F437645

General Info

Members Datasets Scaffolds Average Seq Length
411 237 822 87

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0686866|Ga0501038_0686866_53_349
Length 98
Sequence VGFICSKRGIMANTSSAKKATRKIERRTAVNRVRRSRVRSFVRKVEEALAAGDKAAAEAALRSAQPELMRAAGKGVVHKNTASRKVSRLARRVKALSA

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
94 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
104 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
112 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
113 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
114 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
115 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
116 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
117 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
118 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
121 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
122 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
123 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
124 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
125 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
126 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
127 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
128 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
129 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
130 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
131 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
132 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
133 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
210 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
211 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
212 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
213 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
214 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
217 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
218 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 2508501050 Microvirga lupini Lut6 Isolate Nodule
222 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
223 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
224 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
225 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
226 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
227 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
228 2643221688 Rhizobium sp. Root482 Isolate Unclassified
229 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
230 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
231 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
232 2902330777 Methylobacterium sp. 2A Isolate Unclassified
233 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
234 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
235 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
236 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
237 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.86
Metatranscriptomes 0
Isolates 4.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.33
Nodule 1.22
Rhizoplane 3.89
Rhizosphere 83.45
Stem 0
Stem Tuber 0
Unclassified 5.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0686866 3300049574 Bacteria 768
2 Ga0070670_100099114 3300005331 Bacteria 2508
3 Ga0070680_100004260 3300005336 Bacteria 10745
4 Ga0070668_100018393 3300005347 Bacteria 5246
5 Ga0070668_100082743 3300005347 Bacteria 2518
6 Ga0070669_100123584 3300005353 Bacteria 1978
7 Ga0070667_100031628 3300005367 Bacteria 4411
8 Ga0070711_100581480 3300005439 Unclassified 932
9 Ga0070694_100833107 3300005444 Bacteria 758
10 Ga0070663_100226311 3300005455 Bacteria 1471
11 Ga0070681_10000010 3300005458 Bacteria 140126
12 Ga0070707_100007153 3300005468 Bacteria 10346
13 Ga0070698_100080520 3300005471 Bacteria 3252
14 Ga0070699_101792484 3300005518 Bacteria 562
15 Ga0070679_100001887 3300005530 Bacteria 18834
16 Ga0070665_101457583 3300005548 Bacteria 693
17 Ga0068855_100031097 3300005563 Bacteria 6377
18 Ga0068852_100003038 3300005616 Bacteria 11673
19 Ga0068859_100530272 3300005617 Bacteria 1272
20 Ga0068859_100917690 3300005617 Unclassified 960
21 Ga0068864_100254714 3300005618 Bacteria 1631
22 Ga0068861_100077250 3300005719 Bacteria 2597
23 Ga0068863_100266693 3300005841 Bacteria 1656
24 Ga0068860_100006131 3300005843 Bacteria 12091
25 Ga0068862_100042981 3300005844 Bacteria 3851
26 Ga0075365_10650869 3300006038 Bacteria 745
27 Ga0075368_10089476 3300006042 Bacteria 1259
28 Ga0070715_10966895 3300006163 Bacteria 528
29 Ga0070712_100177739 3300006175 Unclassified 1656
30 Ga0075367_10202105 3300006178 Bacteria 1241
31 Ga0075367_10498230 3300006178 Bacteria 773
32 Ga0075367_10514280 3300006178 Bacteria 760
33 Ga0075366_10042924 3300006195 Bacteria 2678
34 Ga0075366_10050488 3300006195 Bacteria 2470
35 Ga0097620_100530355 3300006931 Bacteria 1272
36 Ga0097620_100917765 3300006931 Unclassified 960
37 Ga0075435_100647414 3300007076 Bacteria 917
38 Ga0105240_10000382 3300009093 Bacteria 83108
39 Ga0105240_10093800 3300009093 Bacteria 3663
40 Ga0111539_10765497 3300009094 Bacteria 1124
41 Ga0105245_13251603 3300009098 Bacteria 503
42 Ga0105247_10068844 3300009101 Bacteria 2207
43 Ga0114129_10155221 3300009147 Bacteria 3131
44 Ga0114129_11136402 3300009147 Bacteria 976
45 Ga0105243_10449740 3300009148 Bacteria 1208
46 Ga0105241_11584423 3300009174 Bacteria 633
47 Ga0105248_10398172 3300009177 Bacteria 1550
48 Ga0105248_10788323 3300009177 Bacteria 1073
49 Ga0105238_10110381 3300009551 Bacteria 2731
50 Ga0105238_12179947 3300009551 Bacteria 589
51 Ga0105249_11892496 3300009553 Bacteria 669
52 Ga0105239_10006694 3300010375 Bacteria 13313
53 Ga0105239_10017712 3300010375 Bacteria 7881
54 Ga0157369_11110983 3300013105 Bacteria 808
55 Ga0163162_10162075 3300013306 Bacteria 2358
56 Ga0157372_10016579 3300013307 Bacteria 7906
57 Ga0157379_11558666 3300014968 Bacteria 644
58 Ga0157379_11759535 3300014968 Bacteria 608
59 Ga0157376_10445668 3300014969 Bacteria 1262
60 Ga0163161_11877602 3300017792 Bacteria 533
61 Ga0213876_10000538 3300021384 Bacteria 28558
62 Ga0213876_10657346 3300021384 Unclassified 558
63 Ga0209130_1019039 3300025284 Bacteria 1601
64 Ga0209025_1092908 3300025294 Bacteria 980
65 Ga0207685_10528534 3300025905 Bacteria 624
66 Ga0207707_10000005 3300025912 Bacteria 382024
67 Ga0207695_10000004 3300025913 Bacteria 1288665
68 Ga0207660_10001159 3300025917 Bacteria 17611
69 Ga0207652_10003831 3300025921 Bacteria 12337
70 Ga0207646_10008113 3300025922 Bacteria 10574
71 Ga0207681_10822227 3300025923 Bacteria 776
72 Ga0207694_10000010 3300025924 Bacteria 439722
73 Ga0207694_11014306 3300025924 Bacteria 702
74 Ga0207650_10148900 3300025925 Bacteria 1846
75 Ga0207709_11570644 3300025935 Unclassified 546
76 Ga0207669_11668548 3300025937 Bacteria 544
77 Ga0207711_10548446 3300025941 Bacteria 1078
78 Ga0207711_10833813 3300025941 Bacteria 858
79 Ga0207667_10000065 3300025949 Bacteria 186655
80 Ga0207712_10306081 3300025961 Bacteria 1306
81 Ga0207712_10395435 3300025961 Bacteria 1160
82 Ga0207712_11887385 3300025961 Bacteria 535
83 Ga0207668_10054485 3300025972 Bacteria 2776
84 Ga0207658_10724840 3300025986 Bacteria 899
85 Ga0207639_11744608 3300026041 Bacteria 583
86 Ga0207678_11108961 3300026067 Bacteria 701
87 Ga0207641_10017251 3300026088 Bacteria 5910
88 Ga0207676_10221794 3300026095 Bacteria 1684
89 Ga0207675_100110833 3300026118 Bacteria 2589
90 Ga0207698_10019601 3300026142 Bacteria 4635
91 Ga0209371_1093198 3300027312 Bacteria 505
92 Ga0209813_10240850 3300027866 Bacteria 684
93 Ga0268266_10047886 3300028379 Bacteria 3663
94 Ga0268266_11268324 3300028379 Bacteria 712
95 Ga0268265_10058200 3300028380 Bacteria 2949
96 Ga0268264_10067113 3300028381 Bacteria 3027
97 Ga0265338_10037107 3300028800 Bacteria 4646
98 Ga0268256_1102548 3300030500 Bacteria 507
99 Ga0265320_10231243 3300031240 Bacteria 822
100 Ga0265325_10004568 3300031241 Bacteria 8709
101 Ga0265325_10036816 3300031241 Bacteria 2591
102 Ga0265325_10069104 3300031241 Bacteria 1777
103 Ga0265340_10054481 3300031247 Bacteria 1928
104 Ga0265340_10054870 3300031247 Bacteria 1921
105 Ga0265339_10024819 3300031249 Bacteria 3450
106 Ga0265339_10037189 3300031249 Bacteria 2721
107 Ga0265339_10113287 3300031249 Bacteria 1401
108 Ga0265331_10058619 3300031250 Bacteria 1823
109 Ga0265316_10038784 3300031344 Bacteria 3833
110 Ga0265316_10181218 3300031344 Bacteria 1568
111 Ga0307513_10265996 3300031456 Bacteria 1501
112 Ga0307408_100504817 3300031548 Bacteria 1059
113 Ga0265313_10017978 3300031595 Bacteria 3990
114 Ga0265313_10029064 3300031595 Bacteria 2864
115 Ga0265313_10378827 3300031595 Bacteria 557
116 Ga0316575_10371019 3300031665 Unclassified 611
117 Ga0265314_10019025 3300031711 Bacteria 5329
118 Ga0265342_10030944 3300031712 Bacteria 3313
119 Ga0265342_10031699 3300031712 Bacteria 3266
120 Ga0265342_10174649 3300031712 Bacteria 1180
121 Ga0316576_10006673 3300031727 Bacteria 7209
122 Ga0316578_10443884 3300031728 Bacteria 767
123 Ga0307516_10197428 3300031730 Unclassified 1734
124 Ga0307413_11077109 3300031824 Bacteria 693
125 Ga0307412_10336109 3300031911 Bacteria 1207
126 Ga0307412_12276702 3300031911 Bacteria 505
127 Ga0307414_10665700 3300032004 Bacteria 939
128 Ga0307414_10927609 3300032004 Bacteria 799
129 Ga0307411_11807978 3300032005 Bacteria 567
130 Ga0307411_11842945 3300032005 Bacteria 562
131 Ga0307415_101100449 3300032126 Bacteria 744
132 Ga0307415_101722849 3300032126 Unclassified 605
133 Ga0316583_10124675 3300032133 Bacteria 898
134 Ga0316574_0000352 3300035398 Bacteria 17817
135 Ga0316582_0987339 3300036647 Bacteria 575
136 Ga0316584_0006366 3300036712 Bacteria 7996
137 Ga0395900_0263900 3300037418 Bacteria 1719
138 Ga0395900_0719363 3300037418 Unclassified 931
139 Ga0395898_0481815 3300037466 Bacteria 1180
140 Ga0395905_0008005 3300037471 Bacteria 10444
141 Ga0395905_0101407 3300037471 Bacteria 2702
142 Ga0395905_0368054 3300037471 Bacteria 1330
143 Ga0395901_0867337 3300038443 Bacteria 887
144 Ga0400485_03648 3300038735 Bacteria 1143
145 Ga0436365_0769465 3300039437 Bacteria 36515
146 Ga0436365_1244619 3300039437 Unclassified 541
147 Ga0439436_0006530 3300041404 Bacteria 3580
148 Ga0439436_0245229 3300041404 Unclassified 519
149 Ga0439438_013147 3300041405 Bacteria 2509
150 Ga0439439_0136142 3300041406 Bacteria 691
151 Ga0439447_095323 3300041407 Bacteria 683
152 Ga0439466_0013268 3300041411 Bacteria 3017
153 Ga0439465_0005196 3300041413 Bacteria 4174
154 Ga0451797_1314863 3300041453 Bacteria 588
155 Ga0451807_0015263 3300041486 Bacteria 705
156 Ga0451807_0778443 3300041486 Bacteria 630
157 Ga0451853_3996971 3300041512 Bacteria 563
158 Ga0439431_0117357 3300041997 Bacteria 740
159 Ga0439433_0089758 3300041999 Bacteria 754
160 Ga0439432_119789 3300042006 Bacteria 780
161 Ga0439432_148866 3300042006 Bacteria 687
162 Ga0439449_0051416 3300042007 Bacteria 1524
163 Ga0439449_0172961 3300042007 Bacteria 807
164 Ga0439451_118648 3300042009 Unclassified 538
165 Ga0450919_046649 3300042121 Bacteria 506
166 Ga0450920_008058 3300042122 Bacteria 1920
167 Ga0450906_004243 3300042145 Bacteria 3015
168 Ga0450907_006649 3300042146 Bacteria 1931
169 Ga0450910_020950 3300042147 Bacteria 988
170 Ga0439446_0315349 3300042156 Bacteria 551
171 Ga0450909_067858 3300042185 Bacteria 568
172 Ga0439434_0011435 3300042435 Bacteria 2624
173 Ga0450918_003392 3300042531 Bacteria 2962
174 Ga0466961_0594308 3300044693 Bacteria 666
175 Ga0466963_0830388 3300044694 Bacteria 652
176 Ga0466968_0030840 3300044735 Bacteria 2222
177 Ga0466970_0170593 3300044765 Bacteria 1206
178 Ga0466970_0786606 3300044765 Bacteria 557
179 Ga0466957_1296535 3300044842 Bacteria 528
180 Ga0466960_0369560 3300044901 Bacteria 821
181 Ga0466960_0848776 3300044901 Bacteria 555
182 Ga0466959_1149578 3300045049 Bacteria 516
183 Ga0495638_0061409 3300046460 Bacteria 2322
184 Ga0495638_0074143 3300046460 Bacteria 2076
185 Ga0495651_0394615 3300046462 Unclassified 905
186 Ga0495663_0359549 3300046525 Bacteria 531
187 Ga0495652_0561044 3300046529 Bacteria 784
188 Ga0495587_0317272 3300046536 Bacteria 871
189 Ga0495667_0208292 3300046559 Bacteria 1250
190 Ga0495625_0389195 3300046660 Bacteria 873
191 Ga0495635_0236773 3300046663 Bacteria 1232
192 Ga0495599_0771986 3300046678 Bacteria 550
193 Ga0495672_0470785 3300047320 Bacteria 563
194 Ga0495675_0473536 3300047444 Bacteria 722
195 Ga0495684_0486488 3300047471 Bacteria 851
196 Ga0495686_0092995 3300047472 Bacteria 1829
197 Ga0495602_0080832 3300048088 Bacteria 2736
198 Ga0496102_0429873 3300048905 Bacteria 1240
199 Ga0496102_0904929 3300048905 Bacteria 804
200 Ga0496102_1512331 3300048905 Unclassified 590
201 Ga0496103_0305806 3300048906 Bacteria 1023
202 Ga0496104_0742751 3300048907 Bacteria 888
203 Ga0496106_0124317 3300048909 Bacteria 2019
204 Ga0496107_0283904 3300048910 Bacteria 1232
205 Ga0496108_1039652 3300048911 Bacteria 698
206 Ga0496108_1101999 3300048911 Bacteria 675
207 Ga0496112_0438593 3300048915 Bacteria 1244
208 Ga0496113_0948183 3300048916 Bacteria 679
209 Ga0496114_0561734 3300048917 Bacteria 1008
210 Ga0496115_0817952 3300048918 Bacteria 724
211 Ga0496122_0144771 3300048925 Bacteria 1479
212 Ga0496123_0324595 3300048926 Bacteria 725
213 Ga0496126_0603240 3300048929 Bacteria 865
214 Ga0496126_1003119 3300048929 Bacteria 626
215 Ga0495682_0001266 3300049460 Bacteria 14185
216 Ga0501031_0000015 3300049568 Bacteria 113809
217 Ga0501031_0098435 3300049568 Bacteria 1908
218 Ga0501031_0429440 3300049568 Bacteria 854
219 Ga0501031_0625864 3300049568 Bacteria 692
220 Ga0501031_0802994 3300049568 Unclassified 603
221 Ga0501032_0000008 3300049569 Bacteria 240313
222 Ga0501032_0010141 3300049569 Bacteria 6799
223 Ga0501032_0139395 3300049569 Bacteria 1597
224 Ga0501032_0203007 3300049569 Bacteria 1294
225 Ga0501032_0293362 3300049569 Bacteria 1052
226 Ga0501033_0000012 3300049570 Bacteria 241599
227 Ga0501033_0007706 3300049570 Bacteria 8352
228 Ga0501033_0096575 3300049570 Bacteria 2159
229 Ga0501033_0125189 3300049570 Bacteria 1863
230 Ga0501033_0278409 3300049570 Bacteria 1181
231 Ga0501033_0304282 3300049570 Bacteria 1122
232 Ga0501034_0000035 3300049571 Bacteria 241623
233 Ga0501034_0034982 3300049571 Bacteria 5094
234 Ga0501034_0128348 3300049571 Bacteria 2520
235 Ga0501034_0447089 3300049571 Bacteria 1210
236 Ga0501034_0706317 3300049571 Bacteria 906
237 Ga0501034_1418265 3300049571 Bacteria 569
238 Ga0501036_0000006 3300049572 Bacteria 241623
239 Ga0501036_0014674 3300049572 Bacteria 6530
240 Ga0501036_0119922 3300049572 Bacteria 2221
241 Ga0501036_0255434 3300049572 Bacteria 1468
242 Ga0501036_0276831 3300049572 Bacteria 1405
243 Ga0501037_0000123 3300049573 Bacteria 72229
244 Ga0501037_0030124 3300049573 Bacteria 4009
245 Ga0501037_0214533 3300049573 Bacteria 1356
246 Ga0501037_0445525 3300049573 Bacteria 884
247 Ga0501037_0514578 3300049573 Unclassified 811
248 Ga0501037_0834611 3300049573 Bacteria 607
249 Ga0501037_1018810 3300049573 Bacteria 539
250 Ga0501038_0000007 3300049574 Bacteria 210775
251 Ga0501038_0032333 3300049574 Bacteria 4617
252 Ga0501038_0132179 3300049574 Bacteria 2048
253 Ga0501038_0206031 3300049574 Bacteria 1576
254 Ga0501038_0224976 3300049574 Bacteria 1495
255 Ga0501039_0000012 3300049575 Bacteria 241623
256 Ga0501039_0060915 3300049575 Bacteria 2922
257 Ga0501039_0156446 3300049575 Bacteria 1790
258 Ga0501039_0230676 3300049575 Bacteria 1455
259 Ga0501039_1452054 3300049575 Bacteria 528
260 Ga0501040_0021997 3300049576 Bacteria 4263
261 Ga0501040_0040457 3300049576 Bacteria 3172
262 Ga0501040_0097193 3300049576 Bacteria 2051
263 Ga0501041_0077702 3300049577 Bacteria 2042
264 Ga0501042_0024135 3300049578 Bacteria 4263
265 Ga0501042_0046528 3300049578 Bacteria 3093
266 Ga0501042_0587683 3300049578 Bacteria 809
267 Ga0501043_0000432 3300049579 Bacteria 37703
268 Ga0501043_0031636 3300049579 Bacteria 4159
269 Ga0501043_0044899 3300049579 Bacteria 3475
270 Ga0501043_0123552 3300049579 Bacteria 2030
271 Ga0501043_0494299 3300049579 Bacteria 915
272 Ga0501043_1231598 3300049579 Bacteria 524
273 Ga0501046_0010146 3300049580 Bacteria 8107
274 Ga0501046_0129531 3300049580 Bacteria 1914
275 Ga0501046_0345093 3300049580 Bacteria 1082
276 Ga0501046_0363943 3300049580 Bacteria 1048
277 Ga0501046_0492793 3300049580 Bacteria 878
278 Ga0501047_0045298 3300049581 Bacteria 4253
279 Ga0501047_0097057 3300049581 Bacteria 2825
280 Ga0501047_0191454 3300049581 Bacteria 1908
281 Ga0501047_0214737 3300049581 Bacteria 1781
282 Ga0501047_0315884 3300049581 Bacteria 1402
283 Ga0501047_0615067 3300049581 Bacteria 907
284 Ga0501047_0848355 3300049581 Bacteria 727
285 Ga0501047_0911632 3300049581 Bacteria 692
286 Ga0501048_0033655 3300049582 Bacteria 3701
287 Ga0501048_0042101 3300049582 Bacteria 3271
288 Ga0501048_0732195 3300049582 Bacteria 710
289 Ga0501067_0041896 3300049583 Bacteria 2543
290 Ga0501067_0056268 3300049583 Bacteria 2179
291 Ga0501067_0359957 3300049583 Bacteria 811
292 Ga0501067_0674664 3300049583 Bacteria 580
293 Ga0501068_0256852 3300049584 Bacteria 1114
294 Ga0501069_0077427 3300049585 Bacteria 1870
295 Ga0501069_0089062 3300049585 Bacteria 1744
296 Ga0501070_0098094 3300049586 Bacteria 2424
297 Ga0501070_0115559 3300049586 Bacteria 2216
298 Ga0501070_0149895 3300049586 Bacteria 1924
299 Ga0501070_0194437 3300049586 Bacteria 1666
300 Ga0501070_0541775 3300049586 Bacteria 932
301 Ga0501070_0766217 3300049586 Bacteria 760
302 Ga0501070_0967518 3300049586 Bacteria 661
303 Ga0501070_1281064 3300049586 Bacteria 560
304 Ga0501071_0010741 3300049587 Bacteria 6141
305 Ga0501071_0060024 3300049587 Bacteria 2752
306 Ga0501072_0009586 3300049588 Bacteria 7363
307 Ga0501072_0025426 3300049588 Bacteria 4612
308 Ga0501072_0784390 3300049588 Bacteria 747
309 Ga0501072_1566745 3300049588 Bacteria 508
310 Ga0501073_0213169 3300049589 Bacteria 1334
311 Ga0501073_1134957 3300049589 Bacteria 537
312 Ga0501074_0037257 3300049590 Bacteria 3526
313 Ga0501074_0071296 3300049590 Bacteria 2498
314 Ga0501074_0217584 3300049590 Bacteria 1360
315 Ga0501074_1344751 3300049590 Bacteria 500
316 Ga0501075_0016758 3300049591 Bacteria 5284
317 Ga0501075_0047310 3300049591 Bacteria 3233
318 Ga0501076_0015876 3300049592 Bacteria 5698
319 Ga0501076_0339518 3300049592 Bacteria 1233
320 Ga0501077_0017381 3300049593 Bacteria 4539
321 Ga0501077_0075473 3300049593 Unclassified 2135
322 Ga0501077_0664537 3300049593 Bacteria 669
323 Ga0501079_0049728 3300049741 Bacteria 3236
324 Ga0501079_0055899 3300049741 Bacteria 3045
325 Ga0501079_0179271 3300049741 Bacteria 1653
326 Ga0501080_0032369 3300049742 Bacteria 4876
327 Ga0501080_0034712 3300049742 Bacteria 4710
328 Ga0501080_0038923 3300049742 Bacteria 4438
329 Ga0501080_0180795 3300049742 Bacteria 1941
330 Ga0501080_0236748 3300049742 Bacteria 1668
331 Ga0501080_1102591 3300049742 Bacteria 685
332 Ga0501080_1196356 3300049742 Bacteria 653
333 Ga0501080_1368741 3300049742 Bacteria 604
334 Ga0501081_0042779 3300049743 Bacteria 3105
335 Ga0501081_0471374 3300049743 Bacteria 934
336 Ga0501081_0599281 3300049743 Bacteria 825
337 Ga0501083_0054563 3300049744 Bacteria 2682
338 Ga0501083_0085947 3300049744 Bacteria 2081
339 Ga0501083_0089675 3300049744 Bacteria 2031
340 Ga0501083_0284674 3300049744 Bacteria 1075
341 Ga0501083_0504911 3300049744 Bacteria 787
342 Ga0501083_1138444 3300049744 Unclassified 508
343 Ga0501035_0000035 3300049822 Bacteria 166916
344 Ga0501035_0024680 3300049822 Bacteria 5511
345 Ga0501035_0037725 3300049822 Bacteria 4374
346 Ga0501035_0158104 3300049822 Bacteria 1963
347 Ga0501035_1131231 3300049822 Bacteria 610
348 Ga0501035_1307363 3300049822 Bacteria 559
349 Ga0501035_1464424 3300049822 Bacteria 522
350 Ga0501044_0000015 3300049823 Bacteria 241623
351 Ga0501044_0022334 3300049823 Bacteria 6743
352 Ga0501044_0023779 3300049823 Bacteria 6515
353 Ga0501044_0037120 3300049823 Bacteria 5094
354 Ga0501044_0046716 3300049823 Bacteria 4482
355 Ga0501044_0457079 3300049823 Bacteria 1183
356 Ga0501044_0565334 3300049823 Bacteria 1033
357 Ga0501044_0934703 3300049823 Bacteria 741
358 Ga0501044_1552271 3300049823 Bacteria 527
359 Ga0501045_0004002 3300049824 Bacteria 10148
360 Ga0501045_0123072 3300049824 Bacteria 1926
361 Ga0501045_0322827 3300049824 Bacteria 1149
362 nmdc:mga0yw44_452737_c1 3300050492 Bacteria 870
363 nmdc:mga0k408_139021_c1 3300050493 Bacteria 1444
364 nmdc:mga0k408_891157_c1 3300050493 Bacteria 516
365 nmdc:mga05p37_1732915_c1 3300050507 Bacteria 607
366 Ga0495601_0203507 3300053077 Unclassified 1293
367 Ga0495612_0117970 3300053078 Bacteria 1140
368 Ga0495655_0014530 3300053083 Bacteria 1653
369 Ga0495595_0554409 3300053084 Bacteria 587
370 Ga0495619_0811440 3300053085 Unclassified 632
371 Ga0500644_0028799 3300053088 Bacteria 1740
372 Ga0500608_014233 3300053122 Bacteria 3547
373 Ga0500559_0002561 3300053136 Bacteria 9324
374 Ga0500568_0044558 3300053139 Bacteria 1769
375 Ga0500577_0385316 3300053142 Bacteria 613
376 Ga0500604_0132157 3300053151 Bacteria 840
377 Ga0500616_0078229 3300053153 Bacteria 1668
378 Ga0500619_261039 3300053154 Bacteria 568
379 Ga0500622_0000323 3300053156 Bacteria 47794
380 Ga0500627_0072706 3300053158 Bacteria 1525
381 Ga0500627_0196307 3300053158 Bacteria 905
382 Ga0500627_0218945 3300053158 Bacteria 850
383 Ga0500627_0244346 3300053158 Bacteria 796
384 Ga0501084_0013768 3300054114 Bacteria 6694
385 Ga0501084_0025016 3300054114 Bacteria 4982
386 Ga0501084_0110835 3300054114 Bacteria 2306
387 Ga0501084_0129703 3300054114 Bacteria 2122
388 Ga0501084_0278794 3300054114 Bacteria 1411
389 Ga0501084_0812394 3300054114 Bacteria 787
390 Ga0501084_1744146 3300054114 Bacteria 520
391 Ga0501082_0058728 3300060353 Bacteria 3314
392 Ga0501082_0106284 3300060353 Bacteria 2428
393 Ga0501082_0131521 3300060353 Bacteria 2171
394 Ga0501082_0609812 3300060353 Bacteria 955
395 2508734381 2508501050 Bacteria 9633614
396 2509074919 2508501114 Bacteria 7082538
397 2513996294 2513237159 Bacteria 6810126
398 2585394781 2582581866 Bacteria 6859583
399 2596372225 2595698237 Bacteria 6712432
400 2643774630 2643221551 Bacteria 3750538
401 2643793075 2643221555 Bacteria 3749717
402 2644495458 2643221688 Bacteria 5260751
403 2835317554 2835312727 Bacteria 7413381
404 2842521252 2842521101 Bacteria 6569494
405 2889310839 2889306138 Bacteria 6358934
406 2902336593 2902330777 Bacteria 6395352
407 2902406800 2902405164 Bacteria 6784948
408 2917557900 2917554339 Bacteria 4987857
409 2920763728 2920760137 Bacteria 7427611
410 2928126918 2928125067 Bacteria 5937560
411 8054568131 8054563764 Bacteria 5592885
412 Ga0501038_0686866
413 Ga0070670_100099114
414 Ga0070680_100004260
415 Ga0070668_100018393
416 Ga0070668_100082743
417 Ga0070669_100123584
418 Ga0070667_100031628
419 Ga0070711_100581480
420 Ga0070694_100833107
421 Ga0070663_100226311
422 Ga0070681_10000010
423 Ga0070707_100007153
424 Ga0070698_100080520
425 Ga0070699_101792484
426 Ga0070679_100001887
427 Ga0070665_101457583
428 Ga0068855_100031097
429 Ga0068852_100003038
430 Ga0068859_100530272
431 Ga0068859_100917690
432 Ga0068864_100254714
433 Ga0068861_100077250
434 Ga0068863_100266693
435 Ga0068860_100006131
436 Ga0068862_100042981
437 Ga0075365_10650869
438 Ga0075368_10089476
439 Ga0070715_10966895
440 Ga0070712_100177739
441 Ga0075367_10202105
442 Ga0075367_10498230
443 Ga0075367_10514280
444 Ga0075366_10042924
445 Ga0075366_10050488
446 Ga0097620_100530355
447 Ga0097620_100917765
448 Ga0075435_100647414
449 Ga0105240_10000382
450 Ga0105240_10093800
451 Ga0111539_10765497
452 Ga0105245_13251603
453 Ga0105247_10068844
454 Ga0114129_10155221
455 Ga0114129_11136402
456 Ga0105243_10449740
457 Ga0105241_11584423
458 Ga0105248_10398172
459 Ga0105248_10788323
460 Ga0105238_10110381
461 Ga0105238_12179947
462 Ga0105249_11892496
463 Ga0105239_10006694
464 Ga0105239_10017712
465 Ga0157369_11110983
466 Ga0163162_10162075
467 Ga0157372_10016579
468 Ga0157379_11558666
469 Ga0157379_11759535
470 Ga0157376_10445668
471 Ga0163161_11877602
472 Ga0213876_10000538
473 Ga0213876_10657346
474 Ga0209130_1019039
475 Ga0209025_1092908
476 Ga0207685_10528534
477 Ga0207707_10000005
478 Ga0207695_10000004
479 Ga0207660_10001159
480 Ga0207652_10003831
481 Ga0207646_10008113
482 Ga0207681_10822227
483 Ga0207694_10000010
484 Ga0207694_11014306
485 Ga0207650_10148900
486 Ga0207709_11570644
487 Ga0207669_11668548
488 Ga0207711_10548446
489 Ga0207711_10833813
490 Ga0207667_10000065
491 Ga0207712_10306081
492 Ga0207712_10395435
493 Ga0207712_11887385
494 Ga0207668_10054485
495 Ga0207658_10724840
496 Ga0207639_11744608
497 Ga0207678_11108961
498 Ga0207641_10017251
499 Ga0207676_10221794
500 Ga0207675_100110833
501 Ga0207698_10019601
502 Ga0209371_1093198
503 Ga0209813_10240850
504 Ga0268266_10047886
505 Ga0268266_11268324
506 Ga0268265_10058200
507 Ga0268264_10067113
508 Ga0265338_10037107
509 Ga0268256_1102548
510 Ga0265320_10231243
511 Ga0265325_10004568
512 Ga0265325_10036816
513 Ga0265325_10069104
514 Ga0265340_10054481
515 Ga0265340_10054870
516 Ga0265339_10024819
517 Ga0265339_10037189
518 Ga0265339_10113287
519 Ga0265331_10058619
520 Ga0265316_10038784
521 Ga0265316_10181218
522 Ga0307513_10265996
523 Ga0307408_100504817
524 Ga0265313_10017978
525 Ga0265313_10029064
526 Ga0265313_10378827
527 Ga0316575_10371019
528 Ga0265314_10019025
529 Ga0265342_10030944
530 Ga0265342_10031699
531 Ga0265342_10174649
532 Ga0316576_10006673
533 Ga0316578_10443884
534 Ga0307516_10197428
535 Ga0307413_11077109
536 Ga0307412_10336109
537 Ga0307412_12276702
538 Ga0307414_10665700
539 Ga0307414_10927609
540 Ga0307411_11807978
541 Ga0307411_11842945
542 Ga0307415_101100449
543 Ga0307415_101722849
544 Ga0316583_10124675
545 Ga0316574_0000352
546 Ga0316582_0987339
547 Ga0316584_0006366
548 Ga0395900_0263900
549 Ga0395900_0719363
550 Ga0395898_0481815
551 Ga0395905_0008005
552 Ga0395905_0101407
553 Ga0395905_0368054
554 Ga0395901_0867337
555 Ga0400485_03648
556 Ga0436365_0769465
557 Ga0436365_1244619
558 Ga0439436_0006530
559 Ga0439436_0245229
560 Ga0439438_013147
561 Ga0439439_0136142
562 Ga0439447_095323
563 Ga0439466_0013268
564 Ga0439465_0005196
565 Ga0451797_1314863
566 Ga0451807_0015263
567 Ga0451807_0778443
568 Ga0451853_3996971
569 Ga0439431_0117357
570 Ga0439433_0089758
571 Ga0439432_119789
572 Ga0439432_148866
573 Ga0439449_0051416
574 Ga0439449_0172961
575 Ga0439451_118648
576 Ga0450919_046649
577 Ga0450920_008058
578 Ga0450906_004243
579 Ga0450907_006649
580 Ga0450910_020950
581 Ga0439446_0315349
582 Ga0450909_067858
583 Ga0439434_0011435
584 Ga0450918_003392
585 Ga0466961_0594308
586 Ga0466963_0830388
587 Ga0466968_0030840
588 Ga0466970_0170593
589 Ga0466970_0786606
590 Ga0466957_1296535
591 Ga0466960_0369560
592 Ga0466960_0848776
593 Ga0466959_1149578
594 Ga0495638_0061409
595 Ga0495638_0074143
596 Ga0495651_0394615
597 Ga0495663_0359549
598 Ga0495652_0561044
599 Ga0495587_0317272
600 Ga0495667_0208292
601 Ga0495625_0389195
602 Ga0495635_0236773
603 Ga0495599_0771986
604 Ga0495672_0470785
605 Ga0495675_0473536
606 Ga0495684_0486488
607 Ga0495686_0092995
608 Ga0495602_0080832
609 Ga0496102_0429873
610 Ga0496102_0904929
611 Ga0496102_1512331
612 Ga0496103_0305806
613 Ga0496104_0742751
614 Ga0496106_0124317
615 Ga0496107_0283904
616 Ga0496108_1039652
617 Ga0496108_1101999
618 Ga0496112_0438593
619 Ga0496113_0948183
620 Ga0496114_0561734
621 Ga0496115_0817952
622 Ga0496122_0144771
623 Ga0496123_0324595
624 Ga0496126_0603240
625 Ga0496126_1003119
626 Ga0495682_0001266
627 Ga0501031_0000015
628 Ga0501031_0098435
629 Ga0501031_0429440
630 Ga0501031_0625864
631 Ga0501031_0802994
632 Ga0501032_0000008
633 Ga0501032_0010141
634 Ga0501032_0139395
635 Ga0501032_0203007
636 Ga0501032_0293362
637 Ga0501033_0000012
638 Ga0501033_0007706
639 Ga0501033_0096575
640 Ga0501033_0125189
641 Ga0501033_0278409
642 Ga0501033_0304282
643 Ga0501034_0000035
644 Ga0501034_0034982
645 Ga0501034_0128348
646 Ga0501034_0447089
647 Ga0501034_0706317
648 Ga0501034_1418265
649 Ga0501036_0000006
650 Ga0501036_0014674
651 Ga0501036_0119922
652 Ga0501036_0255434
653 Ga0501036_0276831
654 Ga0501037_0000123
655 Ga0501037_0030124
656 Ga0501037_0214533
657 Ga0501037_0445525
658 Ga0501037_0514578
659 Ga0501037_0834611
660 Ga0501037_1018810
661 Ga0501038_0000007
662 Ga0501038_0032333
663 Ga0501038_0132179
664 Ga0501038_0206031
665 Ga0501038_0224976
666 Ga0501039_0000012
667 Ga0501039_0060915
668 Ga0501039_0156446
669 Ga0501039_0230676
670 Ga0501039_1452054
671 Ga0501040_0021997
672 Ga0501040_0040457
673 Ga0501040_0097193
674 Ga0501041_0077702
675 Ga0501042_0024135
676 Ga0501042_0046528
677 Ga0501042_0587683
678 Ga0501043_0000432
679 Ga0501043_0031636
680 Ga0501043_0044899
681 Ga0501043_0123552
682 Ga0501043_0494299
683 Ga0501043_1231598
684 Ga0501046_0010146
685 Ga0501046_0129531
686 Ga0501046_0345093
687 Ga0501046_0363943
688 Ga0501046_0492793
689 Ga0501047_0045298
690 Ga0501047_0097057
691 Ga0501047_0191454
692 Ga0501047_0214737
693 Ga0501047_0315884
694 Ga0501047_0615067
695 Ga0501047_0848355
696 Ga0501047_0911632
697 Ga0501048_0033655
698 Ga0501048_0042101
699 Ga0501048_0732195
700 Ga0501067_0041896
701 Ga0501067_0056268
702 Ga0501067_0359957
703 Ga0501067_0674664
704 Ga0501068_0256852
705 Ga0501069_0077427
706 Ga0501069_0089062
707 Ga0501070_0098094
708 Ga0501070_0115559
709 Ga0501070_0149895
710 Ga0501070_0194437
711 Ga0501070_0541775
712 Ga0501070_0766217
713 Ga0501070_0967518
714 Ga0501070_1281064
715 Ga0501071_0010741
716 Ga0501071_0060024
717 Ga0501072_0009586
718 Ga0501072_0025426
719 Ga0501072_0784390
720 Ga0501072_1566745
721 Ga0501073_0213169
722 Ga0501073_1134957
723 Ga0501074_0037257
724 Ga0501074_0071296
725 Ga0501074_0217584
726 Ga0501074_1344751
727 Ga0501075_0016758
728 Ga0501075_0047310
729 Ga0501076_0015876
730 Ga0501076_0339518
731 Ga0501077_0017381
732 Ga0501077_0075473
733 Ga0501077_0664537
734 Ga0501079_0049728
735 Ga0501079_0055899
736 Ga0501079_0179271
737 Ga0501080_0032369
738 Ga0501080_0034712
739 Ga0501080_0038923
740 Ga0501080_0180795
741 Ga0501080_0236748
742 Ga0501080_1102591
743 Ga0501080_1196356
744 Ga0501080_1368741
745 Ga0501081_0042779
746 Ga0501081_0471374
747 Ga0501081_0599281
748 Ga0501083_0054563
749 Ga0501083_0085947
750 Ga0501083_0089675
751 Ga0501083_0284674
752 Ga0501083_0504911
753 Ga0501083_1138444
754 Ga0501035_0000035
755 Ga0501035_0024680
756 Ga0501035_0037725
757 Ga0501035_0158104
758 Ga0501035_1131231
759 Ga0501035_1307363
760 Ga0501035_1464424
761 Ga0501044_0000015
762 Ga0501044_0022334
763 Ga0501044_0023779
764 Ga0501044_0037120
765 Ga0501044_0046716
766 Ga0501044_0457079
767 Ga0501044_0565334
768 Ga0501044_0934703
769 Ga0501044_1552271
770 Ga0501045_0004002
771 Ga0501045_0123072
772 Ga0501045_0322827
773 nmdc:mga0yw44_452737_c1
774 nmdc:mga0k408_139021_c1
775 nmdc:mga0k408_891157_c1
776 nmdc:mga05p37_1732915_c1
777 Ga0495601_0203507
778 Ga0495612_0117970
779 Ga0495655_0014530
780 Ga0495595_0554409
781 Ga0495619_0811440
782 Ga0500644_0028799
783 Ga0500608_014233
784 Ga0500559_0002561
785 Ga0500568_0044558
786 Ga0500577_0385316
787 Ga0500604_0132157
788 Ga0500616_0078229
789 Ga0500619_261039
790 Ga0500622_0000323
791 Ga0500627_0072706
792 Ga0500627_0196307
793 Ga0500627_0218945
794 Ga0500627_0244346
795 Ga0501084_0013768
796 Ga0501084_0025016
797 Ga0501084_0110835
798 Ga0501084_0129703
799 Ga0501084_0278794
800 Ga0501084_0812394
801 Ga0501084_1744146
802 Ga0501082_0058728
803 Ga0501082_0106284
804 Ga0501082_0131521
805 Ga0501082_0609812
806 2508734381
807 2509074919
808 2513996294
809 2585394781
810 2596372225
811 2643774630
812 2643793075
813 2644495458
814 2835317554
815 2842521252
816 2889310839
817 2902336593
818 2902406800
819 2917557900
820 2920763728
821 2928126918
822 8054568131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01649

Ribosomal_S20p

Ribosomal protein S20

12

94

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nn4-assembly1.cif.gz_A crystal structure of bacillus subtilis yqgq, pfam duf910 0.986 42 77
3zg7-assembly1.cif.gz_B crystal structure of penicillin-binding protein 4 from listeria monocytogenes in the apo form 0.959 42 68
4v8s-assembly1.cif.gz_AJ archaeal rnap-dna binary complex at 4.32ang 0.9312 42 81
3vmq-assembly1.cif.gz_A crystal structure of staphylococcus aureus membrane-bound transglycosylase: apoenzyme 0.9069 41 71
3vms-assembly1.cif.gz_A crystal structure of staphylococcus aureus membrane-bound transglycosylase in complex with nbd-lipid ii 0.8869 41 71
ID Description Score Start End Superfamily
af_Q58196_1_186_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9707 43 77 3.40.50.1980
af_O96151_9_341_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.9104 41 71 2.60.40.150
3vmqA00 Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like 0.9069 41 71 1.10.3810.10
af_A0A096R4D2_802_949_1.25.40.90 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.8862 40 71 1.25.40.90
af_I1JFC3_828_964_1.25.40.90 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.87 41 71 1.25.40.90
ID Description Score Start End GO Terms
AF-A0A2N8IU79-F1-model_v4 deleted 0.9791 13 71
AF-A0A366H6C6-F1-model_v4 Uncharacterized protein 0.9197 18 77
AF-A0A1M6CRV1-F1-model_v4 Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase 0.9056 17 78 GO:0004040
AF-A0A6N3RWF1-F1-model_v4 deleted 0.8609 30 79
AF-F7X050-F1-model_v4 Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen 0.7772 3 79 GO:0016491
GO:0017004

Map