F437634

General Info

Members Datasets Scaffolds Average Seq Length
411 239 384 141

Family's Representative Sequence

Representative Sequence 3300049459|Ga0495678_001041|Ga0495678_001041_10003_10482
Length 159
Sequence MPALSSGRDQAYLSIMIKYALQCDQAHVFEGWFGSSSDYDDQSARGLVDCPICGSSGVSKQIMAPAVAGTKAQASAPAVDPKMREMMMTAMGEVRRYVEEKFDNVGDAFAQEARDIHEGKSEERGIYGQATPAEAKALIEDGIKVAPLPPPAPKKTDVN

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
9 2643221583 Caulobacter sp. Root655 Isolate Unclassified
10 2643221584 Caulobacter sp. Root656 Isolate Unclassified
11 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
15 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
16 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
17 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
18 2818991435 Caulobacter henricii 536 Isolate Unclassified
19 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
20 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
21 2849560528 Caulobacter zeae 410 Isolate Unclassified
22 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
23 2851153111 Caulobacter radicis 736 Isolate Unclassified
24 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
25 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
26 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
27 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
30 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
119 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
139 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
140 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
141 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
142 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
143 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
144 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
145 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
148 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
149 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
155 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
156 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
159 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
167 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
168 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
181 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
182 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
183 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
184 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
211 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
212 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
213 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
214 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
215 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
216 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
217 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
218 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
219 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
220 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
221 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
222 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
223 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
224 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
225 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
226 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
227 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
228 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
229 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
230 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
233 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
234 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
235 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
236 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
237 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
238 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.19
Metatranscriptomes 0
Isolates 6.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.22
Nodule 0
Rhizoplane 1.7
Rhizosphere 59.85
Stem 0
Stem Tuber 0
Unclassified 10.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10057600 3300003215 Bacteria 1073
2 rootH1_10061495 3300003316 Bacteria 1865
3 rootH1_10061495 3300003323 Bacteria 5872
4 rootL2_10166532 3300003322 Bacteria 1468
5 Ga0055526_1024078 3300003771 Bacteria 2006
6 Ga0055537_1004109 3300003773 Bacteria 4254
7 Ga0055524_1048252 3300003775 Bacteria 995
8 Ga0055536_1006012 3300003781 Bacteria 5766
9 Ga0055536_1006740 3300003781 Bacteria 5270
10 Ga0055530_10004666 3300003791 Bacteria 6949
11 Ga0055530_10039495 3300003791 Bacteria 1165
12 Ga0055531_10001306 3300003794 Bacteria 18794
13 Ga0055531_10007308 3300003794 Bacteria 6054
14 Ga0055531_10027711 3300003794 Bacteria 1978
15 Ga0065165_1001479 3300005262 Bacteria 25047
16 Ga0070670_100000009 3300005331 Bacteria 291074
17 Ga0070670_100039338 3300005331 Bacteria 4067
18 Ga0070670_100191595 3300005331 Bacteria 1776
19 Ga0070670_101156224 3300005331 Bacteria 707
20 Ga0070666_10045650 3300005335 Bacteria 2937
21 Ga0070668_100000225 3300005347 Bacteria 36473
22 Ga0070668_100002811 3300005347 Bacteria 12814
23 Ga0070668_100040540 3300005347 Bacteria 3563
24 Ga0070669_100034884 3300005353 Bacteria 3642
25 Ga0070669_100770622 3300005353 Bacteria 816
26 Ga0070671_100004998 3300005355 Bacteria 10565
27 Ga0070659_100008732 3300005366 Bacteria 7415
28 Ga0070667_100000730 3300005367 Bacteria 31571
29 Ga0070667_100001005 3300005367 Bacteria 25837
30 Ga0070678_102162557 3300005456 Bacteria 527
31 Ga0070672_101149174 3300005543 Bacteria 691
32 Ga0070665_100001314 3300005548 Bacteria 29649
33 Ga0070665_100286966 3300005548 Bacteria 1648
34 Ga0068855_100036686 3300005563 Bacteria 5832
35 Ga0068855_100438491 3300005563 Bacteria 1427
36 Ga0070664_100061488 3300005564 Bacteria 3201
37 Ga0068854_100833334 3300005578 Bacteria 806
38 Ga0068859_100003642 3300005617 Bacteria 15701
39 Ga0068859_100904766 3300005617 Bacteria 967
40 Ga0068864_100000052 3300005618 Bacteria 133777
41 Ga0068864_100000150 3300005618 Bacteria 65989
42 Ga0068861_100095717 3300005719 Bacteria 2352
43 Ga0068861_101834758 3300005719 Bacteria 602
44 Ga0068863_100000019 3300005841 Bacteria 205585
45 Ga0068863_100000438 3300005841 Bacteria 42054
46 Ga0068863_100003399 3300005841 Bacteria 15703
47 Ga0068858_100000040 3300005842 Bacteria 135911
48 Ga0068858_100003449 3300005842 Bacteria 15691
49 Ga0068858_100147615 3300005842 Bacteria 2209
50 Ga0068860_100000184 3300005843 Bacteria 100730
51 Ga0068860_100011649 3300005843 Bacteria 8672
52 Ga0068860_100063992 3300005843 Bacteria 3493
53 Ga0068860_101412263 3300005843 Bacteria 717
54 Ga0068862_100001953 3300005844 Bacteria 18695
55 Ga0068862_100158629 3300005844 Bacteria 2018
56 Ga0075365_10202439 3300006038 Bacteria 1391
57 Ga0075368_10003315 3300006042 Bacteria 5359
58 Ga0075363_100034502 3300006048 Bacteria 2642
59 Ga0075363_100589744 3300006048 Bacteria 665
60 Ga0075364_10000210 3300006051 Bacteria 27547
61 Ga0075362_10157112 3300006177 Bacteria 1093
62 Ga0075367_10000933 3300006178 Bacteria 11862
63 Ga0075369_10014755 3300006186 Bacteria 3126
64 Ga0075369_10338532 3300006186 Bacteria 705
65 Ga0075366_10012447 3300006195 Bacteria 4826
66 Ga0075366_10202752 3300006195 Bacteria 1207
67 Ga0075366_10374110 3300006195 Bacteria 876
68 Ga0075370_10105225 3300006353 Bacteria 1636
69 Ga0075370_10690095 3300006353 Bacteria 620
70 Ga0097620_100003642 3300006931 Bacteria 15701
71 Ga0097620_100904646 3300006931 Bacteria 967
72 Ga0105240_10450598 3300009093 Bacteria 1440
73 Ga0105240_11005161 3300009093 Bacteria 892
74 Ga0105240_11900177 3300009093 Bacteria 619
75 Ga0105247_10142084 3300009101 Bacteria 1574
76 Ga0105247_10714423 3300009101 Bacteria 756
77 Ga0105241_11413637 3300009174 Bacteria 666
78 Ga0105242_12478897 3300009176 Bacteria 567
79 Ga0105248_10001118 3300009177 Bacteria 29838
80 Ga0105248_10002553 3300009177 Bacteria 20265
81 Ga0105248_10079834 3300009177 Bacteria 3677
82 Ga0105248_10128138 3300009177 Bacteria 2863
83 Ga0105238_10285062 3300009551 Bacteria 1633
84 Ga0105238_10358115 3300009551 Bacteria 1448
85 Ga0105249_10001585 3300009553 Bacteria 19940
86 Ga0105239_12117850 3300010375 Bacteria 654
87 Ga0157373_10005812 3300013100 Bacteria 9234
88 Ga0157373_10005961 3300013100 Bacteria 9114
89 Ga0157370_10502422 3300013104 Bacteria 1113
90 Ga0157370_11365007 3300013104 Bacteria 638
91 Ga0163162_10019678 3300013306 Bacteria 6626
92 Ga0163162_10158719 3300013306 Bacteria 2383
93 Ga0157372_11547613 3300013307 Unclassified 764
94 Ga0163163_10015842 3300014325 Bacteria 6983
95 Ga0163163_10082164 3300014325 Bacteria 3225
96 Ga0157379_10004718 3300014968 Bacteria 11704
97 Ga0157379_10009577 3300014968 Bacteria 8437
98 Ga0157379_10057376 3300014968 Bacteria 3479
99 Ga0182007_10209424 3300015262 Bacteria 685
100 Ga0163161_10306789 3300017792 Bacteria 1251
101 Ga0163161_10445328 3300017792 Bacteria 1046
102 Ga0209565_1000242 3300025263 Bacteria 58681
103 Ga0209673_1000976 3300025273 Bacteria 35297
104 Ga0209675_1012653 3300025291 Bacteria 2700
105 Ga0209676_1000115 3300025292 Bacteria 205183
106 Ga0209676_1000289 3300025292 Bacteria 103078
107 Ga0209676_1000840 3300025292 Bacteria 39709
108 Ga0209676_1003457 3300025292 Bacteria 9702
109 Ga0209564_1006888 3300025295 Bacteria 5991
110 Ga0209564_1012054 3300025295 Bacteria 3806
111 Ga0209564_1020619 3300025295 Bacteria 2406
112 Ga0209564_1021174 3300025295 Bacteria 2349
113 Ga0209758_1002274 3300025297 Bacteria 19896
114 Ga0209758_1004608 3300025297 Bacteria 11325
115 Ga0209050_1002333 3300025298 Bacteria 16676
116 Ga0209050_1008775 3300025298 Bacteria 5313
117 Ga0209050_1018227 3300025298 Bacteria 2739
118 Ga0209050_1066184 3300025298 Bacteria 828
119 Ga0209256_1002323 3300025299 Bacteria 15904
120 Ga0209256_1002598 3300025299 Bacteria 14328
121 Ga0209256_1003071 3300025299 Bacteria 12270
122 Ga0209051_1004291 3300025303 Bacteria 8864
123 Ga0209257_1000036 3300025304 Bacteria 616006
124 Ga0209257_1000090 3300025304 Bacteria 274746
125 Ga0209257_1002980 3300025304 Bacteria 15412
126 Ga0209257_1016769 3300025304 Bacteria 2938
127 Ga0207710_10350082 3300025900 Bacteria 752
128 Ga0207680_10021601 3300025903 Bacteria 3485
129 Ga0207654_11055051 3300025911 Bacteria 592
130 Ga0207681_10007767 3300025923 Bacteria 6569
131 Ga0207694_10049535 3300025924 Bacteria 3252
132 Ga0207650_10000014 3300025925 Bacteria 398063
133 Ga0207650_10145867 3300025925 Bacteria 1864
134 Ga0207650_10269054 3300025925 Bacteria 1384
135 Ga0207650_10348837 3300025925 Bacteria 1217
136 Ga0207644_10009342 3300025931 Bacteria 6440
137 Ga0207690_10032632 3300025932 Bacteria 3343
138 Ga0207669_10157698 3300025937 Bacteria 1599
139 Ga0207711_10001597 3300025941 Bacteria 20953
140 Ga0207711_10055503 3300025941 Bacteria 3401
141 Ga0207711_10097817 3300025941 Bacteria 2592
142 Ga0207711_10378285 3300025941 Bacteria 1314
143 Ga0207689_11629023 3300025942 Bacteria 536
144 Ga0207679_10049820 3300025945 Bacteria 3057
145 Ga0207667_10062924 3300025949 Bacteria 3878
146 Ga0207667_10363821 3300025949 Bacteria 1475
147 Ga0207712_10001052 3300025961 Bacteria 19463
148 Ga0207668_10000118 3300025972 Bacteria 55570
149 Ga0207668_10005921 3300025972 Bacteria 7204
150 Ga0207640_10501314 3300025981 Bacteria 1011
151 Ga0207658_10000285 3300025986 Bacteria 52920
152 Ga0207658_10004479 3300025986 Bacteria 9712
153 Ga0207703_10001216 3300026035 Bacteria 24075
154 Ga0207703_10002554 3300026035 Bacteria 15722
155 Ga0207703_10031281 3300026035 Bacteria 4207
156 Ga0207639_10355876 3300026041 Bacteria 1309
157 Ga0207678_11786674 3300026067 Bacteria 538
158 Ga0207641_10000005 3300026088 Bacteria 470841
159 Ga0207641_10004530 3300026088 Bacteria 12016
160 Ga0207641_10006675 3300026088 Bacteria 9684
161 Ga0207676_10000069 3300026095 Bacteria 104526
162 Ga0207676_10000130 3300026095 Bacteria 66147
163 Ga0207675_100131213 3300026118 Bacteria 2376
164 Ga0207683_11845240 3300026121 Bacteria 553
165 Ga0209813_10005264 3300027866 Bacteria 3131
166 Ga0209974_10302409 3300027876 Bacteria 612
167 Ga0268266_10004835 3300028379 Bacteria 12791
168 Ga0268266_10673534 3300028379 Bacteria 996
169 Ga0268265_10011772 3300028380 Bacteria 5915
170 Ga0268265_10022201 3300028380 Bacteria 4456
171 Ga0268265_10039249 3300028380 Bacteria 3489
172 Ga0268264_10003752 3300028381 Bacteria 13047
173 Ga0268264_10015694 3300028381 Bacteria 6204
174 Ga0268264_10065122 3300028381 Bacteria 3069
175 Ga0307515_10035485 3300028794 Bacteria 8110
176 Ga0307515_10048254 3300028794 Bacteria 6443
177 Ga0307515_10173981 3300028794 Bacteria 2132
178 Ga0265338_10109986 3300028800 Bacteria 2222
179 Ga0265338_10365096 3300028800 Bacteria 1035
180 Ga0307513_10000208 3300031456 Bacteria 84906
181 Ga0307513_10007633 3300031456 Bacteria 13977
182 Ga0307513_10663302 3300031456 Bacteria 750
183 Ga0307516_10000020 3300031730 Bacteria 195931
184 Ga0307413_10318790 3300031824 Bacteria 1186
185 Ga0307413_10355883 3300031824 Bacteria 1132
186 Ga0307410_10449095 3300031852 Bacteria 1051
187 Ga0307406_10590113 3300031901 Bacteria 915
188 Ga0307407_10310542 3300031903 Bacteria 1103
189 Ga0307412_10517967 3300031911 Bacteria 996
190 Ga0307409_100071323 3300031995 Bacteria 2762
191 Ga0307409_102710234 3300031995 Bacteria 524
192 Ga0307416_103031926 3300032002 Bacteria 562
193 Ga0307414_10026644 3300032004 Bacteria 3723
194 Ga0307414_10049529 3300032004 Bacteria 2905
195 Ga0307414_10100923 3300032004 Bacteria 2171
196 Ga0307414_10108875 3300032004 Bacteria 2103
197 Ga0307414_10171311 3300032004 Bacteria 1736
198 Ga0307414_10234035 3300032004 Bacteria 1516
199 Ga0307414_10243023 3300032004 Bacteria 1491
200 Ga0307414_10278801 3300032004 Bacteria 1403
201 Ga0307414_10516577 3300032004 Bacteria 1059
202 Ga0307414_10690140 3300032004 Bacteria 923
203 Ga0307414_10802380 3300032004 Bacteria 858
204 Ga0307414_10816883 3300032004 Bacteria 851
205 Ga0436364_0925434 3300037853 Bacteria 2716
206 Ga0395901_0811946 3300038443 Bacteria 923
207 Ga0436365_0580194 3300039437 Bacteria 1491
208 Ga0436365_0602105 3300039437 Bacteria 747
209 Ga0436362_0515961 3300039453 Bacteria 612
210 Ga0451791_1483678 3300041451 Bacteria 573
211 Ga0451793_1656818 3300041452 Bacteria 730
212 Ga0451845_0148628 3300041501 Bacteria 752
213 Ga0451851_1367725 3300041507 Bacteria 853
214 Ga0439441_051308 3300042001 Bacteria 850
215 Ga0439459_0009492 3300042438 Bacteria 1684
216 Ga0450901_033095 3300042533 Bacteria 574
217 Ga0466957_1295115 3300044842 Bacteria 529
218 Ga0495617_057610 3300046452 Bacteria 1288
219 Ga0495627_000397 3300046453 Bacteria 39323
220 Ga0495590_0004604 3300046457 Bacteria 5541
221 Ga0495638_0000960 3300046460 Bacteria 29237
222 Ga0495638_0001722 3300046460 Bacteria 19242
223 Ga0495638_0002411 3300046460 Bacteria 15279
224 Ga0495638_0006686 3300046460 Bacteria 8355
225 Ga0495638_0017416 3300046460 Bacteria 4789
226 Ga0495638_0138450 3300046460 Bacteria 1423
227 Ga0495638_0238714 3300046460 Bacteria 1007
228 Ga0495650_0000068 3300046471 Bacteria 266671
229 Ga0495585_0586691 3300046492 Bacteria 525
230 Ga0495607_0067241 3300046501 Bacteria 2014
231 Ga0495583_0000002 3300046506 Bacteria 782521
232 Ga0495606_0013667 3300046507 Bacteria 6396
233 Ga0495610_0001379 3300046512 Bacteria 21566
234 Ga0495610_0003215 3300046512 Bacteria 12928
235 Ga0495610_0008833 3300046512 Bacteria 6461
236 Ga0495610_0050818 3300046512 Bacteria 2022
237 Ga0495616_0002094 3300046513 Bacteria 13405
238 Ga0495616_0018305 3300046513 Bacteria 3848
239 Ga0495620_0040043 3300046515 Bacteria 2066
240 Ga0495620_0115029 3300046515 Bacteria 1064
241 Ga0495631_0000827 3300046518 Bacteria 19791
242 Ga0495631_0207739 3300046518 Bacteria 837
243 Ga0495632_0001771 3300046519 Bacteria 17444
244 Ga0495632_0048616 3300046519 Bacteria 2099
245 Ga0495637_0030909 3300046520 Bacteria 2372
246 Ga0495643_0013567 3300046522 Bacteria 4871
247 Ga0495648_0000067 3300046524 Bacteria 140250
248 Ga0495648_0077085 3300046524 Bacteria 1912
249 Ga0495648_0093472 3300046524 Bacteria 1677
250 Ga0495648_0202636 3300046524 Bacteria 992
251 Ga0495663_0090322 3300046525 Bacteria 998
252 Ga0495642_0299197 3300046528 Bacteria 705
253 Ga0495642_0329636 3300046528 Bacteria 670
254 Ga0495654_0000042 3300046530 Bacteria 164346
255 Ga0495654_0215924 3300046530 Bacteria 813
256 Ga0495609_0024340 3300046538 Bacteria 2778
257 Ga0495597_0007485 3300046542 Bacteria 5538
258 Ga0495597_0211701 3300046542 Bacteria 772
259 Ga0495633_0371641 3300046558 Bacteria 647
260 Ga0495668_0000026 3300046616 Bacteria 297287
261 Ga0495668_0001352 3300046616 Bacteria 24072
262 Ga0495668_0005590 3300046616 Bacteria 8451
263 Ga0495668_0023860 3300046616 Bacteria 3483
264 Ga0495625_0000127 3300046660 Bacteria 118526
265 Ga0495625_0006768 3300046660 Bacteria 10144
266 Ga0495625_0012636 3300046660 Bacteria 6834
267 Ga0495625_0063365 3300046660 Bacteria 2610
268 Ga0495625_0115070 3300046660 Bacteria 1835
269 Ga0495625_0298985 3300046660 Bacteria 1030
270 Ga0495659_0122291 3300046664 Bacteria 1026
271 Ga0495669_0000005 3300046684 Bacteria 193971
272 Ga0495669_0000356 3300046684 Bacteria 23366
273 Ga0495669_0062060 3300046684 Bacteria 1693
274 Ga0495670_0069287 3300046691 Bacteria 1783
275 Ga0495671_0410093 3300046692 Bacteria 648
276 Ga0495649_0000077 3300046694 Bacteria 84222
277 Ga0495589_0022528 3300046794 Bacteria 3213
278 Ga0495660_0001489 3300046810 Bacteria 15861
279 Ga0495660_0037133 3300046810 Bacteria 2715
280 Ga0495660_0106784 3300046810 Bacteria 1434
281 Ga0495660_0342908 3300046810 Bacteria 666
282 Ga0495672_0002355 3300047320 Bacteria 17459
283 Ga0495672_0138908 3300047320 Bacteria 1271
284 Ga0495683_0330051 3300047323 Bacteria 648
285 Ga0495677_0049745 3300047445 Bacteria 1541
286 Ga0495679_021909 3300047446 Bacteria 2196
287 Ga0495673_0000208 3300047469 Bacteria 88985
288 Ga0495673_0000293 3300047469 Bacteria 67070
289 Ga0495673_0000886 3300047469 Bacteria 27530
290 Ga0495681_0189813 3300047470 Bacteria 839
291 Ga0495686_0001958 3300047472 Bacteria 20461
292 Ga0495686_0021994 3300047472 Bacteria 4223
293 Ga0495686_0023368 3300047472 Bacteria 4078
294 Ga0495686_0037936 3300047472 Bacteria 3085
295 Ga0495686_0083906 3300047472 Bacteria 1942
296 Ga0495686_0530745 3300047472 Bacteria 616
297 Ga0495593_0028413 3300047673 Bacteria 3072
298 Ga0496102_0302204 3300048905 Bacteria 1508
299 Ga0496102_0474916 3300048905 Bacteria 1172
300 Ga0496106_0520816 3300048909 Bacteria 955
301 Ga0496107_0000113 3300048910 Bacteria 39326
302 Ga0496115_0019810 3300048918 Bacteria 5182
303 Ga0496117_0029617 3300048920 Bacteria 4217
304 Ga0496118_0008572 3300048921 Bacteria 10526
305 Ga0496119_0029323 3300048922 Bacteria 3734
306 Ga0496121_0000067 3300048924 Bacteria 261543
307 Ga0496121_0014089 3300048924 Bacteria 8524
308 Ga0496124_0010685 3300048927 Bacteria 9261
309 Ga0496125_0027084 3300048928 Bacteria 5205
310 Ga0496126_0001854 3300048929 Bacteria 30807
311 Ga0496126_0238868 3300048929 Bacteria 1519
312 Ga0496126_0391011 3300048929 Bacteria 1130
313 Ga0495678_001041 3300049459 Bacteria 23510
314 Ga0501047_0037496 3300049581 Bacteria 4687
315 Ga0501067_0041764 3300049583 Bacteria 2547
316 Ga0501073_0046593 3300049589 Bacteria 3048
317 Ga0501073_0611469 3300049589 Bacteria 752
318 Ga0501077_0116063 3300049593 Bacteria 1697
319 Ga0501238_005449 3300049671 Bacteria 1614
320 nmdc:mga03n38_29706_c1 3300050490 Bacteria 2290
321 nmdc:mga00v17_4310_c1 3300050491 Bacteria 7390
322 nmdc:mga0k408_312507_c1 3300050493 Bacteria 938
323 nmdc:mga0k408_31585_c1 3300050493 Bacteria 3024
324 nmdc:mga0k408_405104_c1 3300050493 Bacteria 812
325 nmdc:mga0k408_433570_c1 3300050493 Bacteria 781
326 nmdc:mga06z11_90321_c1 3300050494 Bacteria 1662
327 nmdc:mga04h51_5967_c1 3300050495 Bacteria 3131
328 nmdc:mga07m45_2974_c1 3300050496 Bacteria 8065
329 nmdc:mga07m45_421697_c1 3300050496 Bacteria 774
330 nmdc:mga0sz30_3025_c1 3300050516 Bacteria 6025
331 Ga0500578_0000309 3300053086 Bacteria 59973
332 Ga0500578_0132681 3300053086 Bacteria 1561
333 Ga0500643_000399 3300053087 Bacteria 33231
334 Ga0500643_034224 3300053087 Bacteria 1532
335 Ga0500644_0000036 3300053088 Bacteria 80681
336 Ga0500644_0001274 3300053088 Bacteria 6881
337 Ga0500644_0040613 3300053088 Bacteria 1540
338 Ga0500651_0017899 3300053093 Bacteria 4380
339 Ga0500651_0056426 3300053093 Bacteria 2459
340 Ga0500651_0187694 3300053093 Bacteria 1225
341 Ga0500641_0003251 3300053096 Bacteria 5743
342 Ga0500554_023353 3300053102 Bacteria 1738
343 Ga0500555_058964 3300053103 Bacteria 1036
344 Ga0500556_0000926 3300053104 Bacteria 15947
345 Ga0500556_0003128 3300053104 Bacteria 4940
346 Ga0500556_0269700 3300053104 Bacteria 668
347 Ga0500562_000770 3300053108 Bacteria 7798
348 Ga0500562_001263 3300053108 Bacteria 6250
349 Ga0500562_001559 3300053108 Bacteria 5682
350 Ga0500569_002610 3300053109 Bacteria 3581
351 Ga0500594_0000456 3300053118 Bacteria 9009
352 Ga0500595_003498 3300053119 Bacteria 7306
353 Ga0500595_007363 3300053119 Bacteria 4572
354 Ga0500607_112357 3300053121 Bacteria 1333
355 Ga0500608_001144 3300053122 Bacteria 9457
356 Ga0500608_017120 3300053122 Bacteria 3287
357 Ga0500614_019626 3300053123 Bacteria 1551
358 Ga0500618_000074 3300053125 Bacteria 81608
359 Ga0500658_0006304 3300053134 Bacteria 4404
360 Ga0500559_0000086 3300053136 Bacteria 73688
361 Ga0500559_0006465 3300053136 Bacteria 5293
362 Ga0500559_0007165 3300053136 Bacteria 4968
363 Ga0500564_000048 3300053138 Bacteria 31432
364 Ga0500577_0001105 3300053142 Bacteria 6918
365 Ga0500616_0015824 3300053153 Bacteria 4307
366 Ga0500616_0030174 3300053153 Bacteria 2980
367 Ga0500616_0059649 3300053153 Bacteria 1981
368 Ga0500616_0222649 3300053153 Bacteria 822
369 Ga0500622_0001059 3300053156 Bacteria 22916
370 Ga0500622_0003258 3300053156 Bacteria 11015
371 Ga0500622_0004093 3300053156 Bacteria 9342
372 Ga0500622_0028259 3300053156 Bacteria 2952
373 Ga0500622_0115635 3300053156 Bacteria 1306
374 Ga0500627_0024995 3300053158 Bacteria 2450
375 Ga0500625_065027 3300053729 Bacteria 1642
376 Ga0500645_000131 3300053730 Bacteria 58717
377 Ga0500645_000662 3300053730 Bacteria 21612
378 Ga0500645_001301 3300053730 Bacteria 12962
379 Ga0500645_028770 3300053730 Bacteria 1680
380 Ga0500645_142346 3300053730 Bacteria 663
381 Ga0500609_000806 3300053731 Bacteria 4709
382 Ga0500596_000880 3300053735 Bacteria 5988
383 Ga0500661_048445 3300055283 Bacteria 757
384 Ga0501082_0096465 3300060353 Bacteria 2556

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_0925434 Ga0436364_0925434_478_933 125
2 3300005563 Ga0068855_100036686 Ga0068855_1000366863 129
3 3300009093 Ga0105240_11005161 Ga0105240_110051612 129
4 3300009551 Ga0105238_10358115 Ga0105238_103581152 129
5 3300025949 Ga0207667_10062924 Ga0207667_100629242 129
6 3300031730 Ga0307516_10000020 Ga0307516_10000020163 131
7 3300046460 Ga0495638_0006686 Ga0495638_0006686_4064_4498 131
8 3300053153 Ga0500616_0059649 Ga0500616_0059649_615_1046 131
9 3300053156 Ga0500622_0001059 Ga0500622_0001059_17277_17711 131
10 3300010375 Ga0105239_12117850 Ga0105239_121178502 132
11 3300031911 Ga0307412_10517967 Ga0307412_105179672 133
12 3300032004 Ga0307414_10243023 Ga0307414_102430232 133
13 3300038443 Ga0395901_0811946 Ga0395901_0811946_480_908 133
14 3300005331 Ga0070670_100191595 Ga0070670_1001915952 134
15 3300005618 Ga0068864_100000150 Ga0068864_10000015056 134
16 3300005841 Ga0068863_100000019 Ga0068863_100000019132 134
17 3300005842 Ga0068858_100000040 Ga0068858_10000004027 134
18 3300009101 Ga0105247_10142084 Ga0105247_101420842 134
19 3300009177 Ga0105248_10079834 Ga0105248_100798343 134
20 3300014325 Ga0163163_10082164 Ga0163163_100821642 134
21 3300014968 Ga0157379_10057376 Ga0157379_100573762 134
22 3300025900 Ga0207710_10350082 Ga0207710_103500822 134
23 3300025925 Ga0207650_10145867 Ga0207650_101458672 134
24 3300025941 Ga0207711_10097817 Ga0207711_100978171 134
25 3300026035 Ga0207703_10001216 Ga0207703_1000121610 134
26 3300026088 Ga0207641_10000005 Ga0207641_1000000590 134
27 3300026095 Ga0207676_10000130 Ga0207676_1000013014 134
28 3300027876 Ga0209974_10302409 Ga0209974_103024091 134
29 3300031824 Ga0307413_10355883 Ga0307413_103558832 134
30 3300032004 Ga0307414_10026644 Ga0307414_100266444 134
31 3300032004 Ga0307414_10049529 Ga0307414_100495294 134
32 3300032004 Ga0307414_10100923 Ga0307414_101009234 134
33 3300032004 Ga0307414_10171311 Ga0307414_101713112 134
34 3300032004 Ga0307414_10234035 Ga0307414_102340352 134
35 3300032004 Ga0307414_10802380 Ga0307414_108023802 134
36 3300046528 Ga0495642_0299197 Ga0495642_0299197_56_484 134
37 3300046684 Ga0495669_0000005 Ga0495669_0000005_190139_190567 134
38 3300047445 Ga0495677_0049745 Ga0495677_0049745_988_1416 134
39 3300048909 Ga0496106_0520816 Ga0496106_0520816_28_456 134
40 3300005331 Ga0070670_100039338 Ga0070670_1000393382 135
41 3300005347 Ga0070668_100002811 Ga0070668_1000028119 135
42 3300005353 Ga0070669_100034884 Ga0070669_1000348843 135
43 3300005355 Ga0070671_100004998 Ga0070671_1000049988 135
44 3300005367 Ga0070667_100001005 Ga0070667_10000100511 135
45 3300005456 Ga0070678_102162557 Ga0070678_1021625571 135
46 3300005548 Ga0070665_100286966 Ga0070665_1002869662 135
47 3300005617 Ga0068859_100003642 Ga0068859_10000364211 135
48 3300005719 Ga0068861_101834758 Ga0068861_1018347581 135
49 3300005841 Ga0068863_100003399 Ga0068863_10000339911 135
50 3300005842 Ga0068858_100147615 Ga0068858_1001476153 135
51 3300005843 Ga0068860_100011649 Ga0068860_1000116495 135
52 3300005844 Ga0068862_100158629 Ga0068862_1001586292 135
53 3300006042 Ga0075368_10003315 Ga0075368_100033153 135
54 3300006048 Ga0075363_100034502 Ga0075363_1000345023 135
55 3300006051 Ga0075364_10000210 Ga0075364_100002105 135
56 3300006178 Ga0075367_10000933 Ga0075367_100009337 135
57 3300006931 Ga0097620_100003642 Ga0097620_1000036422 135
58 3300009177 Ga0105248_10002553 Ga0105248_100025533 135
59 3300009551 Ga0105238_10285062 Ga0105238_102850622 135
60 3300013306 Ga0163162_10019678 Ga0163162_100196784 135
61 3300013307 Ga0157372_11547613 Ga0157372_115476131 135
62 3300014325 Ga0163163_10015842 Ga0163163_100158424 135
63 3300014968 Ga0157379_10009577 Ga0157379_100095773 135
64 3300025923 Ga0207681_10007767 Ga0207681_100077674 135
65 3300025925 Ga0207650_10269054 Ga0207650_102690542 135
66 3300025931 Ga0207644_10009342 Ga0207644_100093422 135
67 3300025941 Ga0207711_10055503 Ga0207711_100555033 135
68 3300025972 Ga0207668_10005921 Ga0207668_100059215 135
69 3300025986 Ga0207658_10004479 Ga0207658_1000447910 135
70 3300026035 Ga0207703_10031281 Ga0207703_100312812 135
71 3300026088 Ga0207641_10006675 Ga0207641_100066754 135
72 3300026121 Ga0207683_11845240 Ga0207683_118452401 135
73 3300027866 Ga0209813_10005264 Ga0209813_100052642 135
74 3300028379 Ga0268266_10673534 Ga0268266_106735342 135
75 3300028380 Ga0268265_10022201 Ga0268265_100222012 135
76 3300028381 Ga0268264_10015694 Ga0268264_100156943 135
77 3300046506 Ga0495583_0000002 Ga0495583_0000002_647053_647487 135
78 3300046684 Ga0495669_0000356 Ga0495669_0000356_4200_4628 135
79 3300046684 Ga0495669_0062060 Ga0495669_0062060_201_629 135
80 3300050491 nmdc:mga00v17_4310_c1 nmdc:mga00v17_4310_c1_1647_2075 135
81 3300050494 nmdc:mga06z11_90321_c1 nmdc:mga06z11_90321_c1_759_1187 135
82 3300050495 nmdc:mga04h51_5967_c1 nmdc:mga04h51_5967_c1_2442_2870 135
83 3300005331 Ga0070670_100000009 Ga0070670_100000009131 136
84 3300005335 Ga0070666_10045650 Ga0070666_100456503 136
85 3300005347 Ga0070668_100000225 Ga0070668_10000022511 136
86 3300005367 Ga0070667_100000730 Ga0070667_10000073030 136
87 3300005548 Ga0070665_100001314 Ga0070665_10000131426 136
88 3300005617 Ga0068859_100904766 Ga0068859_1009047662 136
89 3300005618 Ga0068864_100000052 Ga0068864_10000005221 136
90 3300005719 Ga0068861_100095717 Ga0068861_1000957172 136
91 3300005841 Ga0068863_100000438 Ga0068863_1000004383 136
92 3300005842 Ga0068858_100003449 Ga0068858_1000034499 136
93 3300005843 Ga0068860_100000184 Ga0068860_1000001843 136
94 3300005844 Ga0068862_100001953 Ga0068862_10000195315 136
95 3300006195 Ga0075366_10202752 Ga0075366_102027522 136
96 3300006931 Ga0097620_100904646 Ga0097620_1009046461 136
97 3300009177 Ga0105248_10128138 Ga0105248_101281383 136
98 3300009553 Ga0105249_10001585 Ga0105249_1000158515 136
99 3300013306 Ga0163162_10158719 Ga0163162_101587193 136
100 3300014968 Ga0157379_10004718 Ga0157379_100047189 136
101 3300017792 Ga0163161_10306789 Ga0163161_103067892 136
102 3300025903 Ga0207680_10021601 Ga0207680_100216013 136
103 3300025925 Ga0207650_10000014 Ga0207650_10000014283 136
104 3300025941 Ga0207711_10378285 Ga0207711_103782852 136
105 3300025961 Ga0207712_10001052 Ga0207712_100010523 136
106 3300025972 Ga0207668_10000118 Ga0207668_1000011820 136
107 3300025986 Ga0207658_10000285 Ga0207658_1000028511 136
108 3300026035 Ga0207703_10002554 Ga0207703_100025545 136
109 3300026088 Ga0207641_10004530 Ga0207641_100045309 136
110 3300026095 Ga0207676_10000069 Ga0207676_1000006976 136
111 3300026118 Ga0207675_100131213 Ga0207675_1001312132 136
112 3300028379 Ga0268266_10004835 Ga0268266_100048358 136
113 3300028380 Ga0268265_10011772 Ga0268265_100117722 136
114 3300028381 Ga0268264_10003752 Ga0268264_100037529 136
115 3300048905 Ga0496102_0302204 Ga0496102_0302204_602_1030 136
116 3300050490 nmdc:mga03n38_29706_c1 nmdc:mga03n38_29706_c1_981_1409 136
117 3300050493 nmdc:mga0k408_31585_c1 nmdc:mga0k408_31585_c1_637_1065 136
118 3300050496 nmdc:mga07m45_2974_c1 nmdc:mga07m45_2974_c1_5132_5560 136
119 3300005331 Ga0070670_101156224 Ga0070670_1011562241 137
120 3300005347 Ga0070668_100040540 Ga0070668_1000405404 137
121 3300005353 Ga0070669_100770622 Ga0070669_1007706221 137
122 3300005843 Ga0068860_100063992 Ga0068860_1000639925 137
123 3300025925 Ga0207650_10348837 Ga0207650_103488372 137
124 3300028380 Ga0268265_10039249 Ga0268265_100392492 137
125 3300028381 Ga0268264_10065122 Ga0268264_100651222 137
126 3300039453 Ga0436362_0515961 Ga0436362_0515961_101_538 137
127 iso_pu_bacteria 2643221598 2643999979 137
128 3300025299 Ga0209256_1002598 Ga0209256_10025984 138
129 3300028794 Ga0307515_10173981 Ga0307515_101739812 138
130 3300039437 Ga0436365_0602105 Ga0436365_0602105_100_558 138
131 3300046452 Ga0495617_057610 Ga0495617_057610_759_1193 138
132 3300046460 Ga0495638_0000960 Ga0495638_0000960_21512_21946 138
133 3300046460 Ga0495638_0001722 Ga0495638_0001722_15356_15790 138
134 3300046471 Ga0495650_0000068 Ga0495650_0000068_111673_112107 138
135 3300046512 Ga0495610_0001379 Ga0495610_0001379_3685_4119 138
136 3300046513 Ga0495616_0018305 Ga0495616_0018305_1447_1881 138
137 3300046515 Ga0495620_0040043 Ga0495620_0040043_864_1298 138
138 3300046518 Ga0495631_0207739 Ga0495631_0207739_101_535 138
139 3300046520 Ga0495637_0030909 Ga0495637_0030909_1466_1900 138
140 3300046524 Ga0495648_0093472 Ga0495648_0093472_604_1038 138
141 3300046530 Ga0495654_0000042 Ga0495654_0000042_151210_151644 138
142 3300046660 Ga0495625_0012636 Ga0495625_0012636_3225_3659 138
143 3300046660 Ga0495625_0063365 Ga0495625_0063365_339_773 138
144 3300046660 Ga0495625_0115070 Ga0495625_0115070_1080_1514 138
145 3300046691 Ga0495670_0069287 Ga0495670_0069287_1324_1758 138
146 3300046692 Ga0495671_0410093 Ga0495671_0410093_177_611 138
147 3300047320 Ga0495672_0002355 Ga0495672_0002355_4950_5384 138
148 3300047469 Ga0495673_0000886 Ga0495673_0000886_26108_26542 138
149 3300047470 Ga0495681_0189813 Ga0495681_0189813_123_557 138
150 3300047472 Ga0495686_0021994 Ga0495686_0021994_677_1111 138
151 3300047472 Ga0495686_0530745 Ga0495686_0530745_44_478 138
152 3300048918 Ga0496115_0019810 Ga0496115_0019810_337_771 138
153 3300053103 Ga0500555_058964 Ga0500555_058964_329_763 138
154 3300053104 Ga0500556_0000926 Ga0500556_0000926_8625_9059 138
155 3300053134 Ga0500658_0006304 Ga0500658_0006304_1993_2427 138
156 3300053153 Ga0500616_0030174 Ga0500616_0030174_1320_1754 138
157 3300053158 Ga0500627_0024995 Ga0500627_0024995_828_1262 138
158 3300053730 Ga0500645_001301 Ga0500645_001301_858_1292 138
159 3300031456 Ga0307513_10007633 Ga0307513_1000763311 139
160 3300047320 Ga0495672_0138908 Ga0495672_0138908_153_572 139
161 iso_pu_bacteria 2643221574 2643884476 139
162 iso_pu_bacteria 2643221663 2644351578 139
163 iso_pu_bacteria 2643221699 2644548830 139
164 iso_pu_bacteria 2643221699 2644551700 139
165 3300005366 Ga0070659_100008732 Ga0070659_1000087323 140
166 3300005564 Ga0070664_100061488 Ga0070664_1000614884 140
167 3300013100 Ga0157373_10005812 Ga0157373_100058123 140
168 3300013100 Ga0157373_10005961 Ga0157373_100059613 140
169 3300013104 Ga0157370_11365007 Ga0157370_113650071 140
170 3300025932 Ga0207690_10032632 Ga0207690_100326322 140
171 3300025945 Ga0207679_10049820 Ga0207679_100498204 140
172 3300026041 Ga0207639_10355876 Ga0207639_103558762 140
173 3300053104 Ga0500556_0003128 Ga0500556_0003128_2929_3354 140
174 3300053108 Ga0500562_001559 Ga0500562_001559_549_974 140
175 iso_pu_bacteria 2510917020 2511120442 140
176 iso_pu_bacteria 2582581279 2585146484 140
177 iso_pu_bacteria 2582581280 2585151923 140
178 iso_pu_bacteria 2582581293 2585194592 140
179 iso_pu_bacteria 2585428106 2587918449 140
180 iso_pu_bacteria 2643221545 2643748558 140
181 iso_pu_bacteria 2643221552 2643779516 140
182 iso_pu_bacteria 2643221583 2643923569 140
183 iso_pu_bacteria 2643221584 2643931085 140
184 iso_pu_bacteria 2643221640 2644224989 140
185 iso_pu_bacteria 2643221642 2644234077 140
186 iso_pu_bacteria 2643221691 2644510232 140
187 iso_pu_bacteria 2791355048 2792462878 140
188 iso_pu_bacteria 2818991435 2819537399 140
189 iso_pu_bacteria 2818991454 2819646539 140
190 iso_pu_bacteria 2843744320 2843746425 140
191 iso_pu_bacteria 2849560528 2849561861 140
192 iso_pu_bacteria 2849573788 2849574075 140
193 iso_pu_bacteria 2851153111 2851157753 140
194 iso_pu_bacteria 2857504554 2857505354 140
195 iso_pu_bacteria 2884960567 2884962384 140
196 iso_pu_bacteria 2898329390 2898332598 140
197 iso_pu_bacteria 2928531327 2928533188 140
198 3300005543 Ga0070672_101149174 Ga0070672_1011491742 141
199 3300005578 Ga0068854_100833334 Ga0068854_1008333341 141
200 3300005843 Ga0068860_101412263 Ga0068860_1014122632 141
201 3300006353 Ga0075370_10690095 Ga0075370_106900951 141
202 3300009093 Ga0105240_11900177 Ga0105240_119001771 141
203 3300009101 Ga0105247_10714423 Ga0105247_107144232 141
204 3300009176 Ga0105242_12478897 Ga0105242_124788971 141
205 3300009177 Ga0105248_10001118 Ga0105248_100011186 141
206 3300015262 Ga0182007_10209424 Ga0182007_102094242 141
207 3300017792 Ga0163161_10445328 Ga0163161_104453282 141
208 3300025937 Ga0207669_10157698 Ga0207669_101576981 141
209 3300025941 Ga0207711_10001597 Ga0207711_100015976 141
210 3300025981 Ga0207640_10501314 Ga0207640_105013141 141
211 3300031456 Ga0307513_10000208 Ga0307513_1000020881 141
212 3300031824 Ga0307413_10318790 Ga0307413_103187902 141
213 3300031901 Ga0307406_10590113 Ga0307406_105901132 141
214 3300032004 Ga0307414_10278801 Ga0307414_102788012 141
215 3300032004 Ga0307414_10516577 Ga0307414_105165771 141
216 3300032004 Ga0307414_10690140 Ga0307414_106901402 141
217 3300039437 Ga0436365_0580194 Ga0436365_0580194_247_675 141
218 3300044842 Ga0466957_1295115 Ga0466957_1295115_60_488 141
219 3300046512 Ga0495610_0050818 Ga0495610_0050818_313_741 141
220 3300046522 Ga0495643_0013567 Ga0495643_0013567_2271_2699 141
221 3300046528 Ga0495642_0329636 Ga0495642_0329636_115_543 141
222 3300046538 Ga0495609_0024340 Ga0495609_0024340_151_579 141
223 3300046542 Ga0495597_0007485 Ga0495597_0007485_4809_5237 141
224 3300046616 Ga0495668_0023860 Ga0495668_0023860_2210_2638 141
225 3300047673 Ga0495593_0028413 Ga0495593_0028413_2518_2946 141
226 3300048905 Ga0496102_0474916 Ga0496102_0474916_87_515 141
227 3300048920 Ga0496117_0029617 Ga0496117_0029617_1821_2249 141
228 3300048921 Ga0496118_0008572 Ga0496118_0008572_9666_10094 141
229 3300048922 Ga0496119_0029323 Ga0496119_0029323_3252_3680 141
230 3300048924 Ga0496121_0000067 Ga0496121_0000067_146403_146831 141
231 3300049581 Ga0501047_0037496 Ga0501047_0037496_3955_4392 141
232 3300049583 Ga0501067_0041764 Ga0501067_0041764_477_920 141
233 3300049589 Ga0501073_0046593 Ga0501073_0046593_2188_2631 141
234 3300049589 Ga0501073_0611469 Ga0501073_0611469_106_549 141
235 3300049593 Ga0501077_0116063 Ga0501077_0116063_496_939 141
236 3300050496 nmdc:mga07m45_421697_c1 nmdc:mga07m45_421697_c1_89_526 141
237 3300053087 Ga0500643_000399 Ga0500643_000399_656_1084 141
238 3300053093 Ga0500651_0017899 Ga0500651_0017899_2244_2672 141
239 3300053096 Ga0500641_0003251 Ga0500641_0003251_413_841 141
240 3300053108 Ga0500562_001263 Ga0500562_001263_1732_2166 141
241 3300053109 Ga0500569_002610 Ga0500569_002610_2391_2819 141
242 3300053119 Ga0500595_003498 Ga0500595_003498_1509_1937 141
243 3300053121 Ga0500607_112357 Ga0500607_112357_391_819 141
244 3300053122 Ga0500608_017120 Ga0500608_017120_1681_2109 141
245 3300053136 Ga0500559_0007165 Ga0500559_0007165_2113_2541 141
246 3300053153 Ga0500616_0015824 Ga0500616_0015824_307_735 141
247 3300053156 Ga0500622_0028259 Ga0500622_0028259_1251_1679 141
248 3300053729 Ga0500625_065027 Ga0500625_065027_763_1191 141
249 3300053730 Ga0500645_000131 Ga0500645_000131_8267_8695 141
250 3300053730 Ga0500645_000662 Ga0500645_000662_12472_12900 141
251 3300053730 Ga0500645_142346 Ga0500645_142346_136_564 141
252 3300053735 Ga0500596_000880 Ga0500596_000880_1441_1869 141
253 3300060353 Ga0501082_0096465 Ga0501082_0096465_1790_2233 141
254 3300009174 Ga0105241_11413637 Ga0105241_114136372 142
255 3300025911 Ga0207654_11055051 Ga0207654_110550511 142
256 3300025924 Ga0207694_10049535 Ga0207694_100495352 142
257 3300032004 Ga0307414_10108875 Ga0307414_101088751 142
258 3300032004 Ga0307414_10816883 Ga0307414_108168832 142
259 3300046515 Ga0495620_0115029 Ga0495620_0115029_529_963 142
260 3300009093 Ga0105240_10450598 Ga0105240_104505982 143
261 3300025942 Ga0207689_11629023 Ga0207689_116290231 143
262 3300028800 Ga0265338_10365096 Ga0265338_103650961 143
263 3300031456 Ga0307513_10663302 Ga0307513_106633021 143
264 3300031995 Ga0307409_102710234 Ga0307409_1027102341 143
265 3300053730 Ga0500645_028770 Ga0500645_028770_151_585 143
266 3300003215 JGI25153J46596_10057600 JGI25153J46596_100576002 144
267 3300003316 rootH1_10061495 rootH1_100614952 144
268 3300003322 rootL2_10166532 rootL2_101665322 144
269 3300003771 Ga0055526_1024078 Ga0055526_10240783 144
270 3300003773 Ga0055537_1004109 Ga0055537_10041095 144
271 3300003775 Ga0055524_1048252 Ga0055524_10482522 144
272 3300003781 Ga0055536_1006012 Ga0055536_10060123 144
273 3300003781 Ga0055536_1006740 Ga0055536_10067402 144
274 3300003791 Ga0055530_10004666 Ga0055530_1000466610 144
275 3300003791 Ga0055530_10039495 Ga0055530_100394952 144
276 3300003794 Ga0055531_10001306 Ga0055531_1000130615 144
277 3300003794 Ga0055531_10007308 Ga0055531_100073082 144
278 3300003794 Ga0055531_10027711 Ga0055531_100277112 144
279 3300005262 Ga0065165_1001479 Ga0065165_100147914 144
280 3300005563 Ga0068855_100438491 Ga0068855_1004384911 144
281 3300006038 Ga0075365_10202439 Ga0075365_102024392 144
282 3300006048 Ga0075363_100589744 Ga0075363_1005897442 144
283 3300006177 Ga0075362_10157112 Ga0075362_101571122 144
284 3300006186 Ga0075369_10014755 Ga0075369_100147552 144
285 3300006186 Ga0075369_10338532 Ga0075369_103385321 144
286 3300006195 Ga0075366_10012447 Ga0075366_100124479 144
287 3300006195 Ga0075366_10374110 Ga0075366_103741102 144
288 3300006353 Ga0075370_10105225 Ga0075370_101052252 144
289 3300013104 Ga0157370_10502422 Ga0157370_105024222 144
290 3300025263 Ga0209565_1000242 Ga0209565_100024237 144
291 3300025273 Ga0209673_1000976 Ga0209673_10009762 144
292 3300025291 Ga0209675_1012653 Ga0209675_10126532 144
293 3300025292 Ga0209676_1000115 Ga0209676_1000115161 144
294 3300025292 Ga0209676_1000289 Ga0209676_100028930 144
295 3300025292 Ga0209676_1000840 Ga0209676_100084012 144
296 3300025292 Ga0209676_1003457 Ga0209676_10034579 144
297 3300025295 Ga0209564_1006888 Ga0209564_10068885 144
298 3300025295 Ga0209564_1012054 Ga0209564_10120542 144
299 3300025295 Ga0209564_1020619 Ga0209564_10206192 144
300 3300025295 Ga0209564_1021174 Ga0209564_10211742 144
301 3300025297 Ga0209758_1002274 Ga0209758_10022746 144
302 3300025297 Ga0209758_1004608 Ga0209758_10046087 144
303 3300025298 Ga0209050_1002333 Ga0209050_10023333 144
304 3300025298 Ga0209050_1008775 Ga0209050_10087752 144
305 3300025298 Ga0209050_1018227 Ga0209050_10182273 144
306 3300025298 Ga0209050_1066184 Ga0209050_10661841 144
307 3300025299 Ga0209256_1002323 Ga0209256_100232312 144
308 3300025299 Ga0209256_1003071 Ga0209256_100307114 144
309 3300025303 Ga0209051_1004291 Ga0209051_10042912 144
310 3300025304 Ga0209257_1000036 Ga0209257_1000036414 144
311 3300025304 Ga0209257_1000090 Ga0209257_1000090143 144
312 3300025304 Ga0209257_1002980 Ga0209257_10029805 144
313 3300025304 Ga0209257_1016769 Ga0209257_10167693 144
314 3300025949 Ga0207667_10363821 Ga0207667_103638211 144
315 3300026067 Ga0207678_11786674 Ga0207678_117866741 144
316 3300028794 Ga0307515_10035485 Ga0307515_100354859 144
317 3300028794 Ga0307515_10048254 Ga0307515_100482547 144
318 3300028800 Ga0265338_10109986 Ga0265338_101099862 144
319 3300031852 Ga0307410_10449095 Ga0307410_104490952 144
320 3300031903 Ga0307407_10310542 Ga0307407_103105422 144
321 3300031995 Ga0307409_100071323 Ga0307409_1000713233 144
322 3300032002 Ga0307416_103031926 Ga0307416_1030319261 144
323 3300041451 Ga0451791_1483678 Ga0451791_1483678_77_511 144
324 3300041452 Ga0451793_1656818 Ga0451793_1656818_17_451 144
325 3300041501 Ga0451845_0148628 Ga0451845_0148628_262_696 144
326 3300041507 Ga0451851_1367725 Ga0451851_1367725_189_623 144
327 3300042001 Ga0439441_051308 Ga0439441_051308_159_593 144
328 3300042438 Ga0439459_0009492 Ga0439459_0009492_634_1068 144
329 3300042533 Ga0450901_033095 Ga0450901_033095_50_484 144
330 3300046453 Ga0495627_000397 Ga0495627_000397_25488_25922 144
331 3300046457 Ga0495590_0004604 Ga0495590_0004604_3656_4090 144
332 3300046460 Ga0495638_0002411 Ga0495638_0002411_3821_4255 144
333 3300046460 Ga0495638_0017416 Ga0495638_0017416_3242_3676 144
334 3300046460 Ga0495638_0138450 Ga0495638_0138450_917_1351 144
335 3300046460 Ga0495638_0238714 Ga0495638_0238714_470_904 144
336 3300046492 Ga0495585_0586691 Ga0495585_0586691_62_496 144
337 3300046501 Ga0495607_0067241 Ga0495607_0067241_95_529 144
338 3300046507 Ga0495606_0013667 Ga0495606_0013667_3620_4054 144
339 3300046512 Ga0495610_0003215 Ga0495610_0003215_9897_10331 144
340 3300046512 Ga0495610_0008833 Ga0495610_0008833_4539_4973 144
341 3300046513 Ga0495616_0002094 Ga0495616_0002094_3408_3842 144
342 3300046518 Ga0495631_0000827 Ga0495631_0000827_7835_8269 144
343 3300046519 Ga0495632_0001771 Ga0495632_0001771_13854_14288 144
344 3300046519 Ga0495632_0048616 Ga0495632_0048616_1544_1978 144
345 3300046524 Ga0495648_0000067 Ga0495648_0000067_95782_96216 144
346 3300046524 Ga0495648_0077085 Ga0495648_0077085_473_907 144
347 3300046524 Ga0495648_0202636 Ga0495648_0202636_536_970 144
348 3300046525 Ga0495663_0090322 Ga0495663_0090322_288_722 144
349 3300046530 Ga0495654_0215924 Ga0495654_0215924_299_733 144
350 3300046542 Ga0495597_0211701 Ga0495597_0211701_136_570 144
351 3300046558 Ga0495633_0371641 Ga0495633_0371641_168_602 144
352 3300046616 Ga0495668_0000026 Ga0495668_0000026_165938_166372 144
353 3300046616 Ga0495668_0001352 Ga0495668_0001352_8600_9034 144
354 3300046616 Ga0495668_0005590 Ga0495668_0005590_984_1418 144
355 3300046660 Ga0495625_0000127 Ga0495625_0000127_61323_61757 144
356 3300046660 Ga0495625_0006768 Ga0495625_0006768_3546_3980 144
357 3300046660 Ga0495625_0298985 Ga0495625_0298985_309_743 144
358 3300046664 Ga0495659_0122291 Ga0495659_0122291_114_548 144
359 3300046694 Ga0495649_0000077 Ga0495649_0000077_6475_6909 144
360 3300046794 Ga0495589_0022528 Ga0495589_0022528_1694_2128 144
361 3300046810 Ga0495660_0001489 Ga0495660_0001489_14183_14617 144
362 3300046810 Ga0495660_0037133 Ga0495660_0037133_2261_2695 144
363 3300046810 Ga0495660_0106784 Ga0495660_0106784_481_915 144
364 3300046810 Ga0495660_0342908 Ga0495660_0342908_147_581 144
365 3300047323 Ga0495683_0330051 Ga0495683_0330051_191_625 144
366 3300047446 Ga0495679_021909 Ga0495679_021909_1684_2118 144
367 3300047469 Ga0495673_0000208 Ga0495673_0000208_22603_23037 144
368 3300047469 Ga0495673_0000293 Ga0495673_0000293_54520_54954 144
369 3300047472 Ga0495686_0001958 Ga0495686_0001958_15588_16022 144
370 3300047472 Ga0495686_0023368 Ga0495686_0023368_1082_1516 144
371 3300047472 Ga0495686_0037936 Ga0495686_0037936_100_534 144
372 3300047472 Ga0495686_0083906 Ga0495686_0083906_1193_1627 144
373 3300048910 Ga0496107_0000113 Ga0496107_0000113_35017_35451 144
374 3300048924 Ga0496121_0014089 Ga0496121_0014089_4423_4857 144
375 3300048927 Ga0496124_0010685 Ga0496124_0010685_3397_3831 144
376 3300048928 Ga0496125_0027084 Ga0496125_0027084_1747_2181 144
377 3300048929 Ga0496126_0001854 Ga0496126_0001854_6533_6967 144
378 3300048929 Ga0496126_0238868 Ga0496126_0238868_1073_1507 144
379 3300048929 Ga0496126_0391011 Ga0496126_0391011_651_1085 144
380 3300049459 Ga0495678_001041 Ga0495678_001041_10003_10482 144
381 3300049671 Ga0501238_005449 Ga0501238_005449_316_750 144
382 3300050493 nmdc:mga0k408_312507_c1 nmdc:mga0k408_312507_c1_459_893 144
383 3300050493 nmdc:mga0k408_405104_c1 nmdc:mga0k408_405104_c1_121_555 144
384 3300050493 nmdc:mga0k408_433570_c1 nmdc:mga0k408_433570_c1_328_762 144
385 3300050516 nmdc:mga0sz30_3025_c1 nmdc:mga0sz30_3025_c1_3594_4028 144
386 3300053086 Ga0500578_0000309 Ga0500578_0000309_41773_42207 144
387 3300053086 Ga0500578_0132681 Ga0500578_0132681_311_745 144
388 3300053087 Ga0500643_034224 Ga0500643_034224_1031_1465 144
389 3300053088 Ga0500644_0000036 Ga0500644_0000036_25549_25983 144
390 3300053088 Ga0500644_0001274 Ga0500644_0001274_4461_4895 144
391 3300053088 Ga0500644_0040613 Ga0500644_0040613_1079_1513 144
392 3300053093 Ga0500651_0056426 Ga0500651_0056426_615_1049 144
393 3300053093 Ga0500651_0187694 Ga0500651_0187694_52_486 144
394 3300053102 Ga0500554_023353 Ga0500554_023353_1255_1689 144
395 3300053104 Ga0500556_0269700 Ga0500556_0269700_51_485 144
396 3300053108 Ga0500562_000770 Ga0500562_000770_4565_4999 144
397 3300053118 Ga0500594_0000456 Ga0500594_0000456_4784_5263 144
398 3300053119 Ga0500595_007363 Ga0500595_007363_253_690 144
399 3300053122 Ga0500608_001144 Ga0500608_001144_5388_5822 144
400 3300053123 Ga0500614_019626 Ga0500614_019626_597_1031 144
401 3300053125 Ga0500618_000074 Ga0500618_000074_47463_47897 144
402 3300053136 Ga0500559_0000086 Ga0500559_0000086_68810_69244 144
403 3300053136 Ga0500559_0006465 Ga0500559_0006465_2034_2468 144
404 3300053138 Ga0500564_000048 Ga0500564_000048_7364_7798 144
405 3300053142 Ga0500577_0001105 Ga0500577_0001105_4001_4435 144
406 3300053153 Ga0500616_0222649 Ga0500616_0222649_307_756 144
407 3300053156 Ga0500622_0003258 Ga0500622_0003258_5394_5828 144
408 3300053156 Ga0500622_0004093 Ga0500622_0004093_4662_5096 144
409 3300053156 Ga0500622_0115635 Ga0500622_0115635_371_805 144
410 3300053731 Ga0500609_000806 Ga0500609_000806_277_711 144
411 3300055283 Ga0500661_048445 Ga0500661_048445_169_603 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06676

DUF1178

Protein of unknown function (DUF1178)

16

154

0.95

Feature Viewer

pLDDT pTM Quality
86.08 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map