nmdc:mga0sz30_551_c1
595 Ga0500610_0180064
596 Ga0500643_027592
597 Ga0500644_0130863
598 Ga0500583_0360643
599 Ga0500650_0104331
600 Ga0500556_0133434
601 Ga0500557_001560
602 Ga0500560_066889
603 Ga0500560_143429
604 Ga0500562_190718
605 Ga0500569_022651
606 Ga0500569_023329
607 Ga0500572_001922
608 Ga0500572_081584
609 Ga0500594_0012692
610 Ga0500594_0177331
611 Ga0500618_001994
612 Ga0500618_003962
613 Ga0500618_004216
614 Ga0500618_046660
615 Ga0500652_146860
616 Ga0500561_0000030
617 Ga0500568_0011336
618 Ga0500588_0043424
619 Ga0500616_0012716
620 Ga0500616_0014473
621 Ga0500622_0196503
622 Ga0500624_000393
623 Ga0500627_0217471
624 Ga0500634_0004498
625 Ga0500634_0111938
626 Ga0500636_0000040
627 Ga0500636_0004567
628 Ga0587090_004537
629 2510896706
630 2511184005
631 2513571634
632 2513578669
633 2513630147
634 2513711355
635 2513998498
636 2514019407
637 2515114409
638 2515635413
639 2515643179
640 2515657643
641 2515741594
642 2517038061
643 2517078324
644 2517097083
645 2517408532
646 2520376407
647 2524458484
648 2537873616
649 2554248925
650 2559296013
651 2585166733
652 2585257353
653 2585396062
654 2585526038
655 2585540785
656 2585820843
657 2585839055
658 2585997792
659 2599603194
660 2600373227
661 2601610901
662 2601747675
663 2643921537
664 2644002479
665 2644493072
666 2644499252
667 2644521591
668 2719182968
669 2719667313
670 2719733685
671 2720615187
672 2720621982
673 2720633332
674 2720777030
675 2721149080
676 2721160478
677 2721165893
678 2722842063
679 2723028628
680 2723562232
681 2723568935
682 2724046441
683 2724091637
684 2724106200
685 2725947543
686 2730109564
687 2730166203
688 2730300110
689 2739037281
690 2766064262
691 2793281028
692 2793295623
693 2793320725
694 2793327289
695 2793332242
696 2793346605
697 2793353856
698 2806047373
699 2806054228
700 2806060188
701 2806068799
702 2806076405
703 2808988161
704 2819561023
705 2838024009
706 2838050811
707 2838072129
708 2838678608
709 2838683873
710 2838690288
711 2838698401
712 2838711516
713 2838718304
714 2838722904
715 2838728370
716 2838732063
717 2838744959
718 2841845415
719 2841850460
720 2841856017
721 2841863287
722 2841867753
723 2842081317
724 2842116849
725 2842121906
726 2842129030
727 2842133501
728 2842145118
729 2842155588
730 2842161186
731 2842166698
732 2842174454
733 2842179115
734 2842184803
735 2842190728
736 2842201602
737 2842207424
738 2842214948
739 2842221786
740 2842227669
741 2842232385
742 2842240920
743 2842246801
744 2842261098
745 2842274308
746 2842280865
747 2842288523
748 2842294974
749 2842305850
750 2842346576
751 2842366266
752 2842375008
753 2842381373
754 2842388443
755 2842395938
756 2842406131
757 2842412716
758 2842419405
759 2842425761
760 2842519976
761 2842524473
762 2844457013
763 2852391711
764 2854901709
765 2854919493
766 2857519579
767 2899795384
768 2899849363
769 2919105392
770 2919118439
771 2919175774
772 2923559483
773 2926754968
774 2926762132
775 2933010564
776 2933015764
777 2933572355
778 2933593146
779 2933597498
780 2933603018
781 2935897948
782 2935903630
783 2936369893
784 2936379078
785 2936381945
786 2979092598
787 2979100011
788 2979104570
789 2984513634
790 2984522786
791 2984542092
792 2984590947
793 2984601523
794 2996896999
795 3005415804
796 3005455955
797 639650435
798 650741229
799 8003573710
800 8005286744
801 8005295087
802 8005305966
803 8005313703
804 8005381564
805 8005387768
806 8005400804
807 8005465101
808 8005497678
809 8005561177
810 8005565801
811 8005571849
812 8005669083
813 8005694335
814 8005695740
815 8018128914
816 8018165084
817 8023686543
818 8024484374
819 8054463794
820 8054560996
821 8056385249
822 8057879293

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03734

YkuD

L,D-transpeptidase catalytic domain

27

200

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vyt-assembly1.cif.gz_A-2 crystal structure of the hypc-hypd-hype complex (form i inward) 0.7269 15 40
5uwv-assembly3.cif.gz_D crystal structure of mycobacterium abscessus l,d-transpeptidase 2 0.6315 15 182
4y4v-assembly1.cif.gz_B structure of helicobacter pylori csd6 in the d-ala-bound state 0.627 11 181
3zg4-assembly1.cif.gz_A nmr structure of the catalytic domain from e. faecium l,d- transpeptidase 0.6012 13 182
6fj1-assembly2.cif.gz_B structure of the ldtfm-avibactam carbamoyl enzyme 0.5884 13 182
ID Description Score Start End Superfamily
af_Q2PDY8_210_271_2.170.140.10 Mainly Beta;Beta Complex;Antimicrobial Protein, Tachycitin; Chain A;Chitin binding domain 0.7379 15 37 2.170.140.10
3vytA00 Mainly Beta;Roll;SH3 type barrels.; 0.7269 15 40 2.30.30.140
af_Q9BZP6_428_476_2.170.140.10 Mainly Beta;Beta Complex;Antimicrobial Protein, Tachycitin; Chain A;Chitin binding domain 0.7212 8 37 2.170.140.10
af_Q54YF3_612_706_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6717 12 37 2.30.29.30
af_Q08406_202_305_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6711 15 29 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A829Y3G4-F1-model_v4 deleted 0.9634 34 182
AF-V4RJ39-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.9619 11 182 GO:0004180
GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A1L3L856-F1-model_v4 deleted 0.961 17 182
AF-A0A285M008-F1-model_v4 L,D-peptidoglycan transpeptidase YkuD, ErfK/YbiS/YcfS/YnhG family 0.9591 11 182 GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A5P8N2J7-F1-model_v4 L,D-transpeptidase family protein 0.9589 25 182 GO:0004180
GO:0008360
GO:0009252
GO:0016740
GO:0071555

Map